FREE patent keyword monitoring and additional FREE benefits. /images/triangleright (1K) REGISTER now for FREE triangleleft (1K)
Fresh Patents
Monitor Patents Patent Organizer File a Provisional Patent Browse Inventors Browse Industry Browse Agents Browse Locations


Drug, Bio-affecting And Body Treating Compositions > Designated Organic Active Ingredient Containing (doai) > Peptide Containing (e.g., Protein, Peptones, Fibrinogen, Etc.) Doai > Cyclopeptides > 25 Or More Peptide Repeating Units In Known Peptide Chain Structure

25 Or More Peptide Repeating Units In Known Peptide Chain Structure

25 Or More Peptide Repeating Units In Known Peptide Chain Structure patent applications listed are from June 2005 to current and include Date, Patent Application Number, Patent Title, Patent Abstract summary and are linked to the corresponding patent application page.

03/01/07 - 20070049532 - Modified peptides as therapeutic agents
The present invention concerns fusion of Fc domains with biologically active peptides and a process for preparing pharmaceutical agents using biologically active peptides. In this invention, pharmacologically active compounds are prepared by selecting a peptide that modulates the activity of a protein of interest and preparing a pharmacologic agent having ...

03/01/07 - 20070049531 - Glp-1 agonist and cardiovascular complations
Methods and uses for the treatment and prevention of cardiac and cardiovascular diseases comprising administration of a GLP-1 agonist. ...

03/01/07 - 20070049530 - Cytokine receptor zcytor17 multimers
Novel polypeptide combinations, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed for zcytor17-containing multimeric or heterodimer cytokine receptors that may be used as novel cytokine antagonists, and within methods for detecting ligands that stimulate the proliferation and/or development of hematopoietic, lymphoid and myeloid cells in vitro and ...

03/01/07 - 20070049529 - Cytokine zalpha11 ligand
Antibodies that bind to polypeptides and peptides comprising the sequence of zalpha11 Ligand as shown in SEQ ID NO: 2 are described. The antibodies may bind the full length sequence of 162 amino acid residues or a fragment thereof, including a mature polypeptide of 131 amino acid residues and smaller ...

03/01/07 - 20070049528 - Nucleic acid encoding cytokine receptor zcytor17
Novel polypeptides, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed for zcytor17, a novel cytokine receptor. The polypeptides may be used within methods for detecting ligands that stimulate the proliferation and/or development of hematopoietic, lymphoid and myeloid cells in vitro and in vivo. Ligand-binding receptor polypeptides can ...

03/01/07 - 20070049527 - Nucleic acid encoding cytokine receptor zcytor17
Novel polypeptides, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed for zcytor17, a novel cytokine receptor. The polypeptides may be used within methods for detecting ligands that stimulate the proliferation and/or development of hematopoietic, lymphoid and myeloid cells in vitro and in vivo. Ligand-binding receptor polypeptides can ...

03/01/07 - 20070049526 - Uses of human zven proteins and polynucleotides
The present invention provides methods of using Zven1 and Zven2 polypeptides to increase chemokine production. The present invention also provides methods for treating intestinal motility disorders and improving gastrointestinal function with Zven1 and Zven2 polypeptides. ...

03/01/07 - 20070049525 - Soluble zcytor21, anti-zcytor21 antibodies and binding partners and methods of using in inflammation
The present invention relates ZcytoR21 antagonists, such as soluble receptors and anti-ZcytoR21 antibodies, that are useful in blocking, inhibiting, reducing, antagonizing or neutralizing the activity of IL-17C. IL-17C is a cytokine that is involved in inflammatory processes and human disease. ZcytoR21 is a receptor for IL-17C. The present invention includes ...

03/01/07 - 20070049524 - Soluble zcytor21, anti-zcytor21 antibodies and binding partners and methods of using in inflammation
The present invention relates ZcytoR21 antagonists, such as soluble receptors and anti-ZcytoR21 antibodies, that are useful in blocking, inhibiting, reducing, antagonizing or neutralizing the activity of IL-17C. IL-17C is a cytokine that is involved in inflammatory processes and human disease. ZcytoR21 is a receptor for IL-17C. The present invention includes ...

03/01/07 - 20070049523 - Liquid composition of modified factor vii polypeptides
The invention provides a liquid, aqueous composition, comprising (i) a modified factor VII polypeptide; (ii) an agent suitable for keeping pH in the range of from about 4.0 to about 8.0; (iii) an antioxidant; and (iv) an agent selected from the list of: a calcium salt, a magnesium salt, or ...

03/01/07 - 20070049522 - Kallikrein-inhibitor therapies
Methods are described for preventing or reducing ischemia, e.g., cerebral ischemia, and/or reperfusion injury, e.g., reperfusion injury associated with cerebral ischemia, in a patient. ...

03/01/07 - 20070049521 - Method of use of specific natriuretic peptide receptor c ligands, transgenic non-human mammals expressing specific natriuretic peptide receptor c antagonists and cells thereof
A method of using an osteocrin (Ostn) or a NPR-C specific Ostn peptide derivative for increasing osteogenesis in a mammal comprising administering a therapeutically effective amount of said Ostn or NPR-C specific Ostn peptide derivative to the mammal. ...

02/22/07 - 20070042961 - Activated protein c variants with normal cytoprotective activity but reduced anticoagulant activity
Variants (mutants) of recombinant activated protein C (APC) or recombinant protein C (prodrug, capable of being converted to APC) that have substantial reductions in anticoagulant activity but that retain normal levels of anti-apoptotic activity are provided. Three examples of such recombinant APC mutants are KKK191-193AAA-APC, RR229/230AA-APC, and RR229/230AA plus KKK191-193AAA-APC. ...

02/22/07 - 20070042960 - Methods of using zven proteins
The present invention provides novel uses two members of a new family of human proteins, designated as “Zven,” as agents that stimulate gastrointestinal contractility, gastric emptying, intestinal transit, and treating gastroparesis The Zven1 gene, which resides in human chromosome 3p21.1-3p14.3, is expressed in testicular tissue and peripheral blood lymphocytes. The ...

02/22/07 - 20070042959 - Thrombin-inhibiting peptides
Peptides of Formula I are useful for therapeutic purposes, among others. ...

02/22/07 - 20070042958 - Lefty, lefty derivatives and uses thereof
The disclosure relates to Lefty derivatives and the uses of Lefty polypeptides as antagonists of the function of certain ligands such as Nodal, GDF-8 (Myostatin), and GDF-11. These derivatives may be fused to other functional heterologous proteins such as IgG, especially the Fc portion of IgG. According to the disclosure, ...

02/22/07 - 20070042957 - Type v phosphodiesterase inhibitors and natriuretic polypeptides
This document provides methods and materials related to PDE V inhibitors, natriuretic polypeptides, and combinations thereof. For example, compositions containing one or more PDE V inhibitors in combination with one or more natriuretic polypeptides are provided herein. In addition, methods for using PDE V inhibitors, natriuretic polypeptides, and combinations thereof ...

02/22/07 - 20070042956 - Novel glp-1 compounds
Novel GLP-1 compounds and their therapeutic use. ...

02/22/07 - 20070042955 - Abuse-resistant amphetamine prodrugs
The invention describes compounds, compositions, and methods of using the same comprising a chemical moiety covalently attached to amphetamine. These compounds and compositions are useful for reducing or preventing abuse and overdose of amphetamine. These compounds and compositions find particular use in providing an abuse-resistant alternative treatment for certain disorders, ...

02/22/07 - 20070042954 - Compositions and methods related to soluble g-protein coupled receptors (sgpcrs)
The present invention is directed to compositions and methods related to soluble G-protein coupled receptors (sGPCR). In ceratin aspects the invention includes compositions and methods related to a soluble corticotropin releasing factor receptor related protein, sCRFR2, as well as its effects on CRFR signaling and interaction between CRF family ligand ...

02/22/07 - 20070042953 - Antiepileptogenic complex of albumin with docosahexaenoate
The infusion of an albumin-docosahexaenoic acid (DHA) complex was shown to inhibit the progression of kindling epileptogenesis. This was shown in mice using kindling as the experimental epilepsy model. The DHA-albumin complex was shown to affect the activity of the brain when administered intraperitoneally. This therapy could also be administered ...

02/22/07 - 20070042952 - Analogues of glp-1
Disclosed are peptide analogues of glucagon-like peptide-1, the pharmaceutically-acceptable salts thereof, methods of using such analogues to treat mammals and pharmaceutical compositions useful therefor comprising said analogues. ...

02/22/07 - 20070042951 - Pharmaceutical compositions comprising alpha-2-adrenergics and trefoil factor family peptides
Disclosed herein are dosage forms comprising an alpha-2-adrenergic agonist and a trefoil factor family peptide. Related to these dosage forms are methods of treating glaucoma or reducing intraocular pressure and methods of treating gastrointestinal disorders. ...

02/22/07 - 20070042950 - Antagonistic analogs of gh rh (2003)
There is provided a novel series of synthetic antagonistic analogs of hGH-RH(1-29)NH2. These analogs inhibit the activity of endogenous hGH-RH on the pituitary GH-RH receptors, and therefore prevent the release of growth hormone. The analogs also inhibit the proliferation of human cancers through a direct effect on the cancer cells. ...

02/22/07 - 20070042949 - Pharmaceutical compositions comprising an epitope of platelet gpiiia protein
The present invention relates to a pharmaceutical composition for the prevention or management of a condition caused by exposure to an antithetical allele of a platelet by tolerisation, the composition comprising an immunologically effective platelet protein or peptide fragment thereof. ...

02/22/07 - 20070042948 - Vav inhibition in graft rejection
The present invention provides a method for preventing or treating acute or chronic graft rejection in a recipient of cell, tissue or organ allo- or xenotransplant, inflammatory or autoimmune diseases or malignant proliferative disease, comprising the use of an inhibitor of Vav. Further provided are Vav inhibitors, uses, pharmaceutical compositions ...

02/22/07 - 20070042947 - Agents for preventing and/or treating uppper digestive tract disorders
A compound or its salts that inhibit the activity of the polypeptide or receptor of the present invention and the antibody of the present invention as well as the antisense DNA of the present invention are useful as, e.g., gastric acid secretion inhibitors, mucosa protectants, mineral absorption promoters, etc., which ...

02/22/07 - 20070042946 - Peptide inhibitors of thrombin as potent anticoagulants
The tetrapeptide Phe-Asn-Pro-Arg is a structurally-optimized sequence for binding to the active site of thrombin. By conjugating this tetrapeptide or variants thereof to a C-terminal fragment of hirudin, we were able to generate a series of new multivalent inhibitors of thrombin containing only genetically encodable natural amino acids. We found ...

02/22/07 - 20070042945 - Nouvelles compositions et methods de traitement du psoriasis
The present invention relates to compositions and methods useful for the diagnosis and treatment of psoriasis. ...

02/22/07 - 20070042944 - Processes for the preparation of fibrinogen
The present invention relates to processes for the purification of fibrinogen, and to readily solubilised fibrinogen preparations. ...

02/15/07 - 20070037750 - Methods for glucagon suppression using modified exendins
Methods for use of an exendin, an exendin agonist, or a modified exendin or exendin agonist having an exendin or exendin agonist linked to one or more polyethylene glycol polymers, for example, for lowering glucagon levels and/or suppressing glucagon secretion in a subject are provided. These methods are are useful ...

02/15/07 - 20070037749 - Therapeutic fibrin-derived peptides and uses thereof
The invention relates to peptides having the general formula (I), or a salt or amide thereof, wherein R1 and R2 are either the same or different, wherein R1 and R2 are each selected from the group consisting of hydrogen and a saturated or unsaturated hydrocarbon residue, said residue having from ...

02/15/07 - 20070037748 - Methods of treating diseases with a vegf antagonist
A method of reducing or preventing hypertension associated with administration of a vascular endothelial growth factor (VEGF) antagonist in a human subjects suffering from a disease or condition treatable with a VEGF antagonist in which is it desirable to reduce or prevent hypertension. The method is particularly useful for treatment ...

02/15/07 - 20070037747 - Exendin 4 polypeptide fragment
The present invention relates to an Exendin 4 polypeptide fragment, which has hypoglycemic activity, and can be used for the treatment of type II diabetes mellitus. The polypeptide sequence described herein is HGEGTX1TSDLSKQX2EEEAVX3LFIEWLKNGX4PX5, where X1 represents Phe or Tyr, X2 represents Met, Ile or Leu, X3 represents Lys, X4 represents ...

02/15/07 - 20070037746 - Novel compounds
The present invention relates to novel coagulation factor FVIIa polypeptides. ...

02/15/07 - 20070037745 - Nucleic acid and corresponding protein entitled 213p1f11 useful in treatment and detection of cancer
A novel gene (designated 213P1F11) and its encoded protein, and variants thereof, are described wherein 213P1F11 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 213P1F11 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 213P1F11 gene ...

02/15/07 - 20070037744 - Human cathelicidin antimicrobial peptides
Provided are peptide and peptide consensus sequences, which inhibit bacterial growth and/or viral growth and mimic the activity of LL-37, CRAMP, and/or FALL-39. The peptides are useful as antimicrobials, anti-inflammatories and anti-viral agents. ...

02/15/07 - 20070037743 - Novel conotoxin modulating sodium channels
A 26 residue peptide (Am2766) with the sequence CKQAGESCDIFSQNCCVGTCAFICIE-NH2 has been isolated and purified from the venom of the molluscivorous snail, Conus amadis, collected of the southeastern coast of India. Chemical modification and mass spectrometric studies establish that Am2766 has three disulfide bridges. Cterminal amidation has been demonstrated by mass ...

02/15/07 - 20070037742 - Use of follicle stimulating hormone for reduction of spermatozoa chromosomal aberration in males
The present invention relates to the use of a substance having a FSH activity for reducing gamete chromosomal alterations in a male, more specifically in men suffering from spermatozoa aneuploidy. ...

02/15/07 - 20070037741 - Novel compositions and methods for the treatment of immune related disease
The present invention relates to compositions containing a novel protein and methods of using those compositions for the diagnosis and treatment of immune related disease. ...

02/15/07 - 20070037740 - Combination therapy with glatiramer acetate and alphacalcidol for the treatment of multiple sclerosis
The subject invention provides a method of treating a subject afflicted with a form of multiple sclerosis comprising periodically administering to the subject an amount of glatiramer acetate and an amount of alphacalcidol, wherein the amounts when taken together are effective to alleviate a symptom of the form of multiple ...

02/15/07 - 20070037739 - Compounds useful in coating stents to prevent and treat stenosis and restenosis
At least one bioactive agent is locally delivered to a location where a stent is implanted within a lumen in a patient's body. The bioactive agent includes a: DNA minor groove binder (such as CC-1065 or Duocarmycin); apocynin; RGD peptide (such as RGDfV); stilbene compound (such as resveratrol); camptothecin; des-aspartate ...

02/08/07 - 20070032429 - Methods of using retro-inverso peptides derived from interleukin-6
This invention provides methods of treatment using retro-inverso peptides derived from interleukin-6 (IL-6) having between 15 and about 40 amino acids, and including the sequence that is retro-inverso with respect to SEQ ID NO: 1, i.e. wherein said peptide comprises the sequence D-Glu-D-Ala-D-Met-D-Lys-D-Pro-D-Leu-D-Asn-D-Leu-D-Asn-D-Asn-D-Glu-D-Ala-D-Leu-D-Ala-D-Glu. The peptides of the invention have the ...

02/08/07 - 20070032428 - Novel antimicrobial agents
A novel class of antimicrobial polymeric agents which are designed to exert antimicrobial activity while being stable, non-toxic and avoiding development of resistance thereto and a process of preparing same are disclosed. Further disclosed are pharmaceutical compositions containing same and a method of treating medical conditions associated with pathological microorganisms, ...

02/08/07 - 20070032427 - Methods and compositions for preserving the viability of photoreceptor cells
Provided are methods and compositions for maintaining the viability of photoreceptor cells following retinal detachment. The viability of photoreceptor cells can be preserved by administering a neuroprotective agent, for example, a substance capable of suppressing endogenous calcineurin or constitutively active calcineurin, inhibiting cleavage of calcineurin to constitutively active calcineurin, and/or ...

02/08/07 - 20070032426 - Therapeutic and diagnostic methods for ulcerative colitis and associated disorders
This invention relates to the field of therapy and diagnostic methods for ulcerative colitis. Specifically, the method comprises administering a compound or recombinant protein that inhibits interaction between CEP and human tropomyosin. Also included in the invention are methods to screen for drugs useful in treating ulcerative colitis and diagnostic ...

02/08/07 - 20070032425 - Compositions for diabetes treatment and prophylaxis
Gurmarin containing compositions are useful for modulation of glucose metabolism and the treatment of diabetes. Glucose metabolism in a human patient is regulated by isolated gurmarin-containing dosage forms that contain optionally a non-metabolizable polysaccharide such as the exudate of Sterculia urens. ...

02/08/07 - 20070032424 - Stimulators of factor x activated (fxa) as new topical antihemorrhagic agents
The activated coagulation Factor X (FXa) stimulating agents may be used in the treatment of hemorrhages in a subject. Compounds and combinations are described which are particularly useful for the topical treatment of hemorrhaging in healthy subjects or in patients with hemorrhagic diathesis. ...

02/08/07 - 20070032423 - Methods and compositions for modulating somatolactogenic functions
Compositions containing cyclophilin B, mutants of cyclophilin B or inhibitors of cyclophilin B and methods of using these compositions to modulate somatolactogenic function are provided. ...

02/08/07 - 20070032422 - Methods, compositions and articles of manufacture for contributing to the treatment of cancers
Methods, compositions and articles of manufacture for contributing to the treatment of cancers, including solid tumors, are disclosed. The methods, compositions and articles of manufacture can utilize an endothelin B agonist (ETB) to enhance the delivery and resulting efficacy of a chemotherapeutic agent. ...

02/08/07 - 20070032421 - Methods and compositions relating to cystatin c
A method of treating amyloidoses by administering an effective amount of a cystatin C composition. A method of preventing and inhibiting Aβ oligomerization by administering an effective amount of a cystatin C composition. A composition for inhibiting Aβ oligomerization including an effective amount of a cystatin C composition. A method ...

02/08/07 - 20070032420 - Treating diabetes with glucagon-like peptide-1 secretagogues
In general this invention can be viewed as encompassing novel methods of treating diabetes and insulin resistance. The inventors have made the discovery that increasing secretion of endogenous glucagon-like peptide-1 (GLP-1) in combination with inhibiting the activity of dipeptidyl peptidase I (DPP-IV) can have a significant impact on hyperglycemia and ...

02/08/07 - 20070032419 - Fusion polypeptides, and use thereof in antivascular tumor therapy
The present invention relates to fusion polypeptides, comprising at least two peptides. The invention further relates to the use of these fusion proteins in antivascular therapy of neoplastic diseases and to their use I the production of a drug for the treatment of neoplastic diseases. ...

02/08/07 - 20070032418 - Small-molecule inhibitors of angiogenin and rnases and in vivo and in vitro methods of using same
Lead compounds were obtained in a high throughput screen (HTS) of angiogenin (ANG; a potent inducer of angiogenesis) enzyme activity, an RNase. One lead was shown to delay appearance of tumors in an animal tumor system, and to reduce the number of animals having tumors. Several lead compound analogs were ...

02/08/07 - 20070032417 - Peptides and therapeutic uses thereof
Conformationally constrained peptides that mimic BH3-only proteins, compositions containing them and their use in the regulation of cell death are disclosed. The conformationally constrained peptides are capable of binding to and neutralising pro-survival Bcl-2 proteins. Processes for preparing the conformationally constrained peptides and their use in the treatment and/or prophylaxis ...

02/08/07 - 20070032416 - Chorionic somatomammotropin hormone splice variants
This invention relates to novel proteins, termed INSP100 and INSP104, herein identified as novel splice variants of human Chorionic somatomammotropin hormone 2 (hCS-B; Q14407) and human Chorionic somatomammotropin hormone 1 (hCS-A; P01243) respectively and to the use of these proteins and nucleic acid sequences from the encoding genes in the ...

02/08/07 - 20070032415 - Compositions, splice variants and methods relating to breast specific genes and proteins
The present invention relates to newly identified nucleic acid molecules and polypeptides present in normal and neoplastic breast cells, including fragments, variants and derivatives of the nucleic acids and polypeptides. The present invention also relates to antibodies to the polypeptides of the invention, as well as agonists and antagonists of ...

02/08/07 - 20070032414 - Human secreted proteins
The present invention relates to human secreted polypeptides, and isolated nucleic acid molecules encoding said polypeptides, useful for diagnosing and treating cardiovascular diseases, disorders, and/or conditions related thereto. Antibodies that bind these polypeptides are also encompassed by the present invention. Also encompassed by the invention are vectors, host cells and ...

02/08/07 - 20070032413 - Human secreted proteins
The present invention relates to human secreted polypeptides, and isolated nucleic acid molecules encoding said polypeptides, useful for diagnosing and treating diseases, disorders, and/or conditions related to said human secreted proteins. Antibodies that bind these polypeptides are also encompassed by the present invention. Also encompassed by the invention are vectors, ...

02/01/07 - 20070027085 - Microencapsulation and sustained release of biologically active polypeptides
This invention relates to compositions for the sustained release of biologically active polypeptides, and methods of forming and using said compositions, for the sustained release of biologically active polypeptides. The sustained release compositions of this invention comprise a biocompatible polymer having dispersed therein, a biologically active polypeptide, a sugar and ...

02/01/07 - 20070027084 - Novel integrin ligand itgl-tsp
ITGL-TSP polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques are disclosed. Also disclosed are methods for utilizing ITGL-TSP polypeptides and polynucleotides in the design of protocols for the treatment of, angiogenic diseases (cancer, cancer metastasis, chronic inflammatory disorders, rheumatoid arthritis, atherosclerosis, macular degeneration, diabetic retmopathy), restenosis, ...

02/01/07 - 20070027083 - Human growth hormone aqueous formulation
A stable pharmaceutically acceptable aqueous formulation containing human growth hormone, a buffer, a non-ionic surfactant, and, optionally, a neutral salt, mannitol, or, a preservative, is disclosed. Also disclosed are associated means and methods for preparing, storing, and using such formulations. ...

02/01/07 - 20070027082 - Intracellular interleukin-1 receptor antagonist and uses thereof
Matrix metalloproteinases are major mediators of tissue destruction in various chronic inflammatory disorders. The present invention demonstrates that over- expression of intracellular isoform of IL-1 receptor antagonist confers to recipient cells resistance to signaling pathways of proinflammatory cytokines (such as tumor necrosis factor alpha and IL-1 beta) that induce matrix ...

02/01/07 - 20070027081 - Mechanisms of osteoinduction by lim mineralization protein-1 (lmp-1)
The present invention relates to the methods and compositions for the treatment of subjects having compromised bone conditions. Specifically, the invention relates to combinatorial therapeutic strategies including small molecules and peptide mimics of LIM mineralization proteins, particularly LMP-1, to overcome the dose-related translational barriers for BMP-2 therapeutics. ...

02/01/07 - 20070027080 - Method for treatment of vitiligo
Synergistic therapies for the treatment of vitiligo are provided. The major therapies for the treatment of vitiligo—a pigmentary disorder characterized by patchy depigmentation of skin are Psoralens plus UV-A, steroids. Basic fibroblast growth (bFGF) peptide lotion or surgical procedures. Psoralens plus UV-A is effective in about 50% of cases, steroids ...

02/01/07 - 20070027079 - Ghrp 2 strips
The products that exist on the market today that produce the same results are with injection. This new product, HGH Strips, is taken orally through strips that are placed on the back of the toungue. HGH Strips is scientifically developed with GHRP-2 (Growth Hormone Releasing Peptide-2), L-Lysine, L-Argenin and L-Valine ...

02/01/07 - 20070027078 - Isolated proteins from a traditional chinese medicine yuzhu and use thereof
Disclosed is an isolated protein from the Chinese medicinal herb, Yuzhu, Polygonatum odoratum (Liliaceae). The protein disclosed is an effective agent showing potent antiviral activities while demonstrating antiproliferative effect on HL-60 leukemia and MCF-7 breast cancer cell lines in vitro. A method of obtaining the target protein and use thereof ...

02/01/07 - 20070027077 - Pharmaceutical compositions comprising factor vii polypeptides and factor xi polypeptides
Compositions comprising a factor VII or factor VII-related polypeptide and a factor XI or factor XI-related polypeptide, kits comprising the same, and methods of using such compositions (e.g., in the treatment of bleeding conditions) are provided ...

02/01/07 - 20070027076 - Use of fumaric acid derivatives for treating cardiac insufficiency, and asthma
According to a first aspect the invention relates to the use of fumaric acid derivatives selected from the group consisting of dialkyl fumarates, monoalkyl hydrogen fumarates, fumaric acid monoalkyl ester salts, fumaric acid monoamides, monoamido fumaric acid salts, fumaric acid diamides, monoalkyl monoamido fumarates, carbocyclic and oxacarbocyclic oligomers of these ...

02/01/07 - 20070027075 - Compositions and methods for targeted drug delivery
The present invention provides for methods and compositions for transporting agents and macromolecules across biological membranes. In one embodiment, the invention relates to a method for enhancing transport of a selected agent across a biological membrane, wherein a biological membrane is contacted with a composition containing a biologically active rotaxane ...

02/01/07 - 20070027074 - Novel peptides that bind to the erythropoietin receptor
The present invention relates to peptide compounds that are agonists of the erythropoietin receptor (EPO-R). The invention also relates to therapeutic methods using such peptide compounds to treat disorders associated with insufficient or defective red blood cell production. Pharmaceutical compositions, which comprise the peptide compounds of the invention, are also ...

02/01/07 - 20070027073 - Long-acting derivatives of pyy agonists
The invention provides a PYY agonist derivative of the formula: (X)n-Z, wherein X is a radical 9-fluorenylmethoxy-carbonyl (Fmoc) or 2-sulfo-9-fluorenyl-methoxycarbonyl (FMS), Z is the residue of a PYY agonist linked to the radical X through an amino or hydroxyl group, and n is 1 to 3, or a pharmaceutically acceptable ...

01/25/07 - 20070021344 - Stabilized teriparatide solutions
A stabilized pharmaceutical composition in the form of a solution for parenteral administration of a parathyroid hormone is described wherein the therapeutically active ingredient is stabilized with a buffer and a polyol. Preferred preparations contain in an aqueous solution human PTH (1-34), mannitol, an acetate or tartrate buffering agent and ...

01/25/07 - 20070021343 - Stabilized teriparatide solutions
A stabilized pharmaceutical composition in the form of a solution for parenteral administration of a parathyroid hormone is described wherein the therapeutically active ingredient is stabilized with a buffer and a polyol. Preferred preparations contain in an aqueous solution human PTH(1-34), mannitol, an acetate or tartrate buffering agent and m-cresol ...

01/25/07 - 20070021342 - Wound healing
Methods for accelerating and/or improving wound healing in a subject by administering vascular endothelial growth factor (VEGF) are provided. ...

01/25/07 - 20070021341 - Treatment of autoimmune conditions with copolymer 1 and related copolymers
The present invention is directed to polypeptides containing at least three amino acids randomly joined in a linear array; wherein at least one of the three amino acids is an aromatic amino acid, at least one of the three amino acids is a charged amino acid and at least one ...

01/25/07 - 20070021340 - Use of blood coagulation factor xiii for treating hemophilia a
A patient having hemophilia A is treated by administering factor XIII generally in conjunction with factor VIII or desmopressin. ...

01/25/07 - 20070021339 - Glp-1 pharmaceutical compositions
The present invention is directed to peptide analogues of glucagon-like peptide-1, the pharmaceutically-acceptable salts thereof, to methods of using such analogues to treat mammals and to pharmaceutical compositions useful therefore comprising said analogues. ...

01/25/07 - 20070021338 - Stabilised compositions of factor vii
The invention relates to chemically as well as physically stable kits and compositions comprising polypeptides, in particular Factor VII or Factor VII-related polypeptides, such that these compositions can be stored, handled and used at room temperature. ...

01/25/07 - 20070021337 - Novel agent for inducing apoptosis comprising msx1 or a gene encoding the same as an active ingredient
The present invention relates to a novel use of Msx1 protein or a nucleotide encoding the same for inducing apoptosis. The Msx1 of the present invention induces apoptosis through direct interaction with p53 via a homeodomain and such interaction leads to increased stability, and/or nuclear localization of p53 in cells. ...

01/25/07 - 20070021336 - Use of glp-1 and agonists thereof to prevent cardiac myocyte apoptosis
The present invention relates generally to the novel use of GLP-1, including analogs, and agonists, to prevent cardiac myocyte apoptosis. The present invention relates to methods for using GLP-1 for the treatment of conditions associated with cardiac myocyte apoptosis. The present invention further relates to improving the efficiency of cardiac ...

01/25/07 - 20070021335 - Agent for improving mental disorders
The present invention provides an agent for improving mental disorders due to cerebral dysfunction and an agent for inhibiting vascular hyperpermeability each containing a hepatocyte growth factor. The agent for improving mental disorders according to the present invention is useful in improving mental disorders, particularly decline in learning and memory ...

01/25/07 - 20070021334 - Class iii slrp agonists for the reduction of blood vessel formation
The invention relates to the use of an agent that promotes class III SLRP activity in the manufacture of a medicament for the inhibition of blood vessel formation. In addition the invention relates to the use of an agent that promotes class III SLRP activity in the manufacture of a ...

01/25/07 - 20070021333 - Pharmaceutical compositions based on anticholinergics and soluble tnf receptor fusion proteins
The present invention relates to novel pharmaceutical compositions based on anticholinergics and soluble TNF receptor fusion proteins, processes for preparing them and their use in the treatment of respiratory diseases. ...

01/25/07 - 20070021332 - Helminth-derived antigens having capacity of providing protection against parasites
The primary objective of the present invention is the development of new mutant forms of the Sm14 protein, for producing a greater production volume. The recombinant proteins here obtained were capable of providing protection against schistosome and fasciola infection. The level of protection of Sm14 recombinant proteins obtained in the ...

01/18/07 - 20070015709 - Method for treating hemophilia b
Use of factor XIII for treating hemophilia B. A patient having hemophilia B is treated by administering factor XIII, generally in conjunction with factor IX. ...

01/18/07 - 20070015708 - Methods and compositions for inhibiting tumor growth and angiogenesis
The invention provides compositions comprising angiogenesis inhibitors and RGD-containing plasma adhesion proteins in a pharmaceutical carrier. This invention also provides methods of inhibiting angiogenesis, tumor growth and metastasis by administering angiogenesis inhibitors in combination with RGD-containing plasma adhesion proteins in a pharmaceutical carrier. ...

01/18/07 - 20070015707 - Neuroprotective effect of activin in animals exposed to hypoxia/ischemia
This invention includes embodiments comprising activin and analogs of activin for neuronal rescue in patients having neurons that are subject to death and/or degradation as a result of neurological diseases. In certain embodiments, an activin receptor agonist can be useful for treating neuralogical diseases such as Alzheimer's Disease, Parkinson's Disease ...

01/18/07 - 20070015706 - Bifunctional variants of recombinant tissue-type plasminogen activator with platelet aggregation inhibitory activity
The present invention provides improved tPA variants having significantly reduced susceptibility to inhibition and increased affinity for platelet integrin as compared with the wild-type tPA. The present invention also provides compositions comprising the tPA variants and polynucleotides, vectors, and host cells for producing the same as well as methods of ...

01/18/07 - 20070015705 - Modified annexin proteins and methods for their use in platelet storage and transfusion
Modified annexin proteins, including a homodimer of human annexin V, are provided. Methods for their use, such as to prevent thrombosis without increasing hemorrhage, enhancing the survivability of platelets during storage or transfusion and to attenuate ischemia-reperfusion injury (IPI), are also provided. The modified annexins bind phosphatidylserine (PS) on cell ...

01/18/07 - 20070015704 - Nucleic acid and corresponding protein entitled 238p1b2 useful in treatment and detection of cancer
A novel gene (designated 238P1B2) and its encoded protein, and variants thereof, are described wherein 238P1B2 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 238P1B2 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 238P1B2 gene ...

01/18/07 - 20070015703 - Adamts13-containing compositions having thrombolytic activity
This invention relates to a pharmaceutical composition having thrombolytic activity comprising ADAMTS13, and to methods for treating or preventing a disorder associated with the formation and/or the presence of one or more thrombus and to methods of disintegrating one or more thrombus in a patient in need thereof. Furthermore, the ...

01/18/07 - 20070015702 - Method of treatment and/or prevention of neuropathic pain
The present invention relates to a method of treating and/or preventing neuropathic pain, comprising administering calcitonin continuously. The present invention can provide a drug effective for the treatment of various neuropathic pains. Providing a drug having an action effective on neuropathic pain and having low toxicity. An agent for treating ...

01/18/07 - 20070015701 - Macromolecular conjugates of bone morphogenetic protein-7
A modified bone morphogenetic protein (BMP, also referred to as bone morphogenic protein) composition is described. The bone morphogenetic protein, in one embodiment, is BMP-7 which is chemically modified with a hydrophilic polymer, such as poly(ethylene glycol). ...

01/18/07 - 20070015700 - Mammalian genes modulated during fasting and feeding
Genes are disclosed that are differentially-regulated during feeding and fasting cycles. These genes, and their encoded polypeptides are useful to combat obesity. ...

01/18/07 - 20070015699 - Variants of traf2 which act as an inhibitor of tnf-alpha (tnfalpha) signaling pathway
The present invention relates to variants of TRAF2 which demonstrate the ability to inhibit the TNF α signaling pathway. In particular, applicants have isolated a splice variant of TRAF2 referred to hereinafter as “TRAF2 truncated” or “TRAF2TR” and a TRAF2 expression construct with enhanced dominant negative properties, hereafter referred to ...

01/18/07 - 20070015698 - Treatment of skin, and wound repair, with thymosin beta 4
Compositions and methods for treatment of skin utilizing thymosin β4. ...

01/18/07 - 20070015697 - Enhanced ocular neuroprotection and neurostimulation
An ocular method comprising non-systemic localized ocular administration of a pharmaceutically acceptable formulation and effective concentration of at least one neurostimulatory and/or neuroprotective macrolide or other agent for a duration sufficient to enhance viability, confer protection, reduce degeneration of retinal neural cells. The method is used in a patent having ...

01/18/07 - 20070015696 - 621 human secreted proteins
The present invention relates to human secreted polypeptides, and isolated nucleic acid molecules encoding said polypeptides, useful for diagnosing and treating cancer and other hyperproliferative diseases and disorders. Antibodies that bind these polypeptides are also encompassed by the present invention. Also encompassed by the invention are vectors, host cells, and ...

01/18/07 - 20070015695 - Three-dimensional structures of tall-1 and its cognate receptors and modified proteins and methods related thereto
Disclosed are TALL-1 and TALL-1 receptor protein homologues (agonists and antagonists) designed based on the three-dimensional structure of sTALL-1, eBCMA and eBAFF-R; agonist homologues of APRIL; methods of using wild-type APRIL to inhibit the activity of TALL-1; compositions comprising such homologues, nucleic acid molecules encoding such homologues, and therapeutic methods ...

01/11/07 - 20070010449 - Method of treatment of hemorrhagic disease using a factor viia/tissue factor inhibitor
The present invention provides methods of treating hemorrhagic fevers where selective inhibitors of fVIIa/TF are used as a treatment for hemorrhagic fevers and have therapeutic effects which include ameliorating and/or preventing coagulopathy and inflammatory responses. These inhibitors include certain proteins which are part of a family termed Nematode-Extracted Anticoagulant Proteins ...

01/11/07 - 20070010448 - Drug targets in candida albicans
The present invention is concerned with the identification of genes or functional fragments thereof from Candida albicans which are critical for growth and cell division and which genes may be used as selective drug targets to treat Candida albicans associated infections. Novel nucleic acid sequences from Candida albicans are also ...

01/11/07 - 20070010447 - Methods and compounds for the treatment of mucus hypersecretion
A method of treating mucus hypersecretion, the causative factor in chronic obstructive pulmonary disease (COPD), asthma and other clinical conditions involving COPD, comprises administering a compound that inhibits exocytosis in mucus secreting cells or neurones that control or direct mucus secretion. Also described is a compound, for use in the ...

01/11/07 - 20070010446 - Methods for treating inflammation using thyroid stimulating hormone
Thyroid stimulating hormone has been shown to have anti-inflammatory activity. Polypeptides of thyroid stimulating hormone have a novel use as an anti-inflammatory agent as a stand-alone therapy, or in conjunction with other anti-inflammatory agents. In addition, thyroid stimulating hormone can be used to potentiate the anti-inflammatory activity of glucocorticoid treatment. ...

01/11/07 - 20070010445 - Administration of hypocretin-1 for treatment of narcolepsy
The invention provides compositions and methods for treatment of sleep disorders. Such methods entail administering to the patient a therapeutically effective dosage regime of an agonist of a hypocretin 1 (Hcrt-1) receptor to a peripheral tissue of the patient, and monitoring the condition of the patient responsive to the treatment, ...

01/11/07 - 20070010444 - Novel mediator of neurotransmitter and psychostimulant responses
The present invention provides polypeptides (termed “egl-28 polypeptides”) that modulate neurotransmitter- and psychostimulant-induced responses. The invention also provides methods of modulating such responses, as well as and anti-egl-28 antibodies. The invention encompasses related polynucleotides, vectors, host cells, production methods, and compositions. Moreover, the invention includes methods for prescreening or screening ...

01/11/07 - 20070010443 - Monitoring and modulating hgf/hgfr activity
Provided are methods and compositions for the modulation of hepatocyte growth factor activity to regulate lymphatic vessel development and function. Methods and composition for the monitoring and treatment of skin disorders, lymphedema, and metastatic cancers are disclosed. Also described are methods of identifying inhibitors of hepatocyte growth factor dependent lymphangiogenesis. ...

01/11/07 - 20070010442 - Inhibitor of vascular endothelial cell growth factor
The vascular endothelial cell growth factor (VEGF) inhibitors of the present invention are naturally occurring or recombinantly engineered soluble forms with or without a C-terminal transmembrane region of the receptor for VEGF, a very selective growth factor for endothelial cells. The soluble forms of the receptors will bind the growth ...

01/11/07 - 20070010441 - Random peptides that bind to gastro-intestinal tract (git) transport receptors and related methods
This invention relates to proteins (e.g., peptides) that are capable of facilitating transport of an active agent through a human or animal gastro-intestinal tissue, and derivatives (e.g., fragments) and analogs thereof, and nucleotide sequences coding for said proteins and derivatives. The proteins of the invention have use in facilitating transport ...

01/11/07 - 20070010440 - Local treatment of bone defects
A method of local treatment of specific bone defects such as osteoporosis or bone cysts comprises the step of local administration of a formulation comprising a fusion peptide containing a first domain comprising PTH or BMP 2 or BMP 7, and a second domain comprising a covalently crosslinkable substrate domain; ...

01/11/07 - 20070010439 - Production of human parathyroid hormone from microorganisms
The invention provides recombinant plasmids containing in DNA sequences coding for human preproparathyroid hormone. The invention further provides microorganisms, for example E. coli, transformed by these plasmids. The invention also provides a plasmid for insertion into yeast and a transformed yeast in which the plasmid contains DNA coding for parathyroid ...

01/11/07 - 20070010438 - Tumor treatment using beta-sheet peptides and radiotherapy
The invention relates to the use of designed β-sheet peptides together with radiation therapy for cancer treatment. The β-sheet peptides, which were designed using portions from several α-chemokines, exhibit activity as radiosensitizing agents, and have demonstrated synergism with radiation therapy for cancer treatment. The β-sheet peptides also exhibit activity as ...

01/11/07 - 20070010437 - Amino acid based compositions for the treatment of pathological conditions distinguised by insufficient mitochondrial function
Described herein are compositions suitable for the treatment of pathological conditions distinguished by ‘insufficient or reduced mitochondrial function. The compositions comprise, as principal active ingredients, the amino acids leucine, isoleucine and valine. Preferably envisaged, as further active ingredients, are the amino acids threonine and lysine, and possibly histidine, phenylalanine, methionine, ...

01/11/07 - 20070010436 - Remedy for cardiomyopathy
The present invention provides a cardiomyopathy therapeutic agent that contains hepatocyte growth factor (HGF) and gelatin hydrogel, and gradually releases HGF, which is useful in treating cardiomyopathy. ...

01/11/07 - 20070010435 - Method for treating amyloid disease
Disclosed herein are methods for treating amyloid disease in humans by clearing amyloid peptides from one or more bodily fluids such as, e.g., blood, of a patient. In particular, the methods are based on the administration capable of binding to amyloid-beta (Aβ) or on dialysis of blood or plasma exchange ...

01/11/07 - 20070010434 - Novel compositions and methods for the treatment of immune related diseases
The present invention relates to compositions containing novel proteins and methods of using those compositions for the diagnosis and treatment of immune related diseases. ...

01/11/07 - 20070010433 - Use of compounds capable of inhibiting the proteolytic processing of semaphorins for prevention, treatment, diagnosis and prognosis of an invasive disease
The present invention relates to use of compounds directed to inhibiting expression and/or proteolytic processing semaphorins SEMA3E and/or sema3E and/or activation of a receptor by a proteolytic product of said semaphorins for the manufacture of a medicament for prevention, treatment diagnosis and/or prognosis of an invasive disease. The invention features ...

01/11/07 - 20070010432 - Heat shock protein 90 activator
This invention relates the identification of a novel co-factor (termed ‘Aha1’) that interacts with the molecular chaperone Heat shock protein 90 (Hsp90) and stimulates Hsp90 activity. Various assay methods and therapeutic applications based on this interaction are provided. ...

01/04/07 - 20070004630 - Functional role of adrenomedullin (am) and the gene-related product (pamp) in human pathology and physiology
The methods of the present invention demonstrate that adrenomedullin (AM) is expressed in human cancer cell lines of diverse origin and functions as a universal autocrine growth factor driving neoplastic proliferation. The present invention provides for AM peptides and AM antibodies useful in therapeutic, pharmacologic and physiologic compositions. The present ...

01/04/07 - 20070004629 - K9 and equine joint health food supplement and method of administering
Kolla2 powder compositions, methods of preparing the compositions, and use of the compositions in treating degenerative joint diseases, joint defects, hip displasia, and osteoarthritis. The compositions are orally administered to K9's and equines in need of cartilage cell repair in a daily dietary food supplement. ...

01/04/07 - 20070004628 - Compositions and methods for nerve regeneration
This disclosure demonstrates that p45 promotes rapid regeneration of CNS nerves and axons (for example, in the corticospinal tract and/or raphespinal tract) and locomotor functional recovery following complete spinal cord transection in an adult subject. This remarkable discovery as well as disclosed mapping of p45 functional regions enables, for instance, ...

01/04/07 - 20070004627 - Compounds and methods for treatment of cancer
The invention relates to methods and compounds for treating or preventing cancer. Methods for treating or preventing cancer, for inhibiting tumor growth, reducing tumor volume, inhibiting tumor progression, inhibiting metastasis, and improving survival are provided herein. ...

01/04/07 - 20070004626 - Methods and compositions for treating degenerative bone disorders
The present disclosure provides methods and compositions using Syk inhibitory compounds for treating degenerative bone disorders and as prophylactic treatment to prevent bone loss. These treatments may reduce the fracture risk associated with bone loss and compromised bone strength. ...

01/04/07 - 20070004625 - Use of complement inhibitory proteins to treat spinal cord injury
Trauma to the spinal cord initiates an inflammatory response that results in secondary injury to the surrounding tissue, thereby exacerbating the effects of the initial injury. These secondary injury effects are contributed to, in part, by the activation of complement and the associated inflammatory reaction at the site of injury. ...

01/04/07 - 20070004624 - Methods for modulating bone tissue formation, orthogenic agents and pharmaceutical compositions
The present invention relates to in vivo and in vitro methods, agents and compound screening assays for inducing differentiation of undifferentiated mammalian cells into osteoblasts, including bone formation enhancing pharmaceutical compositions, and the use thereof in treating and/or preventing a disease involving a systemic or local decrease in mean bone ...

01/04/07 - 20070004623 - Use of hydroxylated amino acids for treating diabetes
This invention relates to methods and compositions for treating diabetes, which involve the use of hydroxylated amino acids, such as 4-hydroxyisoleucine, and one or more additional antidiabetic agents. ...

01/04/07 - 20070004622 - Imidazole derivative, process for producing the same, and use
The present invention relates to the use of a peptide that interacts with the αvβ3 integrin of endothelial cells. More particularly, the invention relates to a method for inhibiting endothelial cell adhesion, endothelial cell migration and/or angiogenesis, using a peptide consisting of at least 18 amino acids, comprising tyrosine-histidine (TY) ...

01/04/07 - 20070004621 - Bex4 nucleic acids, polypeptides, and method of using
Bex4 nucleic acids and polypeptides are provided, as are methods of using the nucleic acids and polypeptides. ...

01/04/07 - 20070004620 - Fp receptor antagonists or pgf2 alpha antagonists for treating pathological conditions of the uterus
A method of treating or preventing a pathological condition of the uterus in an female individual, the method comprising administering to the individual at least one agent that prevents PGF2α, having its effect on the FP receptor. Typically, the pathological condition is uterine cancer, fibroids or endometriosis. ...

12/28/06 - 20060293241 - Pharmaceutical composition comprising a factor vii polypeptide and epsilon-aminocaproic acid
The present invention relates to compositions or kits comprising factor VII or a factor VII-related polypeptide and epsilon-aminocaproic acid, and the use thereof for the treatment of bleeding episodes or enhancement of hemostasis. ...

12/28/06 - 20060293240 - Human sef isoforms and methods of using same for cancer diagnosis and gene therapy
A method and pharmaceutical compositions useful for inhibiting the growth of solid tumors are provided. Specifically, the method is effected by administering to a subject in need thereof an agent capable of upregulating the expression level and/or activity of at least a functional portion of Sef, wherein the functional portion ...

12/28/06 - 20060293239 - Treatment and diagnosis of insulin-resistant states
Dickkopf-5 (Dkk-5) protein is administered in effective amounts to treat disorders involving insulin resistance, such as non-insulin-dependent diabetes mellitus (NIDDM) or obesity. Also provided is a method of diagnosing insulin resistance and related disorders using Dkk-5 as a measure, and kits for diagnosis and treatment, as well as hybridomas producing ...

12/28/06 - 20060293238 - Inactivation resistant factor viii
The present invention provides novel purified and isolated nucleic acid sequences encoding procoagulant-active FVIII proteins. The nucleic acid sequences of the present invention encode amino acid sequences corresponding to known human FVIII sequences, wherein residue Phe309 is mutated. The nucleic acid sequences of the present invention also encode amino acid ...

12/28/06 - 20060293237 - Psiepsilonrack peptide composition and method for protection against tissue damage due to ischemia
A method of reducing damage to cells and tissue caused by an ischemic or hypoxic event is disclosed. The method includes administering to the cell or tissue, either in vivo or ex vivo, ψεRACK peptide. The peptide can be administered before, during or after the ischemic or hypoxic event. ...

12/28/06 - 20060293236 - Injectable osteogenic formula and method of using same
Formulations and methods for growing bone in a site specific location using an osteogenic molecule such as a prostaglandin, and a delivery vehicle which is preferably a polymer matrix. ...

12/28/06 - 20060293235 - Hgf beta chain variants
The invention provides HGF/Met modulators comprising HGF having mutations in regions that affect HGF function, and antagonists that target said regions. The invention further provides methods of identifying, making and using these modulators. ...

12/28/06 - 20060293234 - Therapeutic peptides for the treatment of metastatic cancer
Interaction between MUC1 and β-catenin can be interrupted using polypeptides or antibodies that specifically bind to the binding site on MUC1. Interruption provides the beneficial effect of inhibiting, reducing, and/or retarding invasiveness and metastasis. Fusion polypeptides and antibodies are provided to achieve a therapeutic effect. ...

12/28/06 - 20060293233 - Compositions and methods for modulating body weight and treating obesity-related disorders
The present invention relates to compositions and methods for regulating body weight, and for treating conditions associated with obesity, particularly, obesity-related diabetes. The present invention is premised on the discovery that body weight can be effectively regulated by modulating the levels and/or activities of two gut hormones, PYY and ghrelin. ...

12/28/06 - 20060293232 - Hybrid polypeptides with selectable properties
The present invention relates generally to novel, selectable hybrid polypeptides useful as agents for the treatment and prevention of metabolic diseases and disorders which can be alleviated by control plasma glucose levels, insulin levels, and/or insulin secretion, such as diabetes and diabetes-related conditions. Such conditions and disorders include, but are ...

12/28/06 - 20060293231 - Method for enhancing bone formation
This invention provides a method for facilitating bone formation in a subject comprising delivering to a bone formation-requiring site a composition of matter comprising platelet-rich plasma, calcium, a PAR-activating agent and a bone forming material. This invention further provides a method for facilitating bone formation in a subject comprising (a) ...

12/28/06 - 20060293230 - Expression and secretion of icil-1 receptor antagonist type ii
Novel glycosylated intracellular IL-1 receptor antagonist type II (icIL-1ra-II) is expressed and secreted in mammalian cells transformed with an expression vector where icIL-1ra-II is secreted by expressing icIL-1ra-II fused to the human growth hormone signal peptide. Also disclosed are a pharmaceutical composition containing glycosylated icIL-1ra-Il as an active ingredient and ...

12/28/06 - 20060293229 - Site-specific isotopically-labeled proteins, amino acids, and biochemical precursors therefor
Site-specific isotopically-labeled valine, leucine, and isoleucine and biosynthetic precursors for these amino acids are provided. The amino acids are labeled with 13C or 14C at the methyl group carbon atom(s) most remote from the carboxyl group. Also disclosed are the biochemical precursors of these labeled amino acids, 2-keto-4-(nC) butyric acid ...

12/28/06 - 20060293228 - Therapeutic compositions and methods using transforming growth factor-beta mimics
The invention provides methods, compositions, and kits for treating a variety of conditions using substances that display one or more activities of transforming growth factor-β (TGF-β mimics). Conditions include skin conditions, wounds, and the need for soft tissue augmentation. Compositions that may be used to treat such conditions contain a ...

12/28/06 - 20060293227 - Cosmetic compositions and methods using transforming growth factor-beta mimics
The invention provides methods, compositions, and kits for a variety of cosmetic uses, where the methods, compositions and kits utilize substances that display one or more activities of transforming growth factor-β (TGF-β mimics). Compositions, methods, and kits contain TGF-β mimics. ...

12/28/06 - 20060293226 - Medicament and use thereof for tumor therapy
The invention relates to a medicament for tumor therapy, containing a first and a second molecule in an effective concentration, the first molecule representing a1) Annexin V or a molecule that is largely similar thereto, or a2) an effective fragment of Annexin V or the molecule that is largely similar ...

12/28/06 - 20060293225 - Gmg-2 polynucleotides and polypeptides and uses thereof
The present invention relates to the field of obesity research. Obesity is a public health problem that is serious and widespread. A compound, homotrimer of GMG-2 polypeptide fragment comprising globular domain and all or part of GMG-2 collagen-like region, has been identified that has utility for reducing body mass, for ...

12/21/06 - 20060287237 - Rhob as a suppressor of cancer cell growth, cell transformation, and metastasis
The present invention concerns the use of the protein RhoB and its variants to inhibit cancer cell growth, migration, invasion, metastasis, malignant cell transformation, and/or to modulate oncogenic signaling, wherein introducing RhoB directly, or indirectly via a nucleic acid sequence encoding RhoB, into a malignantly transformed cell or a cancerous ...

12/21/06 - 20060287236 - Methods and compositions for diagnosis and treatment of iron overload diseases and iron deficiency diseases
Methods and compositions are provided for the diagnosis and treatment of iron overload diseases and iron deficiency diseases. ...

12/21/06 - 20060287235 - Crystallization of igf-1
Crystalline IGF-1 is provided along with a method for production thereof. Crystallizing IGF-1 comprises the steps of mixing an aqueous solution comprising IGF-1 with a reservoir solution comprising a precipitant to form a mixture; and crystallizing the mixture, optionally also recrystallizing and isolating the crystalline IGF-1. In addition, a method ...

12/21/06 - 20060287234 - Wound healing
Methods for accelerating and/or improving wound healing in a subject by administering vascular endothelial growth factor (VEGF) are provided. ...

12/21/06 - 20060287233 - Method of use of antagonists of zonulin to prevent the loss of or to regenerate pancreatic cells
The present invention provides materials and methods for the treatment of diabetes. Using the materials and methods of the invention, the loss of pancreatic β-cells can be slowed and/or prevented. In addition, the materials and methods of the invention can be used to regenerate pancreatic β-cells. ...

12/21/06 - 20060287232 - Antimicrobial peptides
Artificial antimicrobial peptides are obtained by alterations in alpha helical portions of a known antimicrobial protein, granulysin. The peptides obtained have significantly improved antimicrobial activity and lack the ability to lyse mammalian cells, which may be toxic to a host. The peptides may be designed according to certain guidelines, and ...

12/21/06 - 20060287231 - Therapeutic uses of kallikreins
The present invention relates to therapeutic applications of kallikreins and compositions containing them for treating, preventing and/or ameliorating cancers, especially epithelial cancers, such as ovarian, breast and cervical cancer. ...

12/21/06 - 20060287230 - Compositions which can be used for regulating the activity of parkin
The present invention relates to novel compounds and their uses, in particular their pharmaceutical or diagnostic uses or their use as pharmacological targets. More particularly, the present invention relates to a novel protein, referred to as PAP1, as well as to novel peptides and compounds which are capable of modulating, ...

12/21/06 - 20060287229 - Novel cd40 variants
The invention concerns CD40 skipping 5 nucleic acid sequences and amino acid sequences obtained by alternative splicing of CD40, pharmaceutical compositions comprising said sequences and methods for treatment of a disease, wherein a beneficial therapeutic effect is achieved by the up regulation of the CD40-R-CD40-L interaction. An antibody capable of ...

12/21/06 - 20060287228 - Expression of active human factor ix in mammary tissue of transgenic animals
Recombinant Factor IX characterized by a high percentage of active protein can be obtained in the milk of transgenic animals that incorporate chimeric DNA molecules according to the present invention. Transgenic animals of the present invention are produced by introducing into developing embryos DNA that encodes Factor IX, such that ...

12/21/06 - 20060287227 - Gonadal function improving agents
Metastin, compounds that promote the activity of metastin or its receptors and the like are excellent gonadal function improving agents, ovulation inducers or promoters, gonadotropic hormone secretion promoters, gonadotropic hormone secretion inhibitors, sex hormone secretion promoters, sex hormone secretion inhibitors, etc., and can be used as agents for preventing/treating sterility, ...

12/21/06 - 20060287226 - Characterization of a membrane estrogen receptor
The present invention discloses the identification of a novel membrane associated estrogen receptor, termed mER. The membrane associated receptor is involved in rapid signal transduction. Amino acid sequences, nucleic acid sequences, vectors, and host cells are also discussed. Additionally, methods of detecting agonists and antagonists for the receptor are disclosed ...

12/14/06 - 20060281681 - Methods and compositions for the reduction of neutrophil influx and for the treatment of bronchpulmonary dysplasia, respiratory distress syndrome, chronic lung disease, pulmonary fibrosis, asthma and chronic obstructive pulmonary disease
The present invention relates generally to the use of recombinant human CC10 (rhCC10), also known as recombinant human uteroglobin, for use as a therapeutic in the treatment of Respiratory Distress Syndrome (RDS), Bronchopulmonary dysplasia (BPD), chronic lung disease and/or pulmonary fibrosis, Asthma and Chronic Obstructive Pulmonary Disease (COPD). More particularly, ...

12/14/06 - 20060281680 - Methods and compositions for modulating vascular integrity
The invention provides methods and compositions useful for modulating vascular integrity. ...

12/14/06 - 20060281679 - Human fgf-23 gene and gene expression products
This invention relates to human fibroblast growth factor (hFGF-23), to cleavage products of hFGF-23, and to variants thereof and to polynucleotides encoding FGF-23. The invention also relates to diagnostic and therapeutic agents related to the polynucleotides and proteins, including probes and antibodies, and to methods of treating skin, brain and ...

12/14/06 - 20060281678 - Novel inhibitor of angiogenesis, tumor progression, and metastasis targeting ras signalling pathway
The present invention relates to a novel use of thymosin β10 protein for anti-angiogenesis, anti-tumor progression, and anti-metastasis by targeting a Ras signaling pathway. Particularly, thymosin β10 protein reduces the generation of a Ras-GTP/Raf complex by sequestering Ras-GTP or by interfering with the binding of Ras-GTP to Raf through a ...

12/14/06 - 20060281677 - Compositions and methods for intracellular delivery of biotinylated cargo
The invention provides compositions for intracellular delivery of biotinylated cargo. The compositions comprise a complex formed between (a) a fusion protein comprising a protein transduction domain linked to streptavidin and (b) a biotinylated cargo for intracellular delivery. In some embodiments, the protein transduction domain comprises the protein transduction domain of ...

12/14/06 - 20060281676 - Agent and method for the treatment and prevention of tse and method for the production of said agent
The invention relates to an agent and/or pharmaceutical active ingredient and to a method for the treatment, prevention and diagnosis of TSE, and to a method for the production of an agent and/or pharmaceutical active ingredient. According to the invention, peptides and/or nucleotide sequences coding for said peptides are provided ...

12/14/06 - 20060281675 - Somatogenic therapy using a 20kda placental variant of growth hormone
Embodiments of the present invention provide improved methods of treating conditions requiring human growth hormone (hGH) therapy, whereby the beneficial effects of hGH such as growth promotion and lipolysis are retained and unwanted properties are reduced or eliminated. In particular, it is directed at a method of treatment whereby the ...

12/14/06 - 20060281674 - S100 protein as neutrophil activator for alleviating neutropenia in cancer treatment
The present invention relates to a method and composition for inducing lymphocyte proliferation and migration, and for reducing the risks of microbial infections in patients immuno-supressed. The present invention particularly relates to the use of S100 protein, such as MRP, to induce the proliferation, differentiation and release of immune cells ...

12/14/06 - 20060281673 - Novel peptide inhibitor of hiv fusion that disrupts the internal trimeric coiled-coil of gp41
This invention relates to a novel peptide inhibitor of a HIV fusion that disrupts the internal trimeric coiled-coil of gp41, to a pharmaceutical composition that comprise this inhibitor, and to methods of treating immunodeficiency disease, especially HIV, that employ such a pharmaceutical composition. ...

12/14/06 - 20060281672 - Dec-205 (ly 75)/dcl-1 intergenic splice variants associated with hodgkin's disease, and uses thereof
The inventors have identified intergenically spliced DEC-205/DCL-1 mRNAs, which encode the intact DEC-205 ectodomain together with an additional carbohydrate recognition domain, a transmembrane domain and a cytoplasmic domain derived from DCL-1. These DEC-205/DCL-1 intergenic splice variants were identified on Reed-Sternberg cells and thus have application in the therapy and investigation ...

12/07/06 - 20060276399 - Peptide antagonists of zonulin and methods for use of the same
Peptide antagonists of zonulin are disclosed, as well as methods for the use of the same. The peptide antagonists bind to the zonula occludens receptor, yet do not physiologically modulate the opening of mammalian tight junctions. ...

12/07/06 - 20060276398 - Combined use of factor vii polypeptides and factor viii polypeptides
The invention concerns a pharmaceutical preparation comprising a factor VII or factor VII-related polypeptide and a factor VIII or factor VIII-related polypeptide. The invention also concerns use of a factor VII or factor VII-related polypeptide and a factor VIII or factor VIII-related polypeptide for manufacture of a medicament for pharmaceutical ...

12/07/06 - 20060276397 - Crystallization of igf-1
Crystalline IGF-1 is provided along with a method for production thereof. Crystallizing IGF-1 comprises the steps of mixing an aqueous solution comprising IGF-1 with a reservoir solution comprising a precipitant to form a mixture; and crystallizing the mixture, optionally also recrystallizing and isolating the crystalline IGF-1. In addition, a method ...

12/07/06 - 20060276396 - Albumin fusion proteins
The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention ...

12/07/06 - 20060276395 - Pharmaceutical compositions of adiponectin variants and methods of storage
1. A composition comprising an adiponectin variant at a concentration of at least 2.0 mg/mL, and a pharmaceutically acceptable carrier, wherein less than 20% of said adiponectin variant would aggregate after storage at 4° C. for one week in 10 mM PO4, 150 mM NaCl buffer. ...

12/07/06 - 20060276394 - Methods and compositions for treating neurological disorders
The present invention relates generally to the fields of neuroscience, growth factors and depression. More particularly, the present invention addresses the need in the art for methods and compositions for treating neurological disorders such as depression, anxiety, panic disorder, bi-polar disorder, insomnia, obsessive compulsive disorder, dysthymic disorder and schizophrenia. In ...

12/07/06 - 20060276393 - Novel compositions for preventing and treating neurodegenerative and blood coagulation disorders
Provided herein are methods and compositions for treating or preventing neurodegenerative disorders or blood coagulation disorders. Methods may comprise modulating the activity or level of a sirtuin, such as SIRT1 or Sir2. Exemplary methods comprise contacting a cell with a sirtuin activating compound, such as a flavone, stilbene, flavanone, isoflavone, ...

12/07/06 - 20060276392 - Treatments employing neuronal exocytosis-inhibiting peptides
The peptide has a sequence of 3 to 30 adjacent aminoacids from the amino end of protein SNAP-25 and is useful as neuronal exocytosis inhibitor. The cosmetic and pharmaceutical compositions contain said peptide and optionally one or more peptides from the carboxyl end of SNAP-25. Said compositions are suitable for ...

12/07/06 - 20060276391 - Use of compounds that interfere with the hedgehog signaling pathway for the manufacture of a medicament for preventing, inhibiting, and/or reversing ocular diseases related with ocular neovascularization
The present invention concerns the use of compounds that interfere with the hedgehog signaling pathway for the manufacture of a medicament for preventing, inhibiting, and/or reversing ocular diseases related with ocular neovascularization. Partcularly, the above-mentioned diseases are (wet) age-related macular degeneration, (proliferative) diabetic retinopathy, neovascular glaucoma, retinal vein occlusion, or ...

12/07/06 - 20060276390 - Combined treatments comprising synthetic peptide copolymers for preventing graft rejection
Compositions and methods for the treatment of graft rejection associated with transplantation of tissues and organs include combined treatment involving at least one agent selected from Copolymer 1, a copolymer 1-related heteropolymer or an ordered peptide in combination with at least one additional known immunosuppressive agent. Compositions and methods for ...

12/07/06 - 20060276389 - Fugetactic proteins, compositions and methods of use
This invention relates to compositions and methods that modulate the movement of cells with migratory capacity. More specifically, the invention relates to compositions and methods for promoting migratory movement, fugetaxis, of cells from a specific site in a subject. The foregoing are useful, inter alia, in the treatment of conditions ...

12/07/06 - 20060276388 - Hip/pap polypeptide compositions for use in liver regeneration and for the prevention of liver failure
This invention is based on the experimental finding that HIP/PAP has mitogenic and antiapoptotic effects in vitro on hepatocytes in primary culture. Moreover, HIP/PAP is a mitogenic and anti-apoptotic molecule for hepatocytes, in vivo, during liver failure and liver regeneration. The present invention is also based on the experimental finding ...

12/07/06 - 20060276387 - Method of controlling transcription insulin gene
A method for promoting insulin gene transcription, which comprises the step of inhibiting binding of IPF1 and any one of proteins selected from the following group: (i) HNF3G, (ii) PHF1, and (iii) DLX4; and a method for screening a substance that promotes insulin gene transcription, which comprises the step of ...

12/07/06 - 20060276386 - Use of substances inhibiting the association of said protein with ubiquitin c-terminal hydrolase for altering cellular responses to tgf-beta or bmp
Disclosed is a pharmaceutical composition for altering cellular responses to TGFβs and/or BMPs; the composition comprising a molecule which prevents, inhibits or reduces the association of a Smad protein with a UCH, in admixture with a physiologically acceptable carrier, excipient or diluent. ...

12/07/06 - 20060276385 - Anti-inflammatory agents and methods of their use
The present disclosure provides compositions and methods for reducing or inhibiting vascular inflammation, for example inflammation resulting from unstable blood flow conditions such as oscillatory shear. Representative compositions include an antagonist of BMPs, for example BMP4, or BMP receptors, for example BMPR-I and/or BMPR-II, in an amount sufficient to for ...

12/07/06 - 20060276384 - Peptides and medicinal compositions containing the same
This invention provides a pharmaceutical composition comprising, as an active ingredient, a peptide derived from a PACAP or VIP peptide or a pharmaceutically acceptable salt thereof. This invention provides a PACAP/VIP derivative that can inhibit tautomerization in a solution and that can be applied to clinical applications over a long ...

12/07/06 - 20060276383 - Full length polynucleotide coding chicken type ii collagen and the use of it
The present invention relates to a nucleic acid molecule as set forth in SEQ ID NO:1 comprising a polynucleotide sequence encoding full length chicken type II collagen (CCII), or a fragment thereof in possession of the same biological functions as well as CCII encoded thereof. It also relates to a ...

12/07/06 - 20060276382 - Materials and methods for treatment of allergic diseases
The present invention pertains to a method for treatment of allergic diseases by administering a natriuretic hormone peptide (NHP), or a nucleic acid sequence encoding NHP, to a patient in need thereof. In another aspect, the present invention concerns an expression vector comprising a nucleic acid sequence encoding NHP. In ...

12/07/06 - 20060276381 - Remedy for diabetes
The invention relates to a prophylactic or therapeutic for diabetes mellitus which comprises a growth-hormone secretagogue receptor (GHS-R) antagonist as an active ingredient, as well as a method of lowering the blood glucose level by administering a GHS-R antagonist. The invention further relates to a prophylactic or therapeutic which comprises ...

11/30/06 - 20060270604 - Pharmaceutical preparations of fn3 polypeptides for human treatments
Disclosed herein are proteins that include an immunoglobulin fold and that can be used as scaffolds. Also disclosed herein are nucleic acids encoding such proteins and the use of such proteins in diagnostic methods and in methods for evolving novel compound-binding species and their ligands. ...

11/30/06 - 20060270603 - Amidated parathyroid hormone fragments and uses thereof
C-terminal amidated human parathyroid hormone analogs PTH 1-32-NH2 and PTH 1-33-NH2 are biologically active and can be used for the treatment of various bone related diseases and conditions. ...

11/30/06 - 20060270602 - Mutants of bone morphogenetic proteins
The present invention relates to novel mutants of bone morphogenetic proteins (BMPs) useful as inhibitors of heterotopic ossification. Specifically, the present invention relates to novel mutants containing only the entire region involved in the formation of finger 2 including the wrist epitope of a BMP with a specific cysteine residue ...

11/30/06 - 20060270601 - Arts c-terminus fragments and mimetics thereof
This invention provides isolated peptides comprising a C-terminal fragment of an ARTS protein, isolated nucleotides encoding same, mimetics and small molecule analogues of same, and therapeutic applications comprising administering a peptide, nucleic acid, or mimetic compound of the present invention. This invention also provides isolated complexes comprising a C-terminal fragment ...

11/30/06 - 20060270600 - Anti-cancer agents
An anti-cancer agent comprising as an active component a protein which is a diphtheria toxin mutant such as CRM197, has an activity to inhibit binding of HB-EGF to an EGR receptor and substantially does not have toxicity of diphtheria toxin. The anti-cancer agent is particularly effective for the treatment of ...

11/30/06 - 20060270599 - Inhibiting angiogenesis using molecules that enhance plasmin formation or prolong plasmin activity
A proteinaceous molecule comprising a lysine and/or arginine residue and/or a functional equivalent thereof, capable of providing enhanced levels of plasmin in a mammal through tPA-mediated plasminogen activation for use as a pharmaceutical. Methods of treating diseases associated with angiogenesis and/or inflammatory disorders and/or conformational disorders and/or aging. Also, a ...

11/30/06 - 20060270598 - Method of treatment using adiponectin variants
A method of treating a mammal with an adiponectin mediated disorder comprising administering a therapeutically effective amount of an adiponectin variant with at least a 3-fold increased solubility relative to residues 110-244 of human adiponectin ...

11/30/06 - 20060270597 - Compositions of thap-family chemokine binding domains
Among the compositions and methods described herein are compositions comprising THAP-family chemokine binding domains as well as fragments and homologs thereof. Also disclosed are compositions comprising THAP-family chemokine binding domains as well as fragments and homologs thereof fused to various molecules. ...

11/30/06 - 20060270596 - Compositions of thap-family chemokine binding domains
Among the compositions and methods described herein are compositions comprising THAP-family chemokine binding domains as well as fragments and homologs thereof. Also disclosed are compositions comprising THAP-family chemokine binding domains as well as fragments and homologs thereof fused to various molecules. ...

11/30/06 - 20060270595 - Nucleic acids encoding compositions of thap-family chemokine binding domains
Among the compositions and methods described herein are nucleic acids encoding compositions comprising THAP-family chemokine binding domains as well as fragments and homologs thereof. Also disclosed are nucleic acids encoding compositions comprising THAP-family chemokine binding domains as well as fragments and homologs thereof fused to various molecules. Also disclosed are ...

11/30/06 - 20060270594 - Methods and compositions for modulating hyperstabilized c-met
The invention provides methods and compositions for modulating the HGF/c-met signaling pathway, in particular by inhibiting a hyperstabilized c-met protein. ...

11/30/06 - 20060270593 - Novel molecules of the pyrin/nbs/lrr protein family and uses thereof
Novel PYRIN-2, PYRIN-3, PYRIN-5, PYRIN-6, PYRIN-7, PYRIN-8, PYRIN-10, and PYRIN-11 polypeptides, proteins, and nucleic acid molecules are disclosed. In addition to isolated PYRIN-2, PYRIN-3, PYRIN-5, PYRIN-6, PYRIN-7, PYRIN-8, PYRIN-10, and PYRIN-11 proteins, the invention further provides PYRIN-2, PYRIN-3, PYRIN-5, PYRIN-6, PYRIN-7, PYRIN-8, PYRIN-10, and PYRIN-11 fusion proteins, antigenic peptides and ...

11/30/06 - 20060270592 - Use of neurotransmitters and neuropeptides for the treatment of dry eye diseases and related conditions
The invention further features novel methods and compositions for treating and preventing dry eye by administration of neurotransmitters and/or neuropeptides, optionally in formulation with various other agents, as well as kits for the use of such novel formulations and methods. ...

11/30/06 - 20060270591 - Androgen receptor coregulators
Disclosed are compositions and methods related to androgen receptor coregulators. ...

11/23/06 - 20060264377 - Chemically modified novel erythropoietin stimulating protein compositions and methods
The present invention broadly relates to the field of protein modification, and, more specifically, the attachment of water soluble polymers to novel erythropoietin stimulating protein (NESP). ...

11/23/06 - 20060264376 - Use of natriuretic peptide for treating heart failure
The present invention relates to the use of a natriurectic peptide, such as urodilatin, for treating a patient suffering from heart failure, such as acute decompensated heart failure. Preferably, a composition comprising an effective amount of urodilatin is intravenously administered to the patient continuously through a time period of at ...

11/23/06 - 20060264375 - Elastin protective polyphenolics and methods of using the same
Dermal fibroblasts permanently loose their ability to synthesize elastin, the major component of elastic fibers, shortly after puberty. This progressive loss of elastic fibers cannot be replaced, resulting in the physical signs of aging. The present invention provides methods and compositions containing the polyphenols ellagic acid and/or tannic acid for ...

11/23/06 - 20060264374 - Conus californicus neurotoxins
Novel conotoxin polypeptide and polynucleotide sequences are provided. ...

11/23/06 - 20060264373 - Modified vitamin k-dependent polypeptides
The invention provides vitamin K-dependent polypeptides with enhanced membrane binding affinity. These polypeptides can be used to modulate clot formation in mammals. Methods of modulating clot formation in mammals are also described. ...

11/23/06 - 20060264372 - Process for the synchronization of ovulation for timed breeding without heat detection
A method for synchronizing ovulation in sows and gilts by a single injection of hormones is disclosed. A hormone, gonadotropin releasing hormone (GnRH), luteinizing hormone (LH), follicle stimulating hormone (FSH), human chorionic gonadotropin (hCG), analogues, derivatives, agonists or combinations thereof is administered to an open sow post weaning at a ...

11/23/06 - 20060264371 - Treatment
The invention provides a method of treating or preventing neurodegeneration in a subject in need thereof, which method comprises the step of administering to the subject a therapeutically effective amount of a polypeptide, or a polynucleotide encoding said polypeptide, wherein said polypeptide has the amino acid sequence shown in SEQ ...

11/23/06 - 20060264370 - Antifungal bifunctional molecules, methods of construction and methods of treating fungal infection therewith
The present invention is directed to fusion peptides comprising a fungal targeting agent and a channel-forming domain consisting essentially of amino acids 451-626 of colicin Ia, as well as the polynucleotides encoding the peptides of the invention. The fusion peptides of the peptides of the present invention are particularly useful ...

11/23/06 - 20060264369 - Aptamers to von willebrand factor and their use as thrombotic disease therapeutics
The invention relates generally to the field of nucleic acids and more particularly to aptamers capable of binding to von Willebrand Factor useful as therapeutics in and diagnostics of thrombotic diseases and/or other diseases or disorders in which von Willebrand Factor mediated platelet aggregation has been implicated. The invention further ...

11/23/06 - 20060264368 - Methods and devices for contributing to the treatment of aneurysms
The present invention relates to methods and devices to contribute to the treatment of aneurysms. More specifically, the present invention relates to methods and devices to contribute to contribute to the treatment of aneurysms by delivering bioactive agents via various delivery devices of collagen III and/or collagen III and thrombin. ...

11/23/06 - 20060264367 - Prevention of fibrosis following cardiac injury
A method for treating cardiac fibrosis resulting from injury of a mammalian heart is described comprising the step of contacting a therapeutically effective amount of relaxin and/or an LGR7 activating agent with cardiac cells following the injury in an amount sufficient to reduce the fibrosis. Also described are methods for ...

11/23/06 - 20060264366 - Mule: mcl-1 ubiquitination ligase e3
A HECT-domain containing E3 ubiquitin ligase that mediates the polyubiquitination of Mcl-1, named Mule for Mcl-1 ubiquitin ligase E3, is described. Methods and compositions for modulating functional interaction between Mcl-1 and Mule protein and Mcl-1 mediated apoptosis are described. Diagnostic and prognostic methods based on Mule expression in patient cells ...

11/23/06 - 20060264365 - Treatment of brain tissue damage
Methods of treating brain tissue damage, increasing the expression level of a neuraltrophic factor in a cell, and enhancing angiogenesis in a tissue. ...

11/23/06 - 20060264364 - Acetylated therapeutic procytotoxins
A class of procytotoxic agents is characterized by a capability to kill with target cell-specificity. Such an aspect can be a pore-forming protein which has at least one lysine residue, modified by a peptide linkage to an amino acid residue, via the epsilon amino group, and an acetyl group. These ...

11/23/06 - 20060264363 - Inhibition of nerve cell death by inhibiting degradation of shc3, atf6 or crebl1 by htra2 and method of ameliorating neurodegenerative diseases
A novel protein involved in cell-death and a gene encoding the protein, the use thereof to screen for an anti-cell-death factor for use in the treatment of a disorder caused by excessive cell-death or to screen for a remedy for a disorder caused by aberrant suppression of cell-death, and the ...

11/23/06 - 20060264362 - Method of modulating smooth muscle cell functioning by modulating sphingosine kinase mediated signalling
The present invention relates generally to a method of modulating smooth muscle cell functioning and agents useful for same. More particularly, the present invention relates to a method of modulating smooth muscle tone by modulating intracellular sphingosine kinase mediated signalling. The method of the present invention is useful, inter alia, ...

11/23/06 - 20060264361 - Novel lysophosphatidic acid receptor
It is intended to provide a novel receptor of LPA and a method of screening a drug such as an LPA receptor antagonist using the same. Use as a lysophosphatidic acid (LPA) receptor comprising a G protein-coupled protein p2y9. More specifically, use of the G protein-coupled protein p2y9 as a ...

11/23/06 - 20060264360 - Anti-inflammatory and wound healing effects of lymphoid thymosin beta-4
The invention relates to a method of treating inflammatory conditions in a subject comprising administering to a subject a composition comprising a lymphoid thymosin-β4 polypeptide or a functional lymphoid thymosin-β4polypeptide variant. The invention also provides a method of promoting wound healing in a subject comprising administering to the subject a ...

11/16/06 - 20060258591 - Compositions and methods of treating hiv infections
A method for inhibiting HIV entry into a cell, or inhibiting HIV infection of a cell, or inhibiting contraction of an HIV infection in a subject comprises administering an effective amount of a Beta Defensin-inducing agent. The Beta Defensin-inducing agent may be a Fusobacterium Associated Defensin Inducer (FAD-I) polypeptide. ...

11/16/06 - 20060258590 - Novel melanocortin receptor templates, peptides and use thereof
The present invention relates to novel chimeric peptides and templates containing a combination of antagonist and agonist endogenous ligand residues. In particular, the present invention relates to novel chimeric peptides and templates thereof based upon melanocortin agonist peptides and agouti related protein (AGRP). The present invention provides multifunctional chimeric peptides ...

11/16/06 - 20060258589 - Methods for enhancing radiation therapy
Methods of treating cancer are provided. The methods are improved methods of radiation therapy involving administering an IGF-1-receptor agonist along with therapeutic radiation to a mammal afflicted with cancer. The IGF-1-receptor agonist causes the cancer cells to divide and move into more sensitive stages of the cell cycle, sensitizing the ...

11/16/06 - 20060258588 - Compositions and methods for treating articular cartilage disorders
A method for treating mammalian articular cartilage disorders, more particularly osteoarthritis, and trauma-related cartilage injuries using insulin-like growth factor I (IGF-I) is provided. The method comprises increasing the amount of IGF-I at the diseased or injured articular site to a therapeutically effective level that is capable of maintenance and/or regeneration ...

11/16/06 - 20060258587 - Modified mscl protein channel
The invention relates to the field of drug delivery, in particular, to compounds and methods for the chemical modification of a proteinaceous channel to be used in pharmaceutical delivery vehicles for controlled and/or localized release of therapeutic molecules (e.g., small molecules, peptides, proteins or other macromolecules). Provided are pH- and/or ...

11/16/06 - 20060258586 - Compositions and uses of secreted polypeptide, zsig98
The present invention provides methods of using Zsig98 polypeptides for treating intestinal motility disorders and improving gastrointestinal function, nutritient absorption, metabolism, and diabetes with Zsig98 polypeptides. The invention also provides methods for producing Zsig98 polynucleotides, polypeptides and antibodies. ...

11/16/06 - 20060258585 - Factor vii or viia-like molecules
Conjugates of Factor VII (FVII) and Factor VIIa (FVIIA) are provided, as are methods for preparing them. Methods for producing novel polypeptides contributing to the production of such conjugates are provided. Methods of treatment by administering a FVII or FVIIa conjugate are provided. ...

11/16/06 - 20060258584 - Chimeric proteins with phosphatidylserine binding domains
Chimeric proteins comprising soluble Tissue Factor (sTF) and another subunit (e.g., annexin V) are described. The proteins promote blood clotting and/or inhibit cancer by targeting sTF to specific receptors such as phosphatidyl serine (PS) on activated cells. These chimeric proteins are useful in treating patients with excessive bleeding due to ...

11/16/06 - 20060258583 - Anti-angiogenic peptides for treating or preventing endometriosis
Provided herein are peptides and nucleic acids encoding the peptides, pharmaceutical compositions comprising the nucleic acids and proteins and methods for using the pharmaceuticals to treat or prevent endometriosis in a subject. ...

11/16/06 - 20060258582 - Method of treating myelodysplastic syndromes
The disclosed invention is directed to methods and compounds useful in treating a myelodysplastic syndrome (MDS) using p38 MAP kinase inhibitors either alone or in combination with other chemotherapeutic compounds. A role for p38 kinase inhibition as a treatment modality for combating MDS is discussed herein. Relating to a preferred ...

11/16/06 - 20060258581 - Methods and composition for derepressions of iap-inhibited caspase
The invention provides isolated agents having a core peptide selected from the group consisting of Core peptides 5 through 39 and 42 through 55, wherein the agent derepresses an IAP-inhibited caspase. Also provided is an isolated agent having a core structure selected from any of the structures shown in FIGS. ...

11/16/06 - 20060258580 - Modulators of nod1 signaling
The present invention relates to intracellular signaling molecules, in particular the Nod1 protein. The present invention provides methods of identifying modulators of Nod1 signaling. The present invention further provides methods of altering Nod1 signaling. ...

11/16/06 - 20060258579 - Inhibition of hmgb1 release by fetuin
Methods of inhibiting HMGB1 release by a mammalian cell are provided. The methods comprise treating the cell with sufficient fetuin to inhibit HMGB1 release. Methods of inhibiting an inflammatory cytokine cascade in a mammal are also provided. These methods comprise administering sufficient fetuin to the mammal to inhibit HMGB1 release ...

11/16/06 - 20060258578 - Pharmaceutical composition
The present invention relates to pharmaceutical compositions containing at least one bone morphogenetic protein (BMP) and a plasticizer in a pharmaceutically acceptable carrier, such as in a biodegradable polymer, in amounts providing a synergistic bone forming and bone healing effect. The present invention further relates to methods of treating orthopedic ...

11/16/06 - 20060258577 - Antiviral agents for the treatment, control and prevention of infections by coronaviruses
The invention provides compositions and methods that are useful for preventing and treating a coronavirus infection in a subject. More specifically, the invention provides peptides and conjugates and pharmaceutical compositions containing those peptides and conjugates that block fusion of a coronavirus, such as the SARS virus, to a target cell. ...

11/16/06 - 20060258576 - Gdnf-related neuropeptides
The invention provides novel neuropeptides having amino acid sequences derived from GDNF precursors and homologs thereof, as well as compositions containing the novel neuropeptides. The invention also provides polynucleotides encoding the neuropeptides, antibodies that specifically bind to the neuropeptides, and methods of making and using all of the above, particularly ...

11/16/06 - 20060258575 - Sustained-release microparticle preparation of human growth hormone and process for producing thereof
Provided is a sustained-release microparticle preparation of a human growth hormone which combines biodegradability with sustained-release performance while avoiding the use of an organic solvent as much as possible, allows the sustained-release of a human growth hormone over 3 days or more and reduction in the initial burst release, can ...

11/16/06 - 20060258574 - Novel compositions and methods for the treatment of psoriasis
The present invention relates to compositions containing a novel protein and methods of using those compositions for the diagnosis and treatment of psoriasis. ...

11/09/06 - 20060252696 - Pharmaceutical composition as solid dosage form and method for manufacturing thereof
The present invention relates to a novel pharmaceutical composition as a solid dosage form comprising desmopressin as a therapeutically active ingredient, and to a method for manufacturing thereof. The invention relates to a pharmaceutical composition as a solid dosage form comprising desmopressin, or a pharmaceutically acceptable salt thereof, as a ...

11/09/06 - 20060252695 - Analysis and separation of platelet-derived growth factor proteins
Methods for improving purification and quantification of platelet derived growth factor (PDGF) proteins having structural heterogeneity are provided. Preparation of substantially pure isoforms of these proteins is achieved using TSK sulfopropyl cation exchange chromatography and reverse phase high performance liquid chromatography. A reverse charged capillary zone electrophoresis method enables quantification ...

11/09/06 - 20060252694 - Apolipoprotein a-i agonists and their use to treat dyslipidemic disorders
The present invention provides peptides and peptide analogues that mimic the structural and pharmacological properties of human ApoA-I. The peptides and peptide analogues are useful to treat a variety of disorders associated with dyslipidemia. ...

11/09/06 - 20060252693 - Glucagon-like peptide-1 analogs
Disclosed are glucagon-like peptide-1 (GLP-1) compounds with modifications at one or more of the following positions: 7, 8, 12, 16, 18, 19, 20, 22, 25, 27, 30, 33, and 37. Methods of treating a subject in need of GLP-1 receptor stimulation using these GLP-1 compounds are also disclosed. ...

11/09/06 - 20060252692 - Inhibitors for use in hemostasis
The present invention relates to peptide, polynucleotide and fusion proteins for use as inhibitors in hemostasis. These inhibitors are members of the family of proteins bearing a collagen-like domain and a globular domain. The inhibitors are useful for promoting blood flow in the vasculature by reducing thrombogenic and complement activity. ...

11/09/06 - 20060252691 - Methods and compositions for the treatment and prevention of staphylococcus and other bacterial infections
The invention features methods and compositions for treatment or prevention of infection by, or disease caused by infection with, certain species of bacteria, including in particular bacteria in which a RAP-type and/or TRAP-type molecule plays a role in pathogenesis. This includes Staphylococcus species. ...

11/09/06 - 20060252690 - Factor vii or viia - like molecules
Conjugates of Factor VII (FVII) and Factor VIIa (FVIIA) are provided, as are methods for preparing them. Methods for producing novel polypeptides contributing to the production of such conjugates are provided. Methods of treatment by administering a FVII or FVIIa conjugate are provided. ...

11/09/06 - 20060252689 - Factor vii or viia - like molecules
Conjugates of Factor VII (FVII) and Factor VIIa (FVIIA) are provided, as are methods for preparing them. Methods for producing novel polypeptides contributing to the production of such conjugates are provided. Methods of treatment by administering a FVII or FVIIa conjugate are provided. ...

11/09/06 - 20060252688 - Therapeutic uses of bpi protein products in bpi-deficient humans
New therapeutic uses for BPI protein products that involve treatment of subjects with a BPI deficiency condition, including selective BPI deficiency, and newborns, including BPI-deficient newborns. ...

11/09/06 - 20060252687 - Novel chemokine mimetics synthesis and their use
The present disclosure generally teaches compositions comprising SDF-1 mimetics and methods of using them to modulate an activity of a cell having an SDF-1 receptor by binding the SDF-1 receptor to an SDF-1 mimetic. The cell can be a hematopoietic cell, for example, and can be selected from a group ...

11/09/06 - 20060252686 - Combinations of chromium or vanadium with antidiabetics for glucose metabolism disorders
Compositions and methods of using the same for the treatment of diabetes and other disorders of glucose metabolism are provided. Compositions may include an anti-diabetic agent and one or more of a bioavailable source of chromium and vanadium. ...

11/09/06 - 20060252685 - Treatment for sleep apnea
The present invention relates to compositions and methods of alleviating a symptom of sleep apnea, snoring associated with and independent of sleep apnea, and/or sudden infant death syndrome by administering oxytocin. Specifically, the invention includes a method of administering oxytocin or a salt thereof to an animal in order to ...

11/09/06 - 20060252684 - Osteopontin-based cancer therapies
The invention relates to therapies for treating cancer patients by targeting the osteopontin isoforms OPN-b and OPN-c. Osteopontin is a cytokine that is essential for cellular immunity, particularly through its full length form, OPN-a. OPN-b and OPN-c are splice variants that lack exons 5 and 4, respectively, of the protein's ...

11/09/06 - 20060252683 - Preparation of a peptide compound (syrapro-2000) and its use for the activation of protein phosphatase-2a1 enzyme
This invention relates to the preparation of a peptide compound (SYRAPRO-2000), its use to activate protein phosphatase-2A enzymes for the dephosphorylation of proteins in vitro and in the cell and its use for inhibiting cell proliferation and induction of death of brain cancer cells and other cancer cells and therefore ...

11/09/06 - 20060252682 - Liquid growth hormone formulation and process of preparation thereof
The invention relates to a liquid formulation comprising a growth hormone or a, substance, which stimulates release or potentiates the activity of endogenous hGH; a polyethylene-polypropylene glycol; a citrate buffer and a stabilizer, and to a process of preparation thereof. ...

11/09/06 - 20060252681 - Pain relief agents
The present invention concerns the use of a heat shock polypeptide and/or an encoding nucleic acid sequence in the manufacture of a medicament for use in the relief of pain. In particular the invention concerns the use of chaperonin. The invention further provides methods of relieving pain medicaments containing the ...

11/09/06 - 20060252680 - Genes whose expression is increased in response to stimulation by corticotropin-releasing hormone
The present invention relates generally to therapy and diagnosis of depression. In particular this invention relates to the polypeptides as well as to the polynucleotides encoding these polypeptides, wherein said polypeptides are shown to play a central role in mediating the endocrine response to corticotropin releasing hormone. These polypeptides and ...

11/09/06 - 20060252679 - Preventive and/or trerapeutic drgs for itch
(wherein W represents CH or a nitrogen atom; Z1 and Z2 are the same or different and each represents hydrogen, substituted or unsubstituted lower alkyl, etc.; and Z3 represents hydrogen, substituted or unsubstituted lower alkyl, etc.)] ...

11/09/06 - 20060252678 - Homotrimeric extended obg3 globular head and uses thereof
The present invention relates to the field of obesity research. Obesity is a public health problem that is serious and widespread. A compound, homotrimer of OBG3 polypeptide fragment comprising globular domain and all or part of OBG3 collagen-like region, has been identified that has utility for reducing body mass, for ...

11/09/06 - 20060252677 - Postsynaptic proteins
A protein A that binds to the N-methyl-D-aspartate (NMDA) receptor and a protein B that interacts with protein A are provided. Furthermore, based on the marked promotion of the NMDA receptor mediated signal transduction by these proteins, providing a controlling agent (an inhibiting agent or a promoting agent) and a ...

11/09/06 - 20060252676 - Analgesic antitumor peptide from scorpion and method of producing it
The present invention relates to a peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof having analgesic and antitumor activity, and preparation method and use thereof. The peptide having analgesic and antitumor activity is obtained by extraction, isolation and purification from the ...

11/02/06 - 20060247174 - Use of a peptide
The invention employs GLP-1 (7-37), GLP-1(7-36)amide, and certain related compounds in combination with an oral hypoglycaemic agent for treating diabetes mellitus. ...

11/02/06 - 20060247173 - Alpha-conotoxin peptides
The invention relates to relatively short peptides (termed α-conotoxins herein), about 10-25 residues in length, which are naturally available in minute amounts in the venom of the cone snails or analogous to the naturally available peptides, and which preferably include two disulfide bonds. The α-conotoxins, as described herein, are useful ...

11/02/06 - 20060247172 - Methods and compositions for control of fetal growth via modulation of relaxin
The invention relates to the method for treatment, diagnosis and prevention of diseases related to fetal growth and placental insufficiency and comprises methods including inhibiting or increasing relaxin synthesis, relaxin receptor synthesis, relaxin binding to the relaxin receptor, and relaxin receptor activity. The invention also relates to screening assays to ...

11/02/06 - 20060247171 - Use of a peptide
The invention employs GLP-1 (7-37), GLP-1(7-36)amide, and certain related compounds in combination with an oral hypoglycaemic agent for treating diabetes mellitus. ...

11/02/06 - 20060247170 - Modified growth hormones
Provided are modified growth hormone polypeptides, nucleic acid molecules encoding modified growth hormone polypeptides and methods of generating modified growth hormone polypeptides. Also provided are methods of treatment using modified growth hormone polypeptides. ...

11/02/06 - 20060247169 - Anti-tumor agent
The present invention provides a new anti-tumor agent containing adiponectin as an active ingredient, particularly, an anti-tumor agent capable of inhibiting carcinogenesis in the liver, use of adiponectin as an anti-tumor agent, and a prophylactic or therapeutic method against a tumor using adiponectin. The administration form may be either oral ...

11/02/06 - 20060247168 - Use of adnf polypeptides for treating peripheral neurotoxicity
This invention relates to the use of ADNF polypeptides in the treatment of neurotoxicity induced by chemical agents or by disease processes. The ADNF polypeptides include ADNF I and ADNF III (also referred to as ADNP) polypeptides, analogs, subsequences such as NAP and SAL, and D-amino acid versions (either wholly ...

11/02/06 - 20060247167 - Stable formulations of peptides
Method for increasing the shelf-life of a pharmaceutical formulation comprising a glucagon-like peptide. ...

11/02/06 - 20060247166 - Eye disease treating agent and method for treating eye disease
An eye disease treating agent and a method for treating an eye disease, which use a compound having an interleukin 6 production accelerating activity, are provided. ...

11/02/06 - 20060247165 - Methods and compositions for encapsulation of cells
The present invention relates to methods and compositions for altering (e.g., augmenting or stimulating) differentiation and growth of cells (e.g., neural progenitor cells and neurons). In particular, the present invention relates to compositions comprising one or more self-assembling peptide amphiphiles (e.g., in solution or that generate (e.g., self-assemble into) nanofibers ...

11/02/06 - 20060247164 - Meltrins
The purpose of the present invention is to provide a novel protein involved in adhesion and fusion between myoblasts in the course of the formation of byotube. The present invention relates to Meltrins, which a membrane protein having fusion, adhesion and aggregation activity of cells, especially myoblast; and to polypeptides ...

11/02/06 - 20060247163 - Methods and compositions for control of fetal growth via modulation of relaxin
The invention relates to the method for treatment, diagnosis and prevention of diseases related to fetal growth and placental insufficiency and comprises methods including inhibiting or increasing relaxin synthesis, relaxin receptor synthesis, relaxin binding to the relaxin receptor, and relaxin receptor activity. The invention also relates to screening assays to ...

11/02/06 - 20060247162 - Skin collagen production promoter
It is intended to provide a skin collagen production promoter, foods and drinks for promoting skin collagen production and cosmetics for promoting skin collagen production which are useful in preventing skin chapping, wrinkles, worsening in skin fitness, etc. Namely, a skin collagen production promoter, foods and drinks for promoting skin ...

11/02/06 - 20060247161 - Use of active ingredients for the prophylaxis and/or therapy of viral diseases
The invention relates to the use preferably of at least one active ingredient for the prophylaxis and/or therapy of a viral disease, wherein this active ingredient inhibits at least one component of the cellular signal transduction pathway for the activation of the transcription factor NF-kB such that the virus multiplication ...

11/02/06 - 20060247160 - Metabolic gene polynucleotides and polypeptides and uses thereof
The present invention relates to the field of metabolic research. Metabolic disorders, such as obesity, are a public health problem that is serious and widespread. GMG-3, GMG-4, Cluster 1, GMG-6A, or GMG-6B polypeptides have been identified that are beneficial in the treatment of metabolic disorders. These compounds should be effective ...

10/26/06 - 20060241047 - Fsh formulation
This invention relates to FSH or a FSH variant containing an alpha and beta subunit contained in formulations, and articles of manufacture. The invention provides advantageous new proteins and nucleic acids, multi-use pharmaceutical solutions, formulations and products of said proteins and nucleic acids where none approved for commercial use had ...

10/26/06 - 20060241046 - Linear gamma-carboxyglutamate rich conotoxins
The invention relates to linear y-carboxyglutamate rich conotoxins, derivatives or pharmaceutically acceptable salts thereof, and uses thereof, including the treatment of neurologic and psychiatric disorders, such as anticonvulsant agents, as neuroprotective agents or for the management of pain. The invention further relates to nucleic acid sequences encoding the conopeptides and ...

10/26/06 - 20060241045 - Method for producing preparation containing bioactive substance
A method for producing a preparation containing a bioactive substance, characterized in that it comprises forming a solid material containing the bioactive substance and a polymer, and contacting the solid material with a high pressure gas. The method allows the production of a preparation which is suppressed in excessive initial ...

10/26/06 - 20060241044 - Bacillus cry9 family members
The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of Bacillus thuringiensis encoding δ-endotoxins having pesticidal activity against insect pests, including Lepidoptera. Particular embodiments of the invention provide isolated nucleic acids encoding pesticidal proteins, pesticidal compositions, expression cassettes, and transformed microorganisms and plants comprising a nucleic ...

10/26/06 - 20060241043 - Bacillus cry9 family members
The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of Bacillus thuringiensis encoding δ-endotoxins having pesticidal activity against insect pests, including Lepidoptera. Particular embodiments of the invention provide isolated nucleic acids encoding pesticidal proteins, pesticidal compositions, expression cassettes, and transformed microorganisms and plants comprising a nucleic ...

10/26/06 - 20060241042 - Calcineurin activators
A calcineurin activator, comprising the following protein (a) or (b) as an active ingredient and having the action of increasing intracellular calcium ion concentration through the influx of calcium ions into eukaryotic cells: (a) a killer protein (KLKP), being composed of 3 subunits consisting of amino acid sequences represented by ...

10/26/06 - 20060241041 - Fvii or fviia gla domain variants
Gla domain variants of human Factor VII or human Factor VIIa, comprising 1-15 amino acid modifications relative to human Factor VII or human Factor VIIa, wherein a hydrophobic amino acid residue has been introduced by substitution in position 34; or having an amino acid substitution in position 36; and use ...

10/26/06 - 20060241040 - Methods of treating disorders associated with toll-like receptor 4 (tlr4) signalling
Described herein are methods and compositions for treating, preventing, and diagnosing disorders associated with TLR4 signalling, e.g., gram negative bacterial infection and sterile inflammations such as rheumatoid arthritis. ...

10/26/06 - 20060241039 - Amino acid-substituted coagulation factor v
There is provided FV derivatives that reduce blood clotting activity, by reducing thrombin generation, when compared to wild-type FV. In particular, the FV of the present invention comprises single-point and multi-point mutations, encompassed by aspartic acid 79 to glutamic acid 119. The derivatives can be used to treat patient with ...

10/26/06 - 20060241038 - Therapeutic agent for abeta related disorders
The present invention provides a pharmaceutical composition comprising at least one member selected from a compound capable of enhancing Aβ37 production, a compound capable of inhibiting Aβ40 and Aβ42 production and enhancing Aβ37 production, and salts of the compounds and hydrates thereof. ...

10/26/06 - 20060241037 - Compositions comprising trefoil factor family peptides and/or mucoadhesives and proton pump ihhibitor prodrugs
Disclosed are methods of preventing or treating a disease or adverse condition affecting the gastrointestinal tract of a mammal which comprise orally administering to a mammal a therapeutically effective amount of a prodrug of a proton pump inhibitor and an effective amount of a trefoil family factor peptide, mucoadhesive agent, ...

10/26/06 - 20060241036 - Soluble human interleukin 18 receptor-alpha, method of assaying the same, assay kit and medicinal composition
[PROBLEMS] To confirm the presence of a solubilized human IL-18 receptor-α by a novel ELISA method and provide an assay kit and a medicinal composition containing the solubilized human IL-18 receptor-α as the active ingredient. [MEANS FOR SOLVING PROBLEMS] A solubilized human interleukin-18 receptor-α, a method of assaying the solubilized ...

10/26/06 - 20060241035 - Use of dg153 secreted protein products for preventing and treating pancreatic disease and/or obesity and/or metabolic syndrome
The present invention discloses proteins secreted by the developing pancreas, and polynucleotides, which identify and encode these proteins. The invention also relates to the use of these sequences in the diagnosis, study, prevention, and treatment of pancreatic diseases (e.g. diabetes), obesity, and/or metabolic syndrome. ...

10/26/06 - 20060241034 - Means for preventing and treating cellular death and their biological applications
Inhibitors for preventing, blacking/silencing caspase-2 activity in cell death. ...

10/26/06 - 20060241033 - Markers for pre-cancer and cancer calls and the method to interfere with cell proliferation therein
A novel family of human mitochondrial RNAs, referrred to as chimeric RNAs, which are differentially expressed in normal, pre-cancer and cancer cells, are described. Oligonucleotides targeted to the chimeric RNAs are provided. The described oligonucleotides or their analogs can be used for cancer diagnostics and cancer therapy as well as ...

10/26/06 - 20060241032 - Rgd-enriched gelatine-like proteins with enhanced cell binding
The invention concerns a cell support comprising an RGD-enriched gelatine that has a more even distribution of RGD sequences than occurring in a natural gelatine and with a minimum level of RGD sequences. More precise the percentage of RGD sequences related to the total number of amino acids is at ...

10/26/06 - 20060241031 - Assay
An assay method for an anti-bacterial agent comprising: (a) providing as a first component protein SIC; (b) providing as a second component an antibacterial peptide; (c) contacting the first component with a test substance in the presence of the second component; and (d) determining the interaction or activity of the ...

10/26/06 - 20060241030 - Irs modulators
This invention is directed to a general method for the chronic treatment, potential cure, or prevention of various metabolic and related diseases in people, including diabetes, by modulating IRS2 activity in cells and tissues in the body. IRS1 and IRS2 are part of the insulin or insulin-like growth factor signaling ...

10/26/06 - 20060241029 - Hypocretin administration as a treatment for obesity
The invention provides compositions and methods for treatment and prophylaxis of weight disorders. Such methods entail administering to an individual a therapeutically or prophylactically effective dosage regime of a hypocretin or an agonist thereof, and monitoring the condition of the individual responsive to the administering. ...

10/26/06 - 20060241028 - Use of compounds having the biological activity of vasoactive intestinal peptide for the treatment of sarcoidosis
The present invention relates to peptides which arm highly biologically and pharmacologically active as therapeutic drug for the treatment of diseases related to sarcoidosis. The peptides which can be used according to the invention for the treatment of said disease comprise at least one specific highly conservative amino acid residue ...

10/26/06 - 20060241027 - Hiv inhibiting proteins
The invention relates to proteins comprising HIV fusion inhibiting peptides, such as T-20 and/or T-1249 peptides (including, but not limited to, fragments and variants thereof), which exhibit anti-retroviral activity, fused to albumin (including, but nbot limited to fragments or variants of albumin). These fusion proteins are herein collectively referred to ...

10/19/06 - 20060234937 - Modulation of angiogenesis
Substances are provided that are capable of modulating angiogenesis mediated by Lmo2 or a functionally related polypeptide, which substance binds to Lmo2 and/or a functionally related polypeptide, or alters the expression of Lmo2 or a functionally related polypeptide in a cell. Assay methods are provided for identifying such substances. ...

10/19/06 - 20060234936 - Method for screening substances capable of inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells
There are provided PACAP which is a substance capable of inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells, a method for inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells in a human by PACAP administration, a pharmaceutical composition ...

10/19/06 - 20060234935 - Mutants of the factor vii epidermal growth factor domain
The application relates to modified blood coagulation factor, sequencing encoding such modified factors, processes for their production, and related pharmaceutical compositions comprising such factors and their uses. More specifically, the application relates to mutations in the human FVII EGF-1 domain, wherein said mutations were analyzed for clotting activity, amidolytic activity ...

10/19/06 - 20060234934 - Composition and method for selective cytostasis
A method of inducing cytostasis in a population of HIV-infected cells is disclosed which comprises applying to a population of HIV-infected cells a cytostatically effective amount of an inhibitor comprising an isolated peptide having the amino acid sequence FCRFLLCPSRTSD or SQCEQEGGRCRFLLCPSRTSNIGKLGCEPLWKC CKRWGG, or a conservative variant thereof, whereby cell growth ...

10/19/06 - 20060234933 - Vasoactive intestinal polypeptide pharmaceuticals
Pharmaceutical compositions relating to vasoactive intestinal polypeptides and methods for the treatment of metabolic disorders, including diabetes, insulin resistance, metabolic acidosis and obesity are presented. Methods of using the vasoactive intestinal polypeptide compositions are also disclosed. ...

10/19/06 - 20060234932 - Prolonged efficacy of islet neogenesis therapy methods with a gastrin/cck receptor ligand and an egf receptor ligand composition in subjects with preexisting diabetes
Compositions and methods are provided for achieving in vivo islet cell regeneration in subjects with preexisting diabetes. The methods comprise short term treatment with a composition having a gastrin/cholecystokinin receptor ligand and an EGF receptor ligand. Treatment with such a composition for a short term resulted in a prolonged period ...

10/19/06 - 20060234931 - Treatment of diseases with kinase inhibitors
The invention is directed to the identification and use of additional targets of BIRB 796, imatinib mesylate, and BAY 43-9006. The new targets of BIRB 796, imatinib mesylate, and BAY 43-9006 can be used to screen for suitable therapeutic compounds. Also, novel therapeutic and prophylactic uses for BIRB 796, imatinib ...

10/19/06 - 20060234930 - Use of dg008,dg065,dg210 or dg239 secreted protein products for preventing and treating pancreatic diseases and/or obesity and/or metabolic syndrome
The present invention discloses proteins secreted by the developing pancreas, and polynucleotides, which identify and encode the proteins. The invention also relates to the use of these sequences in the diagnosis, study, prevention, and treatment of pancreatic diseases (e.g diabetes), obesity, and/or metabolic syndrome. ...

10/19/06 - 20060234929 - Rasgap derived peptide for selectively killing cancer cells
The present invention relates to a peptide consisting in the N2 sequence of the RasGAP protein, a fragment thereof, or a variant thereof which enhances the ability of a drug to selectively kill cells. Furthermore, it relates to a pharmaceutical composition comprising as an active substance a pharmaceutically effective amount ...

10/19/06 - 20060234928 - Cell death-inducing fused gene acting specifically on cancer and gene product thereof
The present invention provides a protein having a potent cell-death inducing activity that is, a fused protein is in which a modified Bax protein fused with GFP at the N-terminus and is further fused with a homing signal peptide having a homing activity specific for endothelial cells in tumor angiogenesis; ...

10/19/06 - 20060234927 - Neuroprotective iron chelators and pharmaceutical compositions comprising them
Novel iron chelators exhibiting neuroprotective and good transport properties are useful in iron chelation therapy for treatment of a disease, disorder or condition associated with iron overload and oxidative stress, eg. a neurodegenerative or cerebrovascular disease or disorder, a neoplastic disease, hemochromatosis, thalassemia, a cardiovascular disease, diabetes, a inflammatory disorder, ...

10/19/06 - 20060234926 - Nucleic acid ligands and uses therefor
The present invention relates to novel nucleic acid molecules or ligands or aptamers with affinities for specific target molecules, and uses of such molecules. The target molecules are fibrillar proteins in all forms of the protein that is to say its monomeric, pre-fibrillar, protofibrillar and mature fibrillar forms. The molecules ...

10/19/06 - 20060234925 - Embryo implantation inhibitor
For a pregnancy to be established, communication between conceptus and mother, and implantation of the conceptus on the uterine wall must occur. If a factor mediating the communication between conceptus and mother is investigated and the factor can be used to control the communication, it may be possible to develop ...

10/19/06 - 20060234924 - Novel proteins and dnas thereof
A novel sodium-dependent bile acid transporter protein, an Na+/H+ exchange transporter protein, a P-type ATPase protein and a vanilloid receptor protein, and polynucleotides encoding these proteins are useful in screening preventives/remedies for hyperlipemia, arteriosclerosis, genital diseases or digestive diseases; respiratory diseases, renal diseases or digestive diseases; pancreatic diseases, central nerve ...

10/12/06 - 20060229248 - Use of glp-1 compound for treatment of critically ill patients
Use of medicament for life saving treatment of critically ill patients and method of treatment. The medicament comprises a GLP-1 compound which effectively controls the blood glucose level. ...

10/12/06 - 20060229247 - T. cruzi-derived neurotrophic agents and methods of use therefor
The invention relates to T. cruzi trans-sialidase (TS) and to the neurotrophic and IL-6 secretion-inducing activities of the protein. TS, neurotrophic variants and/or neurotrophic peptides based upon the sequence of TS can be administered to a mammal to directly or indirectly provide neurotrophic support for neurons. A mammalian neurotrophic factor ...

10/12/06 - 20060229246 - Peptide-enhanced transfections
The present invention provides compositions useful for transfecting eukaryotic cells comprising nucleic acid complexes with peptides, wherein the peptide is optionally covalently coupled to a nucleic acid-binding group, and cationic lipids or dendrimers as transfection agents. The invention also provides transfection compositions in which a peptide is covalently linked to ...

10/12/06 - 20060229245 - Lyophilized hgf preparations
The invention relates to a lyophilized HGF preparation prepared by lyophilizing an aqueous solution containing HGF, and a lyophilized HGF preparation containing a stabilizer, sodium chloride, a buffer, and/or a surface active agent. According to the invention, HGF can be stabilized, and it can be stored for a long period. ...

10/12/06 - 20060229244 - Engineered bacteriocins and bacteriocin combinations and methods for treating bacterial based infections
A method for treating bacterial infections in a patient is provided. The method includes the step of administering a therapeutically effective amount of a single naturally-occurring or engineered bacteriocin, or combinations thereof, designed to have high specific activity against the bacterial infection to the patient so that a rate of ...

10/12/06 - 20060229243 - Aequorin-containing compositions and methods of using same
Compositions containing aequorin and methods for their use in preventing and/or alleviating symptoms and disorders related to calcium imbalance are provided by the present invention. ...

10/12/06 - 20060229242 - Composition comprising a pulmonary surfactant and a pde2 inhibitor
The invention relates to the combined administration of a pulmonary surfactant and a PDE2 inhibitor for the treatment of a disease in which pulmonary surfactant malfunction and/or phosphodiesterase 2 (PDE2) activity is detrimental. ...

10/12/06 - 20060229241 - Hypoxia induced mitogenic factor
We found that FIZZ1/RELMα is inducible by hypoxia in lung. The hypoxia-upregulated expression of FIZZ1/RELMα was located in the pulmonary vasculature, bronchial epithelial cells, and type II pneumocytes. Recombinant FIZZ1/RELMα protein stimulates rat pulmonary microvascular smooth muscle cell (RPSM) proliferation dose-dependently. Therefore, we renamed this gene as hypoxia-induced mitogenic factor ...

10/12/06 - 20060229240 - Conformationally constrained parathyroid hormone (pth) analogs with lactam bridges
The present invention relates to methods of treatment of mammalian conditions characterized by decreases in bone mass with conformationally constrained parathyroid hormone (PTH) analogs and derivatives of those analogs containing PTH polypeptide derivatives containing at least one Glu or Lys substitution at position 6 and/or 10, some with installed lactam ...

10/12/06 - 20060229239 - Novel curcuminoid-factor viia constructs as suppressors of tumor growth and angiogenesis
The fluorinated curcuminoid (3,5-bis-(2-fluorobenzylidene)-piperidin-4-one-acetate is about ten times more effective at arresting the growth of tumor cells than cisplatin. The present invention provides methods to deliver a cytotoxic compound, such as a curcuminoid, specifically to cancer cells and to the vascular endothelial cells that nourish solid tumors. The method involves ...

10/05/06 - 20060223754 - Human tslp polynucleotides
The invention is directed to purified and isolated novel TSLP polypeptides, the nucleic acids encoding such polypeptides, processes for production of recombinant forms of such polypeptides, antibodies generated against these polypeptides, fragmented peptides derived from these polypeptides, and the uses of the above. ...

10/05/06 - 20060223753 - Igf-i and igf-2 chimeric polypeptides and therapeutic uses thereof
A chimeric protein comprising an IGF1 and an IGF2 component and optionally a fusion component (F) and/or a signal sequence, exhibiting improved activity relative to the native IGF1 or IGF2 polypeptide. The fusion component (F) may be a multimerizing component, a targeting ligand, or another active or therapeutic compound. ...

10/05/06 - 20060223752 - Transport peptides such as c-terminal erns peptide and analogues thereof
The invention relates to peptides derived from or similar to the Erns protein of pestiviruses for type-specific diagnosis of infection, for eliciting antibiotic activity, and for transport of substances into a cell. For these purposes, the invention provides, among other things, an isolated, synthetic or recombinant protein or peptide module ...

10/05/06 - 20060223751 - Polypeptides having antimicrobial activity and polynucleotides encoding the same
The present invention relates to isolated polypeptides having antimicrobial activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides. ...

10/05/06 - 20060223750 - Agents and methods for enhancing photodynamic therapy
A chemical conjugate for administration to a patient undergoing photodynamic therapy includes a photoactive compound coupled to a leakage reducing agent that is structured to reduce leakage of the photoactive compound from a patient's vasculature. The leakage reducing agent may be a bulking agent to reduce, for example, sterically reduce, ...

10/05/06 - 20060223749 - Inhibition of ship to enhance stem cell harvest and transplantation
The instant invention teaches the inhibition of SHIP expression, or function, for the increased efficacy of autologous stem cell transplants. In another embodiment, interference with SHIP function can be used to temporarily expand and mobilize the hematopoietic stem cell compartment to assist with leukapheresis, to promote hematopoietic recovery after myeloablation ...

10/05/06 - 20060223748 - Biologically active substance of a vasoactive intestinal peptide for treating interstitial lung infections
The invention describes for the first time the preclinical/cellular and clinical relevance of VIP, PACAP as well as of substances with the same biological activity as VIP and PACAP for the treatment of interstitial lung infections such as idiopathic pulmonary fibrosis, hypersensitive pneumonia or diffused panbronchiolitis. VIP and PACAP are ...

09/28/06 - 20060217314 - Feline hepatocyte growth factor
A feline hepatocyte growth factor gene and a 15 base pairs-deleted feline hepatocyte growth factor gene. These genes encode a protein having an amino acid sequence shown in SEQ ID NO: 2 or 4. The feline hepatocyte growth factor and the 5 amino acids-deleted feline hepatocyte growth factor are useful ...

09/28/06 - 20060217313 - 5-cnac as oral delivery agent for parathyroid hormone fragments
Pharmaceutical compositions for the effective oral delivery of a parathyroid hormone, PTH, as well as methods for administration of the compositions are provided. Additionally, methods for stimulating new bone formation and treating and/or preventing osteoporosis are also provided. ...

09/28/06 - 20060217312 - Charged lipoprotein complexes and their uses
The present disclosure provides charged lipoprotein complexes that include as one component a negatively charged phospholipid that is expected to impart the complexes with improved therapeutic properties. ...

09/28/06 - 20060217311 - Vegf antagonist formulations
Formulations of a vascular endothelial growth factor (VEGF)-specific fusion protein antagonist are provided including a pre-lyophilized formulation, a reconstituted lyophilized formulation, and a stable liquid formulation. Preferably, the fusion protein has the sequence of SEQ ID NO:4. ...

09/28/06 - 20060217310 - Fibroblast growth factor 1 (fgf-1) used for skin care
Provided are compositions comprising a fibroblast growth factor 1 (FGF-1) for skin care, and methods of use of such compositions. The FGF-1 is constructed into a recombinant expression vector, and characterized by the molecular characteristics. The FGF-1 can modulate mitogenic activities and mediate both the FGF-2 and KGF signaling pathway ...

09/28/06 - 20060217309 - Novel cyclosporine analog formulations
The present invention relates to formulations containing cyclosporin analogs that are structurally similar to cyclosporin A, in particular isomeric mixtures of cyclosporin analogs that are structurally similar to cyclosporin A. The formulations form stable microemulsion preconcentrates and may provide superior drug bioavailability and/or may reduce one or more adverse effects ...

09/28/06 - 20060217308 - Compositions for the treatment of tumor pathologies, comprising internalin b (ln1b) of listeria monocytogene protein or a fragment thereof
The pathway by which Met is degraded after interacting with In1B, in response to Listeria monocytogenes infection, provides In1B or In1B fragments or peptides, preferably those that interfere with the interaction between In1B and Met, as new cancer treatments that can achieve rapid down-regulation and subsequent degradation of Met. In ...

09/28/06 - 20060217307 - Methods for regulating inflammatory mediators and peptides useful therein
The present invention includes methods of modulating cellular secretory processes. More specifically the present invention relates to modulating or reducing the release of inflammatory mediators from inflammatory cells by inhibiting the mechanism associated with the release of inflammatory mediators from the vesicles or granules in the inflammatory cells. In this ...

09/28/06 - 20060217306 - Systemic treatment of infections with defensins
The present invention relates to methods for treating systemic microbial infections with defensin antimicrobial peptides. The invention also relates to a medicament and a method for preparing a medicament. ...

09/28/06 - 20060217305 - Induction of tumor cell senescence by retinoid receptor agonists and antagonists
The invention relates to the induction of tumor cell growth arrest. More particularly, the invention relates to the use of retinoic acid receptor (RAR) agonists and antagonists to mediate such growth arrest. The invention provides methods for using RAR-modulating compounds to induce growth arrest, methods for identifying such RAR-modulating compounds, ...

09/28/06 - 20060217304 - Long lasting glucagon-like peptide 2 (glp-2) for the treatment of gastrointestinal diseases and disorders
This invention relates to glucagon-like peptide 2 (GLP-2) derivatives. In particular, this invention relates to GLP-2 peptide derivatives having an extended in vivo half-life, for the treatment or prevention of gastrointestinal disorders or diseases such as inflammatory bowel disease and other gastrointestinal functions, from any segment of the gastrointestinal tract, ...

09/28/06 - 20060217303 - Compounds and methods for treating seizure disorders
This invention provides methods for alleviating seizure disorders in an animal, particularly epilepsy, by regulating the flux through the gluconeogenic enzyme PEPCK in brain cells. ...

09/28/06 - 20060217302 - Paralytic peptide for use in neuromuscular therapy
The invention relates to a low molecular weight peptide (or suite of related peptides) isolated from the submaxiliary saliva glands of shrews of the species Blarina as a paralytic agent. This novel paralytic agent is useful as a neuromuscular blocker and analgesic. ...

09/28/06 - 20060217301 - Compositions with hematopoietic and immune activity
The present invention provides methods of using Bv8 and EG-VEGF polypeptides and nucleic acids to promote hemtopoiesis. Also provided herein are methods of screening for modulators of Bv8 and EG-VEGF activity. Furthermore, methods of treatment using Bv8 and EG-VEGF polypeptides or Bv8 and EG-VEGF antagonists are provided. ...

09/28/06 - 20060217300 - Analogues of glp-1
The present invention is directed to peptide analogues of glucagon-like peptide-1, the pharmaceutically-acceptable salts thereof, to methods of using such analogues to treat mammals, and to pharmaceutical compositions useful therefor comprising said analogues. ...

09/28/06 - 20060217299 - Degradation inhibitor for hepatitis b virus x interacting protein
It was discovered that hepatitis B virus x interacting protein (XIP) is cleaved and degraded by caspase-1, and the cleavage recognition site of XIP was also discovered. Based on these findings, the present invention provides a method and composition for inhibiting the degradation of XIP, more particularly, inhibiting the degradation ...

09/28/06 - 20060217298 - Immunogenic cd91 ligand-antigenic molecule complexes and fusion proteins
The present invention relates to complexes and fusion proteins comprising a CD91 ligand and an antigenic molecule, for use in the treatment or prevention of a disease. The invention specifically provides complexes comprising a CD91 ligand non-covalently bound to, or alternatively crosslinked to, an antigenic molecule. The invention also specifically ...

09/28/06 - 20060217297 - Dimerized peptide
The present invention provides a novel tumor antigen peptide and its cancer vaccine, specifically, a peptide dimer wherein two peptide monomers consisting of 7-30 amino acids including at least one cysteine residue and being capable of producing a tumor antigen peptide are bound each other through a disulfide bond. ...

09/28/06 - 20060217296 - Use of ghrelin for treating malnutrition in gastrectomized individuals
The present invention relates to use of ghrelin or an analogue thereof for the preparation of a medicament for one or more of: treatment and/or prevention of loss of body weight and body fat, prophylaxis or treatment of cachexia, stimulation of appetite, stimulation of fool intake, stimulation of weight gain, ...

09/21/06 - 20060211622 - Isolated human nuclear hormone receptors, nucleic acid molecules encoding human nuclear hormone receptors, and uses thereof
The present invention provides amino acid sequences of peptides that are encoded by genes within the human genome, the nuclear hormone receptor peptides of the present invention. The present invention specifically provides isolated peptide and nucleic acid molecules, methods of identifying orthologs and paralogs of the nuclear hormone receptor peptides, ...

09/21/06 - 20060211621 - Combined use of factor vii polypeptides and factor ix polypeptides
The invention concerns a pharmaceutical preparation comprising a factor VII or factor VII-related polypeptide and a factor IX or factor IX-related polypeptide. The invention also concerns use of a factor VII or factor VII-related polypeptide and a factor IX or factor IX-related polypeptide for manufacture of a medicament for pharmaceutical ...

09/21/06 - 20060211620 - Polypeptides having antimicrobial activity and polynucleotides encoding same
The present invention relates to isolated polypeptides having antimicrobial activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides. ...

09/21/06 - 20060211619 - Multivalent clostridial toxin derivatives and methods of their use
The present invention is directed to multivalent Clostridial neurotoxin derivatives having more than one binding domain directed to a cell surface feature of a target cell. Such modified neurotoxins are useful as therapeutic compositions to prevent exocytosis and secretion by the target cell. Conditions in which such compositions man be ...

09/21/06 - 20060211618 - Polynucleotides and polypeptides of the erythropoietin gene
The present invention relates to new polynucleotides deriving from the nucleotide sequence of the EPO gene and comprising new SNPs, new polypeptides derived from the natural EPO protein and comprising at least one mutation caused by the SNPs of the invention as well as their therapeutic uses. ...

09/21/06 - 20060211617 - Methods, compositions and articles of manufacture for contributing to the treatment of solid tumors
Methods, compositions and articles of manufacture for contributing to the treatment of a solid cancerous tumor are disclosed. The methods, compositions and articles of manufacture can utilize an endothelin B agonist (ETB) to enhance the delivery of a chemotherapeutic agent to a solid tumor in mammals, including humans. ...

09/21/06 - 20060211616 - Purification of glucagon-like peptides
Method for purifying a glucagon-like peptide by reversed phase high performance liquid chromatography ...

09/21/06 - 20060211615 - Surfactant peptide nanostructures, and uses thereof
This work describes a new class of short polypeptides that can self-assemble to form regular nanotubes with an average diameters of about 50 nm. These peptides (7 to 8 amino acids) have a structure very similar to those observed in surfactant molecules with a defined hydrophilic head group constituting of ...

09/21/06 - 20060211614 - Methods of inhibiting angiogenesis with fragments and homologs of troponin subunit 1
The present invention relates to methods of inhibiting angiogenesis associated with a disease or disorder with peptides homologous to amino acid residues 130-137 or 132-139 of human troponin subunit I. ...

09/21/06 - 20060211613 - Methods useful in the treatment of bone resorption diseases
The invention relates to a combined pharmaceutical preparation comprising parathyroid hormone and a bone resorption inhibitor, said preparation being adapted for (a) the administration of parathyroid hormone during a period of approximately 6 to 24 months; (b) after the administration of parathyroid hormone has been terminated, the administration of a ...

09/21/06 - 20060211612 - Angiogenesis using hepatocyte growth factor
Methods for enhancing angiogenesis in a mammal using hepatocyte growth factor (“HGF”) are provided. In the methods, HGF can be administered to mammals suffering from, for instance, vascular insufficiency or arterial occlusive disease. Articles of manufacture and kits containing HGF are also provided. ...

09/21/06 - 20060211611 - Therapies and compositions for controlling the stress mechanism and for stabilizing hemostasis in an organism
A theory has been presented that provides a simplified explanation of a cohesive mechanism of embryological development, hemostasis, coagulation, wound repair and tissue maintenance that operates continuously in the animal body to oppose the effects of stress. The theory endeavors to fit all known facts, and is based on the ...

09/21/06 - 20060211610 - Peptide yy analogs
The invention provides analogs of PYY. The invention also provides compositions and methods useful for controlling biological activities such as cell proliferation, nutrient transport, lipolysis, and intestinal water and electrolyte secretion. ...

09/21/06 - 20060211609 - Novel agent for improving neurotransmission failure
A novel medicament for ameliorating neurotransmission dysfunction diseases is provided. A medicament for ameliorating neurotransmission dysfunction diseases comprising as a main active ingredient preferably a selenocysteine-containing protein such as Selenoprotein P or a selenocysteine-containing peptide that consists of said protein or a series of said peptides. A medicament suited for ...

09/21/06 - 20060211608 - Use of a parathyroid hormone peptide analogs for the treatment of viginal atrophy
The invention features methods for the treatment of vaginal atrophy by administering a parathyroid hormone peptide or peptide analog and formulations thereof. ...

09/14/06 - 20060205662 - Combination treatment with t-pa variant and low molecular weight heparin
The invention concerns an improved therapeutic regimen for the treatment of thrombolytic disorders, such as acute myocardial infarction (AMI). In particular, the present invention concerns the treatment of thrombolytic disorders, e.g., AMI, with a combination of a tissue plasminogen activator (t-PA) variant having improved fibrin specificity and extended plasma half-life ...

09/14/06 - 20060205661 - Novel albumin-free factor viii formulations
A Factor VIII composition formulated without albumin, comprising the following formulation excipients in addition to Factor VIII: 4% to 10% of a bulking agent selected from the group consisting of mannitol, glycine and alanine; 1% to 4% of a stabilizing agent selected from the group consisting of sucrose, trehalose, raffinose, ...

09/14/06 - 20060205660 - Ob protein-immunoglobulin chimeras
The present invention concerns long-half derivative of the obesity protein OB. The invention specifically concerns OB protein-immunoglobulin chimeras and polyethylene glycol (PEG)-OB derivatives, which have extended half-life as compared to the corresponding native OB proteins. The invention further relates to methods for appetite and/or weight reducion and for treating other ...

09/14/06 - 20060205659 - Fumaric acid amides
wherein R1 represents OR3 or a D- or L-amino acid radical —NH—CHR4—COOH bonded via an amide bond, wherein R3 is hydrogen, a straight-chained or branched, optionally substituted C1-24 alkyl radical, a phenyl radical or C6-10 aralkyl radical and R4 is a side chain of a natural or synthetic amino acid ...

09/14/06 - 20060205658 - Irrigation solution and method for inhibition of pain and inflammation
A method and solution for perioperatively inhibiting a variety of pain and inflammation processes at wounds from general surgical procedures including oral/dental procedures. The solution preferably includes at least one pharmacological agent that is an interleukin-1 (IL-1) soluble receptor, and optionally additional multiple pain and inflammation inhibitory agents at dilute ...

09/14/06 - 20060205657 - Irrigation solution and method for inhibition of pain and inflammation
A method and solution for perioperatively inhibiting a variety of pain and inflammation processes at wounds from general surgical procedures including oral/dental procedures. The solution preferably includes at least one pharmacological agent that is a class I cytokine soluble receptor, and optionally additional multiple pain and inflammation inhibitory agents at ...

09/14/06 - 20060205656 - P-superfamily conopeptides
The present invention is directed to P-superfamily conopeptides, to DNA encoding precursors of the P-superfamily conopeptides and to the precursor peptides. ...

09/14/06 - 20060205655 - Nucleic acids encoding (poly) peptides having chips activity
The invention relates to nucleic acid molecules encoding (poly)peptides having chemotaxis inhibiting (poly)peptides CHIPS activity, to recombinant vectors harboring such molecules, and the host cells carrying the vectors. The invention further relates to methods for preparing recombinant (poly)peptides having CHIPS activity and to the use of such recombinant (poly)peptides having ...

09/14/06 - 20060205654 - Novel human growth factors
The present invention relates to huXAG-1, huXAG-2 and huXAG-3 proteins which are novel human growth factors. In particular, isolated nucleic acid molecules are provided encoding the huXAG-1, huXAG-2 and huXAG-3 proteins. huXAG-1, huXAG-2 and huXAG-3 polypeptides are also provided as are vectors, host cells and recombinant methods for producing the ...

09/14/06 - 20060205653 - Sources for, and types of, insecticidally active proteins, and polynucleotides that encode the proteins
The subject invention provides exciting new sources for surprising, new types of toxin complex (“TC”) proteins. The subject invention includes these new classes and types of TC proteins. The subject invention also includes polynucleotides that encode the subject proteins. The subject invention further provides vectors and cells comprising these polynucleotides. ...

09/14/06 - 20060205652 - Formulations and methods for delivery of growth factor analogs
Formulations, kits and methods for bone or cartilage repair, including treatment of osteogenic defects, including formulations of synthetic heparin-binding growth factor analogs, non-ionic polymers, gelling agents and calcium-containing agents. ...

09/14/06 - 20060205651 - Method of treating cancer
The invention relates to a method of treating cancer in an individual in need thereof including inhibiting tumour growth and metastasis. The invention also relates to a method of suppressing or preventing formation of metastases, or inhibiting the growth of metastases, particularly bone metastases, from primary tumours. ...

09/14/06 - 20060205650 - Treatment of neuropsychiatric disease with protease and neuraminidase inhibitors
The present invention provides a method of treating a neuropsychiatric disease characterized by an abnormally elevated level of a fragment of an isoform of a neural cell adhesion molecule, N-CAM, in the brain or cerebrospinal fluid of an affected human subject, comprising administering a therapeutically effective amount of at least ...

09/14/06 - 20060205649 - Metabolic-based methods for modulating gene expression
This invention provides methods for modulating cellular gene expression for genes operably linked to an NRSE element that is recognized by an NRSF transcriptional repressor, by changing the concentration of reduced nicotinamide adenine dinucleotide (NADH) in the cell. ...

09/14/06 - 20060205648 - Liquid, aqueous pharmaceutical compositions of factor vii polypeptides
The present invention is directed to liquid, aqueous pharmaceutical compositions stabilised against chemical and/or physical degradation containing Factor VII polypeptides, and methods for preparing and using such compositions, as well as vials containing such compositions, and the use of such compositions in the treatment of a Factor VII-responsive syndrome. The ...

09/14/06 - 20060205647 - Somatostatin and somatostatin agonists for decreasing body weight
The present invention relates to a method of decreasing body weight in a patient. The method includes the step of administering a therapeutically effective amount of a somatostatin or a somatostatin agonist ot said patient. A pharmaceutical/cosmetic composition comprises the somatostatin or somatostatin agonist. Such products are used to prepare ...

09/14/06 - 20060205646 - Methods for increasing cell and tissue viability
The present invention features methods of increasing cell or tissue viability by administering to the cell or tissue a protective protein. The invention also features methods of treating a condition characterized by cell or tissue damage in a subject by administering to the subject a protective protein. Also included are ...

09/14/06 - 20060205645 - Use of hypoxia inducible factor 2 alpha for curing neonatal respiratory distress syndrome and as a target for the treatment of pulmonary hypertension
The current invention relates to the field of hypoxia-induced disorders and more specifically to the use of hypoxia inducible factor 2α as a target in a method for the screening for molecules that can be used for the treatment of pulmonary hypertension. The invention further relates to the use of ...

09/14/06 - 20060205644 - Methods of treating neurological diseases by regulating migration of neuroblasts in the adult nervous system with tenascin-r
This invention provides a method for regulating migration of neuronal progenitor cells in the nervous system of a mammal. The method comprises providing a mammal with TNR, a biologically active fragment of TNR, or a TNR agonist in an amount sufficient to direct migration of the neuronal progenitor cells. The ...

09/14/06 - 20060205643 - Treatment of inflammatory conditions of the intestine
A method for the treatment and/or prophylaxis of an inflammatory condition of the intestine of a patient, comprises parenteral administration to the patient of an effective amount of high density lipoprotein (HDL) ...

09/14/06 - 20060205642 - Oral methods of treatment using proanf peptides
A method of treatment of hypertension, congestive heart failure, pulmonary edema, nephrotic syndrome, acute and chronic renal failure, toxemia of pregnancy, hepatic cirrhosis, and/or hyperkalemia. Humans or other mammals are administered an effective amount of peptide(s) consisting of amino acids 1-30 (proANF 1-30), amino acids 31-67 (proANF 31-67) and amino ...

09/14/06 - 20060205641 - Vanilrep4 polypeptides and vanilrep4 polynucleotides
VANILREP4 polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques are disclosed. Also disclosed are methods for utilizing VANILREP4 polypeptides and polynucleotides in diagnostic assays. ...

09/14/06 - 20060205640 - Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism
A antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows: GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its fragments and a polypeptide, as well as transformed host organisms capable of producing the peptide such as microorganisms, animal cells, digital cells and plants, ...

09/07/06 - 20060199767 - Cardiac muscle function and manipulation
A method of causing cardiomyocyte growth and/or differentiation, the method comprising exposing a cardiomyocyte to neuregulin (NRG) thereby activating the MAP kinase pathway in the cardiomyocyte and causing growth and/or differentiation of the cardiomyocyte. Use of neuregulin, neuregulin polypeptide, neuregulin derivatives, or compounds which mimic the activities of neuregulins in ...

09/07/06 - 20060199766 - Pharmaceutical composition comprising a factor viia and a factor xiii
The present invention relates to the use of a factor VIIa and a factor XIII in the treatment or pro-phylaxis of bleeding episodes. ...

09/07/06 - 20060199765 - Pth functional domain conjugate peptides, derivatives thereof and novel tethered ligand-receptor molecules
Novel parathyroid hormone (PTH) peptides and analogs thereof of the PTH(1-34) fragment are disclosed that combine the N-terminal signaling domain (residues 1-9) and the C-terminal binding domain (residues 15-31) via a linker. Nucleic acid molecules and peptides for PTH(1-9)-(Gly)5-PTH(15-31) (PG5) and PTH(1-9)-(Gly)7-PTH(15-31) and a novel PTH receptor are disclosed. Additionally, ...

09/07/06 - 20060199764 - Fgf growth factor analogs
where R1, R2, R3, R4, R5, X, Y and Z are as defined, pharmaceutical compositions, coating compositions and medical devices including the fibroblast growth factor heparin-binding analog of the foregoing formula, and methods and uses thereof. ...

09/07/06 - 20060199763 - Derivatives of glp-1 analogs
The present invention relates to a pharmaceutical composition comprising a GLP-1 derivative having a lipophilic substituent; and a surfactant. ...

09/07/06 - 20060199762 - Skin ulcer preventive curative agent containing human recombinant hgf
A neovascularization promoting composition, a granulation formation-promoting composition and a preventive or curative composition for skin ulcer, comprising a human recombinant HGF wherein five amino acid residues are deleted in the first Kringle domain thereof. The provided compositions of the present invention are useful as a drug capable of promoting ...

09/07/06 - 20060199761 - Insulin resistance improving agent
The invention provides an insulin resistance improving agent which contains, as an active component, a C-terminal globular domain of adiponectin, adiponectin, or a gene for the domain or adiponectin. The invention also provides a therapeutic agent for type 2 diabetes, which contains, as an active component, a C-terminal globular domain ...

08/31/06 - 20060194735 - Albumin fusion proteins
The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention ...

08/31/06 - 20060194734 - Cardiac muscle function and manipulation
A method of causing cardiomyocyte growth and/or differentiation, the method comprising exposing a cardiomyocyte to neuregulin (NRG) thereby activating the MAP kinase pathway in the cardiomyocyte and causing growth and/or differentiation of the cardiomyocyte. Use of neuregulin, neuregulin polypeptide, neuregulin derivatives, or compounds which mimic the activities of neuregulins in ...

08/31/06 - 20060194733 - Substantially non-immunogenic injectable collagen
The invention provides an article of manufacture comprising a substantially non-immunogenic injectable collagen for implantation into humans. The invention further provides methods for preparing injectable collagen material by removing collagen-containing material from a non-human animal; washing in saline and alcohol; subjecting material to cellular disruption treatment; and digesting the material ...

08/31/06 - 20060194732 - Recombinant sp-a for the treatment or prevention of pulmonary infection and inflammation
Recombinant surfactant protein A and medicament compositions based thereon are useful for the prevention or treatment of pulmonary infection and inflammation. ...

08/31/06 - 20060194731 - Polypeptides
The present invention relates to polypeptides, and nucleic acids DNA encoding these polypeptides, capable of eliciting an immune reaction against cancer, methods for generating T lymphocytes capable of recognising and destroying tumour cells, and pharmaceutical compositions for the treatment, prophylaxis or diagnosis of cancer. ...

08/31/06 - 20060194730 - Tumor associated antigen peptides and use of same as anti-tumor vaccines
The present invention relates to tumor associated antigen (TAA) peptides and to use of same, of polynucleotides encoding same and of cells presenting same as anti-tumor vaccines. More particularly, the present invention relates to tumor associated antigen peptides derived from Uroplakin Ia, Ib, II and III, Prostate specific antigen (PSA), ...

08/31/06 - 20060194729 - Method of promoting natural bypass
An angiogenic factor comprising a mixture of proteins derived from bone. The angiogenic protein mixture is produced by a series of steps that allow the proteins to be kept in solution. The angiogenic mixture of bone proteins is produced by a multi-step process that includes at least one ultrafiltration step, ...

08/31/06 - 20060194728 - Surfactant treatment regimen
Regimens for the therapeutic or prophylactic administration of pulmonary surfactant to infants exhibiting or at risk of developing bronchopulmonary dysplasia are disclosed. ...

08/31/06 - 20060194727 - Prevention and reduction of blood loss
Methods are described for preventing or reducing ischemia and/or systemic inflammatory response in a patient such as perioperative blood loss and/or systemic inflammatory response in a patient subjected to cardiothoracic surgery, e.g. coronary artery bypass grafting and other surgical procedures, especially when such procedures involve extra-corporeal circulation, such as cardiopulmonary ...

08/31/06 - 20060194726 - Methods of treating cartilage defects
The present invention provides methods of repairing and regenerating cartilage tissue by administering into the cartilage or the area surrounding the cartilage a composition comprising a therapeutically effective amount of a morphogenic protein. ...

08/31/06 - 20060194725 - Methods of treating disease with random copolymers
The invention relates to novel methods and kits for treating or preventing disease through the administration of random copolymers. The invention also relates to the treatment of autoimmune diseases, such as multiple sclerosis, and to the administration of random copolymers in treatment regimen comprising formulations that are administered at intervals ...

08/31/06 - 20060194724 - Methods and systems for nerve regeneration
An exemplary method of regenerating a nerve within a patient includes implanting a system control unit within the patient and applying a stimulus to the nerve with the system control unit in accordance with one or more control parameters. The stimulus is configured to promote regeneration of the nerve. An ...

08/31/06 - 20060194723 - Novel medication treatment and delivery strategies for alzheimer's disease, other disorders with memory impairment, and possible treatment strategies for memory improvement
The present invention is a novel method for medication treatment for Alzheimer's Disease, Mild Cognitive Impairment, Age Associated Memory Impairment, other disorders with memory impairment, and for possible treatment strategies for memory improvement. ...

08/31/06 - 20060194722 - Use of calcitonin in osteoarthritis
The present invention relates to a novel use of calcitonin in osteoarthritis, and to methods of treating and/or preventing osteoarthritis in mammals, particularly humans. ...

08/31/06 - 20060194721 - Tissue regeneration
A biocompatible, biodegradable composition for encouraging controlled growth, regeneration or repair of biological tissue or cells, the composition comprising a scaffold, formed from biodegradable and biocompatible material, and a receptor for a growth factor, or a growth factor-binding fragment or homologue thereof, located at or adjacent a surface of the ...

08/31/06 - 20060194720 - Glp-1 derivatives and transmicosal absorption preparations thereof
The invention relates to a GLP-1 derivative including an amino acid sequence of GLP-1 (7-35) having deletion, substitution and/or addition of one or more amino acids and having Waa-(Xaa)n-Yaa (in which Waa is Arg or Lys, Xaa is Arg or Lys, n is an integer of 0 to 14, and ...

08/31/06 - 20060194719 - Stabilized exendin-4 compounds
The present invention disclosed compositions comprising a stabilized Exendin-4 (1-39) and related compounds. The invention describes stabilized Exendin-4 agonists that include at least one modified amino acid residue particularly at positions Gln 13, Met14, Trp25, or Asn28 of the Exendin-4 (1-39) molecule. Disclosed are preferred modifications of deaminated, hydrolyzed, oxidized, ...

08/24/06 - 20060189536 - Treating the effects of nicotine
The invention provides methods and materials for treating the effects of nicotine. In particular, the invention provides methods that involve administering a neurotensin receptor (NTR) agonist to a mammal that has been exposed to nicotine. The NTR agonist typically is administered in an amount effective to diminish or abolish the ...

08/24/06 - 20060189535 - Combination treatment using exendins and thiazolidinediones
The present invention relates to methods for treatment and/or prevention of diabetes and diabetes related diseases. More specifically, the methods and uses of the invention pertains to administration of an exendin-4 compound in combination with administration of a thiazolidinedione insulin sensitizer. ...

08/24/06 - 20060189534 - Compounds useful in inhibiting vascular leakage, inflammation and fibrosis and methods of making and using same
The present invention is directed to a method of inhibiting at least one of vascular leakage, angiogenesis, inflammation and fibrosis in an animal by administering to the animal an effective amount of a composition, wherein the composition is selected from the group consisting of kallistatin, fragments of kallistatin, analogs or ...

08/24/06 - 20060189533 - Stable pharmaceutical dosage forms of teriparatide
A parathyroid hormone (1-34) (PTH) dosage form is described that is suitable for multi-use administration. A dosage form of parathyroid hormone (1-34) (PTH) comprising an aqueous pharmaceutical formulation for aerosolized intranasal delivery of PTH having a bioavailability of about 5% or greater, wherein the formulation comprises a therapeutically effective amount ...

08/24/06 - 20060189532 - Use of calcitonin and calcitonin-like peptides to treat and prevent multiple sclerosis
Methods for treating and preventing multiple sclerosis by administering to a patient an effective amount of calcitonin, calcitonin-like peptides or calcitonin mimetics to a patient. Additionally, 1,25-dihydroxyvitamin D analogs can be used in combination with the calcitonin, calcitonin-like peptides or calcitonin mimetics. ...

08/24/06 - 20060189531 - Thrombopoietic compounds
The invention relates to the field of compounds, especially peptides or polypeptides, that have thrombopoietic activity. The peptides and polypeptides of the invention may be used to increase platelets or platelet precursors (e.g., megakaryocytes) in a mammal. ...

08/24/06 - 20060189530 - Neuropeptide y receptor y5 and nucleic acid sequences
The present invention provides novel NPY/PYY receptor proteins and the nucleic acid sequence encoding them. The invention is directed to the isolation, characterization, and pharmacological use of these receptors and nucleic acids. In particular, this invention provides human and rat NPY/PYY receptors (which we call the NPY Y5 receptor) and ...

08/24/06 - 20060189529 - Modified human growth hormone
Modified growth hormone polypeptide and uses thereof are provided. ...

08/24/06 - 20060189528 - Osteoprotegerin variant proteins
The present invention relates to novel osteoprotegerin variant proteins (OVPs) that demonstrate reduce binding affinity for their ligand TRAIL when compared to wild-type osteoprotegerin. Nucleic acids which encode these OVPs are also provided. Recombinant vectors and host cells expressing these OVPs are also encompassed as are methods of producing recombinant ...

08/24/06 - 20060189527 - Methods of treating disease with random copolymers
The invention relates to novel methods and kits for treating or preventing disease through the administration of random copolymers. The invention also relates to the treatment of autoimmune diseases, such as multiple sclerosis, and to the administration of random copolymers in treatment regimen comprising formulations that are administered at intervals ...

08/24/06 - 20060189526 - Compositions containing an intestinal trefoil peptide and a mucoadhesive
The invention features compositions containing an intestinal trefoil peptide and a mucoadhesive excipient. Such compounds are useful, e.g., for the treatment or prevention of lesions. Compositions containing an intestinal trefoil peptide and a mucoadhesive excipient may be formulated in combination with one or more additional therapeutic agents. ...

08/24/06 - 20060189525 - Dadd, death activator death domain protein
Polynucleotides encoding DADD protein are also disclosed, along with vectors, host cells, and methods of making DADD protein. Methods of identifying inhibitors of DADD death domain binding and inhibitors identified by such methods are also disclosed. ...

08/24/06 - 20060189524 - Pharmaceutical compositions based on anticholinergics and pegsunercept
The present invention relates to novel pharmaceutical compositions based on anticholinergics and pegsunercept, processes for preparing them and their use in the treatment of respiratory diseases. ...

08/24/06 - 20060189523 - Use of effectors of glutaminyl and glutamate cyclases
The present invention provides novel physiological substrates of mammalian glutaminyl cyclase (QC, EC 2.3.2.5), new effectors of QC and the use of such effectors and pharmaceutical compositions comprising such effectors for the treatment of diseases that can be treated by modulation of QC-activity, e.g. diseases selected from the group consisting ...

08/24/06 - 20060189522 - Modification of feeding behaviour
The present invention relates to compositions and methods for use in the prevention or treatment of excess weight in a mammal. The compositions comprise oxyntomodulin which is shown to reduce food intake and/or increase energy expenditure. ...

08/24/06 - 20060189521 - Human liver regeneration associated protein and the use thereof
This invention provides a novel human liver regeneration associated protein hLRTM4 and the polynucleotide which encodes the hLRTM4 protein. Furthermore, this invention provides a method of preparing and using hLRTM4 protein and its polynucleotides. hLRTM4 protein can be used to treat liver injury, and its antagonists (e.g. antisense nucleic acids ...

08/24/06 - 20060189520 - Treatment of diabetes
Compositions and methods are provided for islet neogenesis therapy comprising a member of a group of factors that complement a gastrin/CCK receptor ligand, with formulations, devices and methods for sustained release delivery and for local delivery to target organs. ...

08/24/06 - 20060189519 - Anti-angiogenic fragments fo pigment epithelium-derived factor (pedf)
The present invention provides anti-angiogenic derived from pigment epithelium-derived factor (PEDF) pharmaceutical compositions comprising the peptides, and methods of preventing angiogenesis. Such methods are useful in treating angiogenesis-associated disorders and diseases. ...

08/24/06 - 20060189518 - Preventing/remedies for cancer
The invention provides prophylactic/therapeutic agent for cancer, etc. More specifically, a compound or its salt inhibiting the activity f a protein having an amino acid sequence, which is the same or substantially the same amino acid sequence represented by SEQ ID NO: 1 or SEQ ID NO: 16, a compound ...

08/17/06 - 20060183687 - Novel therapeutic molecules
The present invention relates generally to novel molecules capable of, inter alia, modulating apoptosis in mammalian cells and to genetic sequences encoding same. More particularly, the present invention relates to a novel member of the Bcl-2 family of proteins, referred to herein as “Bim”, and to genetic sequences encoding same. ...

08/17/06 - 20060183686 - Novel nucleic acid molecules and polypeptides encoding baboon tafi
The present invention relates to the isolation and identification of novel baboon nucleic acid molecules and proteins and polypeptides encoded by such nucleic acid molecules, or degenerate variants thereof, which proteins and polypeptides comprise novel baboon thrombin-activatable fibrinolysis inhibitors or “TAFI” enzyme molecules. Because the novel baboon TAFI proteins and ...

08/17/06 - 20060183685 - Peptide pharmaceutical formulations
A pharmaceutical composition for administration to a mammal is disclosed. The composition includes a therapeutically effective amount of a peptide, such as a GLP-1 molecule, a PTH molecule, or a GRF molecule. The composition further includes a buffer including a weak acid having an acid dissociation constant value of greater ...

08/17/06 - 20060183684 - Therapeutic combination of a vegf antagonist and anti-hypertensive agent
Disclosed are compositions and methods for treating a disease or condition related to angiogenesis with a vascular endothelial growth factor (VEGF) inhibitor and one or more anti-hypertensive agent(s). The method of the invention is useful for preventing the development of hypertension and/or reducing hypertension in a subject treated with a ...

08/17/06 - 20060183683 - Liquid composition of factor vii polypeptides
The invention concerns a liquid aqueous composition comprising (i) a factor VII polypeptide, (ii) an agent suitable for keeping pH in the range of from about 4.0 to about 9.0; (iii) an agent selected from the group consisting of: a calcium salt, a magnesium salt, or a mixture thereof; wherein ...

08/17/06 - 20060183682 - Stabilized pharmaceutical peptide compositions
Method for increasing the shelf-life of a pharmaceutical composition comprising a glucagon-like peptide which is prepared from a peptide product that has been dried at a pH above neutral pH. ...

08/17/06 - 20060183681 - Stabilized compositions containing natriuretic peptides
Stabilized compositions of natriuretic peptides comprise the peptide and an effective stabilizing amount of (i) an alkyl or aryl sulfonyl fluoride protease inhibitor, or (ii) benzamidine: ...

08/17/06 - 20060183680 - Remedy for ischemia
The present invention provides a ischemia therapeutic agent that contains vascularization induction factor and gelatin hydrogel, and gradually releases vascularization induction factor, which is useful in treating ishchemia accompanying peripheral circulatory disorders etc. encountering as complications of arteriosclerosis obliterans, Buerger's disease, diabetes and collagen disease. ...

08/17/06 - 20060183679 - Peptides having a high cysteine content
The invention relates to cysteine containing peptides of the structure XXCCXXXXXXXCXXXCXXXXXXQXXCXXXCXCXXXXXXXCXXXXXX, of the structure XXCCXXXXXXXCXXXCXXXXXXXXXCXXXCXCXXXXTXXCXXXXXX and of the structure XXCCXXXXXXXCXXXCXXXXXXXXXXCXXXCXCXXXXXXXXCXXXXXX, wherein X, independently of one another, represents any naturally occurring amino acid, as well as to nucleic acid sequences encoding said peptides, to vectors comprising said sequences, as well as ...

08/17/06 - 20060183678 - Nogo a binding molecules and pharmaceutical use thereof
This invention relates to molecules, such as for example monoclonal antibodies or Fab fragments thereof, which are capable of binding to the human NogoA polypeptide or human NiG or human NiG- or human NogoA_623-640 with a dissociation constant <1000 nM; polynucleotides encoding such a binding molecule; an expression vector comprising ...

08/17/06 - 20060183677 - Novel exendin agonist formulations and methods of administration thereof
Novel exendin and exendin agonist compound formulations and dosages and methods of administration thereof are provided. These compositions and methods are useful in treating diabetes and conditions that would be benefited by lowering plasma glucose or delaying and/or slowing gastric emptying or inhibiting food intake. ...

08/17/06 - 20060183676 - Treatment of mycobacterium tuberculosis with antisense oligonucleotides
Methods of inhibiting the proliferation of Mycobacterium tuberculosis comprising contacting Mycobacterium tuberculosis with an effective amount of a polynucleotide complementary to an mRNA transcript expressed by Mycobacterium tuberculosis are provided. Typical methods of the invention utilize phosphorothioate modified antisense polynucleotides (PS-ODNs) against the mRNA of M. tuberculosis genes such as ...

08/17/06 - 20060183675 - Antimicrobial polypeptide from aspergillus niger
The present invention relates to an anti-microbial polypeptide and a DNA construct encoding said anti-microbial polypeptide and the use of said anti-microbial polypeptide. ...

08/10/06 - 20060178310 - Intracellular delivery of biological effectors
The invention relates to sequences of amino acids with the capacity to facilitate transport of an effector across a biological membrane. More specifically, the present invention relates to novel peptide transporters that specifically target certain cell types for the intracellular delivery of drugs and therapeutic agents. ...

08/10/06 - 20060178309 - Method for the crystallization of human serum albumin
The present invention relates to the purification and production of human albumin from various sources through crystallization and repeated crystallization. Basic features of the invented process include providing specific reaction conditions and precipitating reagents to maximize albumin crystallization. Solubility diagrams are utilized as the basis for process control of the ...

08/10/06 - 20060178308 - Complement inhibitor
The present invention concerns regulation of complement activation, in particular the fluid phase regulation of complement activation, and provides molecules comprising at least complement control protein modules 1-4 of complement factor H, DNA molecules encoding same, their use in the manufacture of a medicament for inhibiting complement activation and methods ...

08/10/06 - 20060178307 - Modulation of nmda receptor currents via orexin receptor and/or crf receptor
This invention pertains to the discoveries that orexin and/or CRF increase NMDAR (N-methyl-D-aspartate receptor)-mediated currents at excitatory synapses onto a subset of dopamine cells in the ventral tegmental area (VTA) in the mammalian brain. The orexin effect can be blocked by an orexin receptor type 1 (OXR1). The CRF effect ...

08/10/06 - 20060178306 - Modulation of the neuroendoctrine system as a therapy for motor neuron disease
The invention provides a method for treating amyotrophic lateral sclerosis (ALS) in a subject. The method comprises administering to the nervous system of the subject a composition comprising a thyroxine protein or a therapeutic fragment or pharmacologic mimic thereof and a pharmaceutically acceptable carrier. The invention also provides a method ...

08/10/06 - 20060178305 - Antitumor combinations containing a vegf-inhibiting agent and 5fu or a derivative thereof
This invention relates to antitumor combinations comprising a VEGF inhibitor combined with 5-fluorouracil or with a 5-fluoropyrimidine derivative that are therapeutically useful in the treatment of neoplastic diseases, and pharmaceutical compositions comprising such combinations. ...

08/10/06 - 20060178304 - Stabilized pharmaceutical peptide compositions
Method for increasing the shelf-life of a pharmaceutical composition for parenteral administration comprising a glucagon-like peptide which is prepared from a peptide product that has been subjected to treatment at a pH above neutral pH. ...

08/10/06 - 20060178303 - Potassium channel blockers
The present invention is directed to conopeptides termed conkunitzins and their use for blocking the flow of potassium ions through voltage-gated potassium channels. In view of the Kunitz domain in the conkunitzins, they are also useful for inhibiting platelet aggregation and as protease inhibitors. ...

08/10/06 - 20060178302 - Amyloid beta protein (globular assembly and uses thereof)
The invention provides amyloid beta-derived dementing ligands (ADDLs) that comprise amyloid β protein assembled into globular non-fibrillar oligomeric structures capable of activating specific cellular processes. The invention also provides methods for assaying the formation, presence, receptor protein binding and cellular activity of ADDLs, as well as compounds that block the ...

08/10/06 - 20060178301 - Albumin-fused ciliary neurotrophic factor
The invention relates to a fusion protein comprising an albumin, or a fragment or a variant or a derivative thereof and at least one biologically active peptide which activates the ciliary neurotrophic factor (CNTF) receptor, or a fragment or variant or a derivative thereof. ...

08/10/06 - 20060178300 - Heterocarpine, a plant-derived protein with anti-cancer properties
The invention relates to a plant-derived protein with anti-cancer properties which binds the human growth hormone-releasing hormone (hGHRH). Said protein, which is obtained from the Pilocarpus Heterophyllus plant, is particularly adapted for preparing a medicament that is intended for the treatment of cancers for which growth is dependant on the ...

08/10/06 - 20060178299 - Therapeutic epitopes and uses thereof
The invention herein disclosed is related to epitopes useful in methods of diagnosing, treating, and preventing coeliac disease. Therapeutic compositions which comprise at least one epitope are provided. ...

08/03/06 - 20060172946 - Human bikunin
The instant invention provides for proteins, polypeptides, nucleic acid sequences, constructs, expression vectors, host cells, pharmaceutical compositions of, and methods for using human placental bikunin, serine protease inhibitor domains, and fragments thereof. ...

08/03/06 - 20060172945 - Human neutrophil alpha-defensin 4 inhibition of hiv-1
A method to reduce replication of HIV-1, involving administering a therapeutically effective amount of recombinant HNP4 to a subject in need thereof to combat HIV-1 infection. The HNP4 agent may be utilized in pharmaceutical compositions including a pharmaceutically acceptable carrier and an anti-viral agent, e.g., an anti-viral agent, or combination ...

08/03/06 - 20060172944 - Method of treating eye injury with local administration of a vegf inhibitor
Methods of reducing or treating angiogenesis and/or inflammation associated with eye injury in a subject in need thereof, comprising administering an agent capable of blocking or inhibiting vascular endothelial growth factor (VEGF) are provided. The methods are useful for inhibiting or ameliorating eye injury, particularly acute or subacute corneal injury ...

08/03/06 - 20060172943 - Restoring vascular function
The invention relates to Tenascin-C and peptides that bind thereto. According to the invention, Tenascin-C or peptides and antibodies that bind thereto can be used to treat or prevent vascular diseases, either alone or in combination with therapeutic agents or cells that have cardioplastic potential. ...

08/03/06 - 20060172942 - Process for producing polypeptide mixtures using hydrogenolysis
The subject invention provides for a process for making a mixture of acetate salts of polypeptides, each of which consisting of glutamic acid, alanine, tyrosine and lysine, wherein the mixture has a desired peak molecular weight, comprising: a) polymerizing N-carboxyanhydrides of tyrosine, alanine, γ-benzyl glutamate and trifluoroacetyllysine with an initiator ...

08/03/06 - 20060172941 - Anti-angiogenic peptides and methods of use thereof
Anti-angiogenic peptides that inhibit activation or proliferation of endothelial cells are disclosed. Such peptides may be used to inhibit VEGF binding to the VEGFR2 receptor (also known as the kinase domain receptor or KDR) and bFGF binding to its receptor. Such peptides may also be used to inhibit, VEGF, bFGF, ...

08/03/06 - 20060172940 - Antimicrobial agent
The present application discloses a therapeutic antimicrobial composition comprising mucocidin antimicrobial peptides or analogue or fragments thereof having antimicrobial activity. ...

08/03/06 - 20060172939 - Methods and apparatus for creating particle derivatives of hdl with reduced lipid content
The present invention is directed to systems, apparatus and methods for creating derivatives of at least one form of HDL without substantially affecting LDL. These derivatives of HDL are particles with reduced lipid content, particularly reduced cholesterol content. These particles have the capacity to bind cholesterol and are administered to ...

08/03/06 - 20060172938 - Peptide inhibitors against seprase
The invention generally relates compositions and methods for the treatment of patients with melanoma and other malignant cancers. The compositions of the present invention are novel peptide sequences that inhibit seprase-mediated cell migration. Said sequences may also be used for diagnostics and library screening protocols. ...

08/03/06 - 20060172937 - Identification of new ny-eso-1 epitopes recognized by cd4+ t-cells
The invention relates to peptides which bind to MHC molecules of either Class I or Class II, and their use. The peptides consist of amino acid sequences found in the NY-ESO-1 molecule. ...

08/03/06 - 20060172936 - Sulfonamide inhibitors of aspartyl protease
The present invention relates to a novel class of sulfonamides which are aspartyl protease inhibitors. In one embodiment, this invention relates to a novel class of HIV aspartyl protease inhibitors characterized by specific structural and physicochemical features. This invention also relates to pharmaceutical compositions comprising these compounds. The compounds and ...

08/03/06 - 20060172935 - Screening and therapeutic methods for treating circadian rhythm disorders
The invention provides a method for screening for a compound for modulating circadian rhythm. The method involves (a) providing a compound that is a Prokineticin 2 (PK2) receptor antagonist or agonist; and (b) determining the ability of the compound to modulate one or more indicia of circadian rhythm function, wherein ...

08/03/06 - 20060172934 - Method and kit for repairing a defect in bone
Methods and devices are provided for the repair of bone defects. The bone defect repair may be accomplished by minimally invasive means. The bone defect repair may utilize a bone growth promoting substance. The bone growth promoting substance may comprise a carrier material and at least one osteoinductive formulation. ...

08/03/06 - 20060172933 - Natriuretic compounds, conjugates, and uses thereof
Modified natriuretic compounds and conjugates thereof are disclosed in the present invention. In particular, conjugated forms of hBNP are provided that include at least one modifying moiety attached thereto. The modified natriuretic compound conjugates retain activity for stimulating cGMP production, binding to NPR-A receptor, and in some embodiments an improved ...

08/03/06 - 20060172932 - Novel erythropoietin receptor agonists
Disclosed are novel Erythropoietin receptor agonist proteins, DNAs which encode the Erythropoietin receptor agonist proteins, methods of making the Erythropoietin receptor agonist proteins and methods of using the Erythropoietin receptor agonist proteins. ...

08/03/06 - 20060172931 - Heparin-binding peptides and uses thereof
Heparin-binding peptides are provided of the formula R1(X1B1B2X2B3X3Y1R2)nR3, R1(X1B1B2B3X2X3B4X4Y1R2)nR3, and C(X1B1B2B3X2X3B4X4)nC; wherein X1, X2, X3, and X4 are independently selected from the group consisting of hydropathic amino acids; B1, B2, B3, and B4 are independently selected from the group consisting of basic amino acids; C is cysteine; Y1 is zero ...

08/03/06 - 20060172930 - Apoptosis-inducing gene and utilization of the same
The object of the present invention is to provide a protein useful for searching an apoptosis-inhibiting substance or an apoptosis-promoting substance, a gene encoding the above protein, a vector comprising the above gene, and a transformant comprising the above vector. The present invention provides an apoptosis-inducing protein of any one ...

08/03/06 - 20060172929 - Use of natriuretic peptides for the treatment of stature disorders related to the shox gene
The invention relates to the use of natriuretic peptides (ANP or BNP) for the preparation of pharmaceutical compositions for the treatment of short stature in a subject being suspected of having a genetic defect in the human SHOX gene. Further, the invention relates to use of natriuretic peptides in combination ...

08/03/06 - 20060172928 - Composition and method for stabilizing of biomolecules
The present invention relates in general to the field of biotechnology. The invention particularly relates to a composition and process for stabilizing or preserving biological molecules, as well as devices that comprise correspondingly stabilized or preserved biomolecules. ...

08/03/06 - 20060172927 - Analogs of human growth hormone-releasing hormone, their preparation and use
Growth hormone-releasing hormone analogs having the amino acid sequence of the formula: Dat-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr10-R11-R12-VAL-Leu-Ala-Gln-Leu-Ser-Ala-R20-R2-Leu-Leu-Gln-Asp-Ile-Nle-Asp-R29-NH2 (I), wherein R11 is hArg, Gab or Gap; R12 is hArg, Orn, Gab or Gap; R20 is hArg, hArg, Gab or Gap; R21 is hArg, Orn, Gab or Gap; R29 is D-Arg, hArg, Gab or Gap; and ...

07/27/06 - 20060166887 - Method of inducing neuronal production in the brain and spinal cord
The present invention relates to methods of inducing neuronal production in the brain, recruiting neurons to the brain, and treating a neurodegenerative condition by providing a nucleic acid construct encoding a neurotrophic factor, and injecting the nucleic acid construct intraventricularly into a subject's brain. ...

07/27/06 - 20060166886 - Albumin-based colloid composition and method of use in treating hypovolemia and multiorgan dysfunction
A composition comprising an albumin-based colloid and its use in treating hypovolemic conditions such as capillary leak syndrome and shock are disclosed. ...

07/27/06 - 20060166885 - Treatment and prevention of decubitus
Provided is a method for treating a subject suffering from, or at risk of suffering from, decubitus, the method comprising a step of administering erythropoietin (EPO), or a functional part, derivative or analogue thereof to the subject. In certain embodiments, the EPO has been recombinantly produced in host cells that ...

07/27/06 - 20060166884 - Purified rhlgf-i/rhlgfbp-3 complexes and their method of manufacture
Complexes of IGF-I and IGFBP-3 with new levels of purity are provided. Chromatographic techniques have been developed that remove contaminants, such as mass and charge variants of IGFBP-3. The new techniques enable the production of high-quality pharmaceutical compositions comprising IGF-I/IGFBP-3 complexes. ...

07/27/06 - 20060166883 - Novel antimicrobial peptides based on tripeptide repeats
The invention described herein relates to compositions of novel antimicrobial peptides that comprise hydrophobic and cationic residues, based on monomeric tri-peptide units. The peptides of the present invention exhibit high antibacterial activity and low hemolytic activity. The invention further provides compositions comprising these antimicrobial peptides and methods of use thereof ...

07/27/06 - 20060166882 - Liquid, aqueous pharmaceutical composition of factor vii polypeptides
The present invention is directed to liquid, aqueous pharmaceutical compositions containing Factor VII polypeptides, and methods for preparing and using such compositions, as well as vials containing such compositions, and the use of such compositions in the treatment of a Factor VII-responsive syndrome, e.g., bleeding disorders, including those caused by ...

07/27/06 - 20060166881 - Membrane-permeant peptide complexes for treatment of sepsis
Methods and compositions for treating sepsis using cell membrane-permeant peptide conjugate covalent compounds having target cell specificity are provided. ...

07/27/06 - 20060166880 - Control of function of intracellular ca ion
Analysis of substance capable of binding with inositol-1,4,5-triphosphate (IP3) receptor (IP3R), preferably with a regulation domain of IP3R; analysis of the function of IP3R; and establishing of a method of treatment or diagnosis for various malfunctions and diseases associated with IP3R. In particular, control of the activity of intracellular Ca2+ ...

07/27/06 - 20060166879 - Treatment of conditions associated with the presence of macromolecular aggregates, particularly ophthalmic disorders
A method and formulation are provided for the treatment of medical conditions associated with the formation and/or deposition of macromolecular aggregates, particularly those associated with adverse ocular conditions. The formulation contains a non-cytotoxic chelating agent containing at least three negatively charged chelating atoms and a charge-masking agent containing at least ...

07/27/06 - 20060166878 - Peptide antagonists of vascular endothelial growth factor
The present invention provides isolated polypeptides having VEGF antagonist activity, pharmaceutical compositions and methods of treatment. The polypeptides of the invention include polypeptides comprising a portion of SEQ ID NO: 1 having VEGF antagonist activity, polypeptides comprising SEQ ID NO: 2 or a portion thereof having VEGF antagonist activity, and ...

07/27/06 - 20060166877 - Methods of protecting against radiation damage using alpha thymosin
Damage to cells and/or a subject caused by radiation is treated or prevented by administration of an alpha thymosin peptide. ...

07/27/06 - 20060166876 - Delocalization molecules and use thereof
The invention relates to delocalization molecules, methods for the production thereof, and the use thereof as medicaments, especially for treating tumors. ...

07/27/06 - 20060166875 - Single chain recombinant t cell receptors
A single chain T cell receptor (scTCR) comprising an a segment constituted by a TCR α chain variable region sequence fused to the N terminus of a TCR α chain constant region extracellular sequence, a β segment constituted by a TCR β chain variable region fused to the N terminus ...

07/27/06 - 20060166874 - Fvii or fviia variants having increased clotting activity
The present invention relates to novel Factor VII or VIIa variants comprising a substitution in at least one position selected from the group consisting of L39, 142, S43, K62, L65, F71, E82 and F275. Such variants exhibit increased clotting activity as compared to human wild-type Factor VIIa. The present invention ...

07/27/06 - 20060166873 - Preventive/remedy for arteriosclerosis
A scavenger receptor A expression down-regulator and a drug for preventing or treating arteriosclerosis which contain, as the active ingredient, a C-terminal globular domain of adiponectin, adiponectin, or a gene encoding the domain or adiponectin. According to the present invention, there is provided a preventive or therapeutic agent capable of ...

07/27/06 - 20060166872 - Fp receptor antagonists or pgf2 alpha antagonists for treating menorrhagia
A method of treating or preventing menorrhagia in an female individual the method comprising administering to the individual at least one agent that prevents PGP2α having its effect on the FP receptor. Optionally, an inhibitor of PGES and/or an antagonist of EP2 or EP4 is also administered. ...

07/27/06 - 20060166871 - Medical compositions containing ghrelin
It is provided a pharmaceutical composition stably containing ghrelin or its derivative, which is an endogenous growth hormone secretagogue (GHS) to a growth hormone secretagogue-receptor (GHS-R), comprising a aqueous solution containing the ghrelins having pH range of 2 to 7, wherein the aqueous solution having pH range of 2 to ...

07/27/06 - 20060166870 - Treatment of glioblastoma with thymosin-alpha 1
Thymosin-α1 is used as an adjuvant in combination with carmustine (BCNU) as an effective treatment for malignant glioblastoma. ...

07/20/06 - 20060160741 - Dimeric tf antagonists
Dimer FVII polypeptides, which binds and inhibits two TF molecules simultaneously. ...

07/20/06 - 20060160740 - Use of glp-1 or analogs in treatment of stroke
This invention provides a method of reducing mortality and morbidity associated with stroke. GLP-1, a GLP-1 analog, or a GLP-1 derivative, is administered at a dose effective to normalize blood glucose. ...

07/20/06 - 20060160739 - Grf-containing lyophilized pharmaceutical compositions
Human growth hormone factor (GFR) containing pharmaceutical compositions are described, and more precisely, lyophilized compositions of hGRF stabilized by means of saccharose. ...

07/20/06 - 20060160738 - Stem cell factor-like proteins and uses thereof
The invention relates to pharmaceutical compositions comprising gastrointestinal proliferative factor SCFA2, SCFA4 or SCFA4v polynucleotides and polypeptides. The invention further relates to the therapeutic use of SCFA2, SCFA4 or SCFA4v to prevent or treat conditions or disorders associated with the degeneration of the epithelial mucosa. ...

07/20/06 - 20060160737 - Methods of using il-1 antagonists to treat polymyalgia rheumatica and giant cell arteritis
Methods of treating, inhibiting, or ameliorating polymyalgia rheumatica (PMR) and/or giant cell arteritis (GCA) in an adult or juvenile human subject in need thereof, comprising administering to a subject in need a therapeutic amount of an interleukin 1 (IL-1) antagonist, wherein PMR and/or GCA are inhibited, or ameliorated. The IL-1 ...

07/20/06 - 20060160736 - Pharmaceutical compositions and methods for restoring beta-cell mass and function
Pharmaceutical compositions and methods for using are provided for restoring β-cell mass and function in a mammal in need thereof. The pharmaceutical compositions have a biological response modifier and a β-cell growth factor in admixture with a pharmaceutically acceptable carrier, adjuvant or vehicle. ...

07/20/06 - 20060160735 - Beta-peptoids with antimicrobial activity
The present invention relates to beta-peptoids with antimicrobial activity. The present invention also relates to methods of producing β-peptoids. The antimicrobial β-peptoids of the invention are useful in pharmaceutical, healthcare, medical device, industrial, food, agricultural, and personal care applications. ...

07/20/06 - 20060160734 - In situ method for treatment and repair of meniscal injuries
A method for in situ repair of meniscal injuries comprising induction of meniscal repair and regeneration by introducing an adhesive collagen-polyethylene glycol (PEG) hydrogel to a site of injury alone, supplemented with a synovial tissue or in conjunction with a support matrix. ...

07/20/06 - 20060160733 - Compositions and methods for treating and preventing heart tissue degeneration and uses thereof
The present invention provides compositions useful for cardiac therapy comprising a cyclin-associated agent. The present invention also provides kits for use in delivering a cyclin-associated agent to cardiac cells in a subject, comprising the composition of the present invention and a catheter. The present invention additionally provides a methods for ...

07/20/06 - 20060160732 - Compositions and methods for inhibiting cell senescence and hyperproliferative disorders
The present disclosure provides compositions and methods for inhibiting cell and/or organismic senescence by treating conditions associated with aging and preventing undesirable cell proliferation. Compositions provided in the present disclosure include a transport agent attached to a therapeutic agent portion, wherein the transport agent portion has a role in transporting ...

07/20/06 - 20060160731 - Peptide nucleic acids
A novel class of compounds, known as peptide nucleic acids, bind complementary ssDNA and RNA strands more strongly than a corresponding DNA. The peptide nucleic acids generally comprise ligands such as naturally occurring DNA bases attached to a peptide backbone through a suitable linker. ...

07/20/06 - 20060160730 - Target for angiogenesis and anti-angiogenesis therapy
The present disclosure concerns the use of peptides and compositions, such as pharmaceutical compositions, to influence angiogenesis. Particular methods are useful for promoting angiogenesis, while others are particularly useful for inhibiting angiogenesis. ...

07/20/06 - 20060160729 - Methods and compositions for manipulating the guided navigation of endothelial tubes during angiogenesis
Methods and compositions for manipulating the directed navigation of physiological tracking tubular structures are provided. A novel cell-bound receptor, roundabout-4 (Robo-4), is described. The Robo-4 receptor shows sequence and structural similarity to members of the roundabout family of receptors. Also, the Robo-4 receptor binds Slit ligand, a known receptor of ...

07/20/06 - 20060160728 - Diagnostic and therapeutic use of ensandin-0138 gene and protein for neurodegenerative diseases
The present invention discloses the differential expression of a gene coding for Ensadin-0138 in specific brain regions of Alzheimer's disease patients. Based on this finding, this invention provides a method for diagnosing or prognosticating a neurodegenerative disease, in particular Alzheimer's disease, in a subject, or for determining whether a subject ...

07/13/06 - 20060154870 - Method for prevention or treatment of diseases or disorders related to excessive formation of vascular tissue or blood vessels
This invention concerns a method for treating or preventing a disease or disorder related to excessive formation of vascular tissue or blood vessels in a patient, said method comprising administering to said patient an agent affecting the NPY Y2 receptor. ...

07/13/06 - 20060154869 - Liver regeneration promoting agent
Although it is known that adiponectin, which is adipose-specific protein, has effects of suppressing the proliferation and migration of vascular smooth muscle, an effect against arteriosclerosis, an effect of inhibiting the activation of monocytes and macrophages and an anti-inflammatory effect, its action on hepatic stellate cells has never been known ...

07/13/06 - 20060154868 - Guanylate cyclase receptor agonists for the treatment of tissue inflammation and carcinogenesis
A method of treatment of inflamed, pre-cancerous or cancerous tissue or polyps in a mammalian subject is disclosed. The treatment involves administration of a composition of at least one peptide agonist of a guanylate cyclase receptor and/or other small molecules that enhance intracellular production of cGMP. The at least one ...

07/13/06 - 20060154867 - Compounds for targeting hepatocytes
We describe compounds that bind to and are internalized by hepatocytes. Association of these compounds to other molecules or complexes can be used to target the molecules or complexes to hepatocytes in vivo or in vitro. ...

07/13/06 - 20060154866 - Combination therapy for the treatment of diabetes and conditions related thereto and for the treatment of conditions ameliorated by increasing a blood glp-1 level
The present invention concerns combination of an amount of a GPR119 agonist with an amount of a dipeptidyl peptidase IV (DPP-IV) inhibitor such that the combination provides an effect in lowering a blood glucose level or in increasing a blood GLP-1 level in a subject over that provided by the ...

07/13/06 - 20060154865 - Conjugates of insulin-like growth factor-1 and poly(ethylene glycol)
A conjugate consisting of an insulin-like growth factor-1 (IGF-I) variant and one or two poly(ethylene glycol) group(s), characterized in that said IGF-I variant has an amino acid alteration at up to three amino acid positions 27, 37, 65, 68 of the wild-type IGF-I amino acid sequence so that one or ...

07/13/06 - 20060154864 - Transcript factor and an akt substrate related to transcriptional action of insulin and applications of same
A transcription factor capable of activating multiple insulin-responsive genes. In one embodiment, the transcription factor includes an NH2-domain containing thirteen epidermal growth factor (EGF)-like repeats proximate to the N-terminus, a solitary calcium-binding EGF-like domain proximate to the C-terminus, and three consecutive fibronectin type III (fn3) domains between the NH2-domain and ...

07/13/06 - 20060154863 - Methods and compositions for treating conditions
The invention relates to compositions comprising of SEQ NO: 1-244, 248-249, and any homologs, analogs, and fragments thereof. Such compositions can be used to treat, prevent, and modulate pain, inflammation, and metabolic processes in various organisms including plants and animals. Such compositions can be formulated with an acceptable pharmaceutical excipient ...

07/13/06 - 20060154862 - Processes for preparing a polypeptide
The present invention relates to processes for preparing a polypeptide or pharmaceutically acceptable salt thereof comprising L-tyrosine, L-alanine, L-glutamate and L-lysine. The polypeptide or pharmaceutically acceptable salt thereof is preferably glatiramer acetate. ...

07/13/06 - 20060154861 - Method for screening substances capable of inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells
There are provided PACAP which is a substance capable of inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells, a method for inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells in a human by PACAP administration, a pharmaceutical composition ...

07/13/06 - 20060154860 - Manipulating stem-progenitor cell trafficking to injured tissue and/or tumors by altering hif-1 and/or sdf-1 activity
The present invention relates to a method for modulating recruitment of stem cells or progenitor cells to a selected tissue site. Methods for treating damaged tissue and for treating cancerous tumor tissue are also disclosed. These methods involve regulating HIF-1 and/or SDF-1 activity in the tissue. ...

07/13/06 - 20060154859 - Leptin antagonists
The invention relates to synthetic leptin antagonists in which at least two amino acid residues of the sequence LDFI/S of the hydrophobic binding site at positions 39-42 of a leptin polypeptide sequence are substituted with different amino acid residues such that the site becomes less hydrophobic, and fragments of said ...

07/13/06 - 20060154858 - Canine rankl and methods for preparing and using the same
The present invention provides isolated nucleic acid molecules that encode a substantial part of canine RANKL polypeptide, including the extracellular domains of that polypeptide, the polypeptide and fragments thereof. Vectors and host cells encoding and expressing canine RANKL polypeptide are provided, as well as antibodies that bind to RANKL and ...

07/06/06 - 20060148709 - Neuroprotective properties of gdf-15, a novel member of the tgf-beta superfamily
The present invention relates to a transforming growth factor-beta (TGF-β)-like protein which is derived from neurons and glial cells, and which has a neurotrophic effect on dopaminergic (DAergic) neurons, to nucleic acids coding for the protein, to a vector containing the nucleic acids, to host organisms containing the nucleic acids ...

07/06/06 - 20060148708 - C5a receptor
A human C5a receptor polypeptide and DNA (RNA) encoding such polypeptide and a procedure for producing such polypeptide by recombinant techniques is disclosed. Also disclosed are methods for utilizing such polypeptide for identifying antagonists and agonists to such polypeptide. Antagonists and agonists may be used therapeutically to inhibit or stimulate ...

07/06/06 - 20060148707 - Use of ligands to gaba beta receptors
The invention relates to the use of ligands to GABAB receptors for increasing neurotrophin levels in the central nervous system. ...

07/06/06 - 20060148706 - Composition for wound healing and use thereof
The invention relates to a method for treatment of wound healing, comprising administering to a patient in need of such treatment with an effective amount of a polypeptide comprising amino acid sequence or a conservative variant thereof having EGF-like domain of thrombomodulin. The invention also relates to a composition for ...

07/06/06 - 20060148705 - Vegf-binding fusion proteins and therapeutic uses thereof
Nucleic acid molecules encoding fusion proteins which bind and inhibit vascular endothelial growth factor (VEGF). The VEGF-binding fusion proteins are therapeutically useful for treating VEGF-associated conditions and diseases, and are specifically designed for local administration to specific organs, tissues, and/or cells. ...

07/06/06 - 20060148704 - Supplemented matrices for the repair of bone fractures
Supplemented matrices comprising a PTH releasably incorporated therein, optionally containing a granular material, are described herein. The PTH is incorporated either through covalent linkage to the matrix or through non-covalent interaction with the matrix and/or the granules. These supplemented matrices decrease the time of healing compared to autograft and or ...

07/06/06 - 20060148703 - Sustained delivery of pdgf using self-assembling peptide nanofibers
The present invention is directed to a therapeutic composition in which human PDGF is bound directly to peptides that self assemble into a biologically compatible gel. When implanted in a patient's body, the composition provides for the slow, sustained release of PDGF. The composition will be especially useful in treating ...

07/06/06 - 20060148702 - Methods of increasing cerebral blood flow
Methods of increasing blood flow in a mammalian brain blood vessel characterized by, or otherwise experiencing, decreased blood flow due to an ischemic or other hypoxic event, vasoconstriction or vasospasm following hemorrhagic stroke; due to chronic high blood pressure; and/or due to idiopathic causes are provided. The method for increasing ...

07/06/06 - 20060148701 - Surfactant protein c esters
Novel surfactant protein C esters suitable for preparing pharmaceutical compositions for the treatment of infant respiratory distress syndrome and adult respiratory distress syndrome are described. ...

07/06/06 - 20060148700 - Methods and compositions for reducing injury to a transplanted organ
Methods for reducing injury to a transplanted mammalian organ or tissue, including inhibiting the development of graft blood vessel disease, are provided. In one form, a method includes administering compositions that include one or more PKC regulators to an organ or tissue donor and an organ or tissue recipient. Methods ...

07/06/06 - 20060148699 - Counterion exchange process for peptides
The invention encompasses a process for purifying a peptide comprising loading a peptide onto a RP-HPLC column; washing the column with an aqueous solution of a pharmaceutically acceptable counterion salt; and eluting the peptide from the column with a solvent mixture of a organic solvent and an acid of the ...

07/06/06 - 20060148698 - Storage-stable fibrinogen solutions
Methods are provided for the stable storage of ready-to-use, biocompatible mammalian fibrinogen, which despite its concentration, remains available in fluid form, and which will permit long-term rapid and easy processing into a tissue adhesive preparation. Also provided is the sterile, storage-stable aqueous fibrinogen product resulting from the use of the ...

07/06/06 - 20060148697 - Methods for treating and preventing brain cancers
Methods are provided for treating brain cancer, preventing or slowing proliferation of cells of prostate origin, preventing brain cancer in a patient at risk of contracting brain cancer, preventing or inhibiting an upregulation of the cell cycle in brain-derived cells in a patient, and decreasing the level of brain cancer-specific ...

07/06/06 - 20060148696 - Protozoan derived compositions and methods for treating autoimmune disease
The instant invention relates to methods for treating a subject suffering from or susceptible to an autoimmune disease or disorder, or a disease or disorder having an autoimmune component, comprising administering to the subject an effective amount of cyclophilin or a biologically active fragment thereof. ...

07/06/06 - 20060148695 - Novel angiogenic composition and use thereof
The invention relates to a composition for promoting angiogenesis, for controlling DNA synthesis of a cell, and for controlling chemotactic motility of a cell. The invention also relates to a method for treating ischemia diseases. ...

07/06/06 - 20060148694 - Inhibition of stress-induced ligand-dependent egfr activation
The present invention relates to the inhibition of stress-induced receptor tyrosine kinase activity by inhibiting a ligand of said receptor tyrosine kinase, particularly an extracellular ligand. ...

07/06/06 - 20060148693 - Composition comprising a pulmonary surfactant and a pde5 inhibitor for the treatment of lung diseases
The invention relates to the combined administration of a pulmonary surfactant and a PDE5 inhibitor for the treatment of a disease in which pulmonary surfactant malfunction and/or phosphodiesterase 5 (PDE5) activity is detrimental. ...

07/06/06 - 20060148692 - Novel protein and its dna
A protein, a polynucleotide, an antibody of the present invention, etc. are useful as, for example, a diagnostic marker for a neurodegenerative disease and so on. A compound promoting or inhibiting the activity of the protein, a compound promoting or inhibiting the expression of a gene for the above protein, ...

07/06/06 - 20060148691 - Sustained release preparation for therapy of coronary stenosis or obstruction
A pharmaceutical composition for therapy of coronary artery narrowing or blockage, which comprises a sustained release preparation containing an angiogenesis factor or a gene encoding the same and a gelatin hydrogel is disclosed. Examples of the angiogenesis factor which may be used include e.g., bFGF and other FGFs, VEGF, HGF, ...

07/06/06 - 20060148690 - Secreted peptides
This invention provides secreted active peptides, methods and compositions for making such peptides, and methods of using the peptides in detection assays, for disease diagnosis, for disease treatment and for drug development, in particular for microbial or viral infections. ...

07/06/06 - 20060148689 - Peptides with affinity for a phospholipid and uses
in which the amino acids J are chosen, independently of one another, from essential amino acids, or derivatives thereof, such that at least 50% of them are polar residues chosen from Arg, Asn, Asp, Cys, Gln, Glu, Gly, His, Lys, Orn, Pro, Ser, Thr and Tyr; the amino acids U ...

07/06/06 - 20060148688 - Use of na, k-atpase a-and b-subunits in bladder cancer detection and drug screening
Methods are provided for determining the malignancy of cells in a bladder carcinoma sample. Expression patterns of Na,K-ATPase α and β subunits are shown to be associated with recurrence risk in these cancers. Detection of Na,K-ATPase α and β subunits expression in bladder carcinomas provides a useful diagnostic for predicting ...

07/06/06 - 20060148687 - Proteolysis resistant active vegf
The invention relates to endothelial growth factor (VEGF) in which the alanine at AA position 111 is replaced by proline. The arginine at AA position 110 may moreover be replaced by another amino acid. The invention also relates to derivatives of the VEGF according to the invention, nucleic acids, expression ...

06/29/06 - 20060142200 - Compounds and methods for lowering cholesterol levels without inducing hypertrigylceridemia
This invention provides methods of lowering cholesterol, delaying the onset of atherosclerosis, or treating atherosclerosis in a mammal without inducing hypertriglyceridemia. These methods involve administrating to or expressing in a mammal, an apoE polypeptide or nucleic acid that, when administered to or expressed in a mammal, lowers the total serum ...

06/29/06 - 20060142199 - Cd-44 like protein
The present invention concerns a novel CD44-like protein receptor. In particular, isolated nucleic acid molecules are provided encoding the CD44-like protein. CD44-like polypeptides are also provided, as are screening methods for identifying agonists and antagonists capable of enhancing or inhibiting CD44-like protein-mediated signaling. The invention further concerns therapeutic methods for ...

06/29/06 - 20060142198 - Compositions for treating wounds and processes for their preparation
The present invention provides a process for obtaining growth factors by treating a growth factor starting material to release growth factors from the growth factor starting material and recovering growth factors from the treated growth factor starting material. The growth factor obtained can be used in compositions to treat humans. ...

06/29/06 - 20060142197 - Tnf receptor and steroid hormone in a combined therapy
The present invention relates to the use of a TNF Receptor together with a steroid hormone to produce a pharmaceutical composition for the treatment of lethal bacterial and viral infections as well as autoimmune and inflammatory diseases. It also relates to said pharmaceutical compositions for the simultaneous separate or sequential ...

06/29/06 - 20060142196 - Uses of gdnf and gdnf receptor
GDNFRα, GDNFRα extracellular domain (ECD), GDNFRα variants, chimeric GDNFRα (e.g., GDNFRα immunoadhesin), and antibodies which bind thereto (including agonist and neutralizing antibodies) are disclosed. Various uses for these molecules are described, including methods to modulate cell activity and survival by response to GDNFRα-ligands, for example GDNF, by providing GDNFRα to ...

06/29/06 - 20060142195 - Non-neurotoxic plasminogen activating factors for treating of stroke
The invention pertains to the use and production of non-neurotoxic plasminogen activating factors e.g. of Desmodus rotundus (DSPA) for the therapeutic treatment of stroke in humans in order to provide a new therapeutic concept for treating stroke in humans. ...

06/29/06 - 20060142194 - Methods and compounds for treating brain amyloidosis
The present invention discloses the use of (i) a fragment of the amyloid precursor protein (APP); or, (ii) a derivative of (i); or, (iii) a functional mimetic of (i) or (ii), in the preparation of a medicament for modulating CNS levels and/or activity of a member of the neprilysin family. ...

06/29/06 - 20060142193 - Selective inhibition of rock1 in cardiac therapy
The present invention is directed to the treatment and/or prevention of disease as it relates to Rho kinase. In specific embodiments, disease is treated and/or prevented through the administration of an agent that selectively inhibits ROCK1. In specific embodiments, it inhibits ROCK1 and not ROCK2. In other specific embodiments, the ...

06/29/06 - 20060142192 - Soluble zcytor21, anti-zcytor21 antibodies and binding partners and methods of using in inflammation
The present invention relates ZcytoR21 antagonists, such as soluble receptors and anti-ZcytoR21 antibodies, that are useful in blocking, inhibiting, reducing, antagonizing or neutralizing the activity of IL-17C. IL-17C is a cytokine that is involved in inflammatory processes and human disease. ZcytoR21 is a receptor for IL-17C. The present invention includes ...

06/29/06 - 20060142191 - Viral complement control proteins for eye disorders
The present invention provides compositions and methods for treating and/or preventing age related macular degeneration and other conditions involving macular degeneration or choroidal neovascularization. Certain of the compositions comprise a poxvirus complement control protein or a complement binding fragment or variant thereof. Other compositions comprise a poxvirus complement control protein ...

06/29/06 - 20060142190 - Synthetic peptide, inhibitor to dna viruses
The present invention relates to the identification of the active domain of Herpoxin, a DNA virus-inhibiting-protein which was isolated from cobra venom in U.S. Pat. No. 5,648,339 and has a molecular weight of 13.5 kDa We have isolated a fragment of Herpoxin which contains the active domain and which we ...

06/29/06 - 20060142189 - Methods and agents for treating axonal damage, inhibition of neurotransmitter release and pain transmission, and blocking calcium influx in neurons
The present invention pertains to methods to promote outgrowth of, or extension across a substrate of, neuronal cells by inhibiting the interaction between the cytoplasmic tail of the L1-CAM cell surface adhesion molecule and the cytoskeletal protein ankyrin. The invention also pertains to a method to treat diseases characterized by ...

06/29/06 - 20060142188 - Monkey alpha-7 nicotinic acetylcholine receptor and methods of use thereof
Monkey alpha-7 neuronal nicotinic acetylcholine receptor polypeptides, as well as the DNA (RNA) encoding such polypeptides, are disclosed. Also disclosed are methods for utilizing such polypeptides in diagnostic assays for identifying mutations in nucleic acid sequences encoding the polypeptides of the present invention, for detecting altered levels of the polypeptide ...

06/22/06 - 20060135429 - Compositions and methods for inducing apoptosis in tumor cells
A method is described for using an E-domain peptide for the induction of apoptosis in a cancer cells. In particular, the invention relates to methods for using a-type E-domain peptide from trout IGF and/or a b-type E-domain peptide from human IGF for the induction of apoptosis in a broad spectrum ...

06/22/06 - 20060135428 - Long lasting anti-angiogenic peptides
Modified anti-angiogenic peptides are disclosed. The modified peptides are capable of forming a peptidase stabilized anti-angiogenic peptide. The modified anti-angiogenic peptides, particularly modified kringle 5 peptides are capable of forming a conjugate with a blood protein. Conjugates are prepared from anti-angiogenic peptides, particularly kringle 5 peptides, by combining the peptide ...

06/22/06 - 20060135427 - Formulations of human growth hormone comprising a non-naturally encoded amino acid
Formulations of modified human growth hormone polypeptides are provided. ...

06/22/06 - 20060135426 - Long lasting synthetic glucagon like peptide (glp-1)
Modified insulinotropic peptides are disclosed. The modified insulinotropic peptides are capable of forming a peptidase stabilized insulinotropic peptide. The modified insulinotropic peptides are capable of forming covalent bonds with one or more blood components to form a conjugate. The conjugates may be formed in vivo or ex vivo. The modified ...

06/22/06 - 20060135425 - Intravenous injection of plasminogen non-neurotoxic activators for treating cerebral stroke
The invention refers to the use of non-neurotoxic plasminogen activating factors, e.g., from Desmodus rotundus (DSPA) or genetically modified plasminogen activating factors, for example of human origin, for the therapeutic treatment of stroke in mammals. ...

06/22/06 - 20060135424 - Treatment of short bowel syndrome patients with colon-in-continuity
Intestinal absorption is enhanced in short bowel syndrome patients presenting with colon-in-continuity by treatment with a GLP-2 receptor agonist, such as teduglutide. ...

06/22/06 - 20060135423 - Vegf-a as an inhibitor of angiogenesis and methods of using same
The invention relates to methods and compositions for the treatment or prevention of ocular angiogenesis and neovascularization associated with neovascular disease. Administration of vascular endothelial growth factor (VEGF)-A into the eye when macrophage infiltration is reduced inhibits ocular angiogenesis. ...

06/22/06 - 20060135422 - Use of angiotensin receptor blockers (arbs) to treat diseases associated with excess ace
Disclosed are methods of treating neuropsychiatric diseases, neuromuscular diseases, viral infections, neurodegenerative diseases and ricin poisoning using angiotensin II receptor blockers. ...

06/22/06 - 20060135421 - Unitary combination of fsh and hcg
A novel ovulatory induction paradigm entails administration of hCG in combination with FSH during all stages of treatment, where the ratio of FSH to hCG is adjusted to optimize ovulatory stimulation and minimize complications. The use of compositions characterized by various FSH:hCG ratios enables the practitioner readily to tailor the ...

06/22/06 - 20060135420 - Method of diagnosing non-alcoholic steatohepatitis (nash) using molecular markers
The invention relates to a method of diagnosing non-alcoholic steatohepatitis (NASH) using molecular markers. The inventive method consists in detecting and quantifying, in vitro in a hepatic tissue sample, the levels of a protein which can be used as a NASH molecular marker and which is selected from apolipoprotein A1, ...

06/22/06 - 20060135419 - Proteins involved in the regulation of energy homeostasis
The prevent invention discloses PRL-1 homologous proteins regulating the energy homeostasis and the metabolism of triglycerides, and polynucleotides, which identify and encode the proteins disclosed in this invention. The invention also relates to the use of these sequences in the diagnosis, study, prevention, and treatment of metabolic diseases and disorders. ...

06/22/06 - 20060135418 - Receptors
A multivalent T cell receptor (TCR) complex comprising at least two TCRs, linked by a non-peptidic polymer chain or a peptidic linker sequence. Preferably the TCR complex comprises TCR heterodimers having a non-native disulfide bond between constant domain residues, said TCRs being linked via an optionally substituted, polyalkylene glycol linker. ...

06/22/06 - 20060135417 - Use of the crh (corticotropin releasing hormone)-ucn (urocortin) system in the treatment of inflammatory diseases
The invention relates to the use of corticotropin-releasing hormone (CRH) receptor-1 (R1) antagonists and/or CRH-R2 receptor agonists for the treatment of inflammatory diseases via regulation of monocyte/macrophage cell activation, proliferation, differentiation, apoptosis, and inflammatory cytokine production. As CRH system we define natural and synthetic CRH and urocortin (UCN) agonists and ...

06/22/06 - 20060135416 - Multifunctional context-activated protides and methods of use
This invention is directed to multifunctional, context-activated protides that have two or more effectors with individually distinct biological functions and one or more corresponding activator sites that can each initiate or amplify the biological function of one or more effectors upon context-activation. The context-activated protides of the invention are useful ...

06/15/06 - 20060128627 - Human appetite control by glucagon-like peptide receptor binding compounds
A composition including a compound which binds to a receptor for glucagon-like peptide-1 and a pharmaceutical carrier. The amount of the compound present is effective to control appetite in a human. Also disclosed is a method for controlling appetite and for reducing food intake in a human by administering to ...

06/15/06 - 20060128626 - Method of use of peptide antagonists of zonulin to prevent or delay the onset of diabetes
A method for preventing or delaying the onset of autoimmune diseases is disclosed. ...

06/15/06 - 20060128625 - Povidone-containing carriers for polypeptide growth factors
A liquid carrier medium is provided which is suitable for solubilizing growth factors, such as mixtures of bone morphogenetic proteins, that are found to induce an angiogenic response in ischemic tissues. The liquid medium comprises an aqueous solution of polyvinyl pyrrolidone. ...

06/15/06 - 20060128624 - Pharmacokinetic and pharmacodynamic modeling of erythropoietin administration
The present invention relates to systems and methods for obtaining optimized EPO dosage regimens for a desired pharmacodynamic/pharmacokinetic response. The system includes choosing one or more EPO dosage regimens, then using a PK/PD model to determine the pharmacodynamic/pharmacokinetic profile of one or more EPO dosage regimens, and finally selecting one ...

06/15/06 - 20060128623 - Granulysin peptides and methods of use thereof
Granulysin peptides are small antimicrobial agents with potent activity against bacteria and inflammation. A pharmaceutical composition comprising granulysin peptides as an active agent is administered therapeutically to a patient suffering from a microbial infection. ...

06/15/06 - 20060128622 - Therapeutic formulations of keratinocyte growth factor
The present invention provides long-term stable formulations of lyophilized keratinocyte growth factor and methods for making a lyophilized composition comprising keratinocyte growth factor. ...

06/15/06 - 20060128621 - Pharmaceutical composition of hydrophobically modified hedgehog proteins and their use
The object of the invention is to provide a pharmaceutical composition of a hydrophobically modified hedgehog protein containing a biocompatible carrier, wherein the carrier binds the hedgehog protein as an active folded structure and can release it locally in vivo in an active form in a delayed manner. Such formulations ...

06/15/06 - 20060128620 - Adrenocorticotropic hormone analogs and related methods
ACTH analog compounds of the present invention include compounds comprising an ACTH peptide sequence with one or more structural modifications that can have one or more of the following preferred ACTH analog biological functions: (1) reduction of corticosteroid secretion by adrenal membrane in the presence of the ACTH analog compared ...

06/15/06 - 20060128619 - Therapeutic use of modulators of notch
Provided is a method for modifying IL-4 expression in a cell using a modulator of Notch signalling. Also provided are methods for generating immune modulatory cytokine profiles with increased IL-4 expression and/or increased IL-10 expression and/or reduced IL-5, IL-13 and TNFα expression. In addition, a method for increasing a TH2 ...

06/15/06 - 20060128618 - Molecules which promote hematopoiesis
Peptides, methods for the preparation thereof, medicaments containing the peptides, and their use in selected indications, such as the treatment of various forms of anemia and stroke. ...

06/15/06 - 20060128617 - Oligoribonucleotide or peptidic nucleic acid inhibiting function of hepatitis c virus
A method of inhibiting the replication ability of a hepatitis C virus (HCV) is provided. An oligoribonucleotide or a peptide nucleic acid which sequence-specifically binds to the HCV-RNA, and a therapeutic agent for hepatitis C which contains any of these components as an active ingredient are provided. ...

06/15/06 - 20060128616 - Process for the purification of tnf-binding proteins using imac
A new purification process for Tumor Necrosis Factor-binding proteins is described. In particular this process is characterized by the use as capture step of an Immobilized Metal Affinity Chromatography (IMAC) using copper as metal. This brings advantages in terms of process yields, purity of the final product and applicability to ...

06/15/06 - 20060128615 - Ghrh analogues
The present invention relates to growth hormone-releasing hormone (GHRH) analogues. More particularly, the invention relates to synthetic GHRH analogues of 29 amino acids or more, exhibiting concomitantly an increased resistance to proteolysis and high binding affinity to human GHRH receptor in in vitro studies, in comparison with human native GHRH ...

06/08/06 - 20060122118 - Therapeutic compositions and methods of using same
A targeted composition comprising a modulation molecule, such as an siRNA oligo or a small molecule, and a translocation peptide is disclosed. Methods of making and using the composition are also disclosed. The disclosed composition can be employed in a variety of therapeutic and research applications, in which it is ...

06/08/06 - 20060122117 - Method of treating retinopathies and disorders associated with blood vessel loss
The present invention provides a method of treating or preventing retinopathy in an individual in need thereof, comprising administering to said individual an effective amount of an agonist of VEGFR-1 (vascular endothelial growth factor receptor-1). Another aspect of the invention provides a method of treating or preventing disorders associated with ...

06/08/06 - 20060122116 - Treatment for disorders of the peripheral nervous system
Pleiotrophin is used to treat various conditions, disorders, and diseases which involve damage to the peripheral nervous system. Such conditions include traumatic nerve damage, Charcot-Marie-Tooth disease, amyotrophic lateral sclerosis, spinobulbar muscular atrophy, spinal muscular atrophy, diabetic neuropathy, and uremic neuropathy. Pleiotrophin can be provided as a protein or as a ...

06/08/06 - 20060122115 - Use of serp-1 as an antiplatelet agent
Compositions and methods for antiplatelet/anti-thrombotic therapy in a mammalian subject are provided. The method involves administering a therapeutically effective amount of SERP-1 admixed with a pharmaceutically acceptable carrier to a subject in need of such therapy. Methods of administering SERP-1 with at least one other antiplatelet agent are also provided. ...

06/08/06 - 20060122114 - Antibodies to heregulin 2
Novel 2 polypeptides with binding affinity for the p185HER2 receptor, designated heregulin 2-α and heregulin 2-β, have been identified and purified from human tissue. The cDNA encoding the novel heregulin 2-α has been isolated from human tissue and sequenced. Provided herein is nucleic acid sequence of the heregulin 2-α useful ...

06/08/06 - 20060122113 - Mixtures of polypeptides, compositions containing and processes for preparing same, and uses thereof
The invention provides a composition comprising a mixture of polypeptides, wherein each polypeptide (a) is a copolymer of the amino acids L-glutamic acid, L-alanine, L-tyrosine, and L-lysine, and (b) may be in the form of a pharmaceutically acceptable salt; and wherein in the mixture (i) the polypeptides have an average ...

06/08/06 - 20060122112 - Method for preventing or treating osteosarcoma
Provided is a novel method for preventing or treating osteosarcoma, which comprises administering an effective amount of at least one selected from the group consisting of: (a) a pigment epithelium-derived factor; (b) a variant of the pigment epithelium-derived factor (a) that has the functionally equivalent property to the factor (a), ...

06/08/06 - 20060122111 - Regeneration and neogenesis of retinal visual cell otx2 gene
The present invention provides a medicine, comprising (a) an Otx2 protein or its partial peptide, or a salt thereof, or (b) a DNA or an RNA encoding an Otx2 protein or its partial peptide. The present medicine is useful as an agent for preventing, treating or suppressing progression of a ...

06/08/06 - 20060122110 - Nogo, caspr, f3 nb-3 useful in the treatment of injury and disease to the central nervous system
The application provides materials and methods for promoting myelination of neuronal axons in the CNS. These derive from the findings firstly that the molecules Nogo and Caspr interact with one another during establishment and maintenance of the axoglial junction, and secondly that the molecules F3 and NB-3 are capable of ...

06/08/06 - 20060122109 - Composition for preventing the formation of new scar comprising bmp-7
Composition for preventing the formation of new scar, e.g. myofibroblast, having BMP-7 polypeptide is disclosed. The composition for preventing the formation of scar includes an effective amount of BMP-7 (Bone Morphogenic Protein-7) polypeptide of sequence 1. The effective amount is 50 ng/ml-50 μg/ml or 0.1 ng-1 μg/kg by weight and ...

06/08/06 - 20060122108 - Use of poly-alpha2,8-sialic acid mimetic peptides to modulate ncam functions
The invention relates to the use of a peptide consisting of 5 to 30 amino acid residues, preferably 9 to 15, most preferably about 12 amino acid residues, said peptide comprising a B epitope of a poly-α2,8 sialic acid attached to NCAM, which is recognized by an anti-poly-α2,8 sialic acid ...

06/08/06 - 20060122107 - Method of modulating cellular activity and molecules for use therein
The present invention relates generally to a method of modulating T cell functional activity by utilising β-amino acid substituted peptides and to agents useful for the same. More particularly, the present invention relates to a method of modulating class I restricted T cell activity by utilising β-amino acid substituted peptides ...

06/08/06 - 20060122106 - Prevention and/or treatment of inflammatory bowel disease using pyy or agonists thereof
A novel use of PYY or a PYY agonist is disclosed for treating a bowel condition such as inflammatory bowel disease (e.g. ulcerative colitis and Crohn's disease), bowel atrophy, loss of bowel mucosa and loss of bowel mucosal function. The novel use is based on the discovery and demonstration that ...

06/08/06 - 20060122105 - Method of improing the growth performance of an animal
The invention broadly relates to a method of improving the growth performance of an animal. In particular the present invention relates to a method of improving the growth performance of an animal comprising the step of administering to an animal in need thereof a growth promoting amount of one or ...

06/08/06 - 20060122104 - Methods for in vitro expansion and transdifferentiation of human pancreatic acinar cells into insulin-producing cells
This invention relates, e.g., to a method for expanding mammalian acinar cells, comprising culturing the cells in a cell culture system comprising a cell culture medium and a cell attachment surface, under conditions wherein the acinar cells undergo a 3-4 fold expansion together with transdifferentiation into a modified cell phenotype ...

06/01/06 - 20060116324 - Novel formulations
The present invention relates to compositions comprising coagulation factor FVIIa. ...

06/01/06 - 20060116323 - Tumor-inhibiting protein and the use thereof
The invention has disclosed a new tumor suppressor protein HCRP1, the polynucleotide sequences encoding this polypeptides, and methods for production of the polypeptide using the recombinant technology. The tumor suppression protein, HCRP1, is obtained through the positional candidate cloning strategy. It locates in 8p22 region of human chromosome. The full ...

06/01/06 - 20060116322 - Formation of novel erythropoietin conjugates using transglutaminase
The invention provides biologically active erythropoietin (EPO) conjugate compositions wherein a transglutaminase reaction is employed to covalently and site specifically conjugate the EPO molecule to a non-antigenic hydrophilic polymer that can also be covalently linked to an organic molecule either of which modification increases the circulating serum half-life of the ...

06/01/06 - 20060116321 - Immunosuppressive exosomes
The present invention relates to methods and compositions for use in mediating an immunosuppressive reaction. The compositions of the invention comprise exosomes having immunosuppressive activity. Such exosomes may be derived from a variety of different cell types, including antigen presenting cells such as dendritic cells and macrophages. Prior to isolation ...

06/01/06 - 20060116320 - Growth hormone crystals and a process for production of these gh-crystals
A process for producing cation crystals of growth hormone or growth hormone derivatives, as well as growth hormone and growth derivatives. The process of producing the growth hormone crystals includes the steps of (a) adding cations of inorganic or organic nature and an organic solvent or a mixture of inorganic ...

06/01/06 - 20060116319 - Method for identifying and treating photodamaged skin
The present invention relates to modulation of MAP2K2 and DUSP-1 genes and proteins encoded thereby. More specifically, the present invention relates to modulation of MAP2K2 and DUSP-1 genes to detect and condition photo-damaged skin, preferably, chronically photo-damaged skin, as well as to identify active compounds and compositions for skin conditioning. ...

06/01/06 - 20060116318 - Preptin methods of use
This invention features a method for treating a bone condition in a patient, e.g., a mammal, a human, a horse, a dog, or a cat. The method includes administering an effective amount of preptin, preptin analog, or a preptin agonist to the patient. ...

06/01/06 - 20060116317 - Characterization of a membrane estrogen receptor
The present disclosure relates to a process for dyeing keratin materials with compositions comprising, in a medium that is suitable for dyeing, at least one ninhydrin derivative, which may optionally be combined with at least one compound comprising at least one labile hydrogen. Further disclosed herein are dying compositions, multi-component ...

05/25/06 - 20060111298 - Compositions and therapeutic methods using morphogenic proteins and stimulatory factors
The present invention provides pharmaceutical compositions comprising a morphogenic protein stimulatory factor (MPSF) for improving the tissue inductive activity of morphogenic proteins, particularly those belonging to the BMP protein family. Methods for improving the tissue inductive activity of a morphogenic protein in a mammal using those compositions are provided. This ...

05/25/06 - 20060111297 - Blood factor domains
The present invention provides methods and compositions for detecting, diagnosing, prognosing and monitoring the progress of diseases. Further provided are methods for screening to identify agonists and antagonists of antigens associated with these diseases. ...

05/25/06 - 20060111296 - Plasmin-inhibitory therapies
The disclosure features a method of treating cancers, angiogenesis-related disorders and lymphangiogenesis-related disorders with plasmin inhibitors. An exemplary method includes: administering, to a subject, a plasmin inhibitor, such as a protein that includes a Kunitz domain that inhibits plasmin. ...

05/25/06 - 20060111295 - Cellular receptors utilized as carrier agents for pharmaceutical compounds used in the treatment of arthritis, inflammation and immune disorders
This invention describes a method of utilizing soluble receptors such as tumor necrosis factor receptor or interleukin receptor to carry pharmaceutical compounds to areas of inflammation. Patients with inflammatory disease such as arthritis, or cardiomyopathy or other inflammatory conditions may benefit from this treatment. ...

05/25/06 - 20060111294 - Use of a polypeptide domain to modulate the tumorigenic and metastatic potential of cancer cells
The present invention relates to the use of a polypeptide domain to modulate the tumorigenic and metastatic potential of cancer cells. More specifically, the present invention relates to a domain of a Secretory Leukocyte Protease Inhibitor (SLPI) to modulate tumor invasiveness and/or metastasis. It further relates to compounds, such as ...

05/25/06 - 20060111293 - Antagonists for human prolactin
Modified prolactin molecules wherein the prolactin molecule comprises at least one mutation in a region selected from i) amino acids 41-57, ii) amino acids 94-110, and iii) amino acids 160-173; and wherein the at least one mutation is selected from deletions, replacements, and insertions. The modified prolactins are prolactin antagonists, ...

05/25/06 - 20060111292 - Compositions for mucosal and oral administration comprising hcg fragments
The invention relates to the field of immunology, more specifically to the field of immune-mediated disorders such as allergies, auto-immune disease, transplantation-related disease and other inflammatory diseases. The invention in particular relates to the systemic treatment of inflammatory disease by oral or mucosal administration of a pharmaceutical composition with a ...

05/25/06 - 20060111291 - Uv device for treating osteolysis
Irradiating osteolytic regions with UVB light. ...

05/25/06 - 20060111290 - Use of sdf-1 or g-csf to improve myocardial function after ischemic injury
This invention provides methods of improving myocardial function in a subject after ischemic injury comprising administering G-CSF or SDF-1 to the subject. ...

05/25/06 - 20060111289 - Compositions and methods of using alpha-fetoprotein growth inhibitory peptides
This invention describes compositions related to growth inhibitory protein-derived peptide fragments. These fragments can be identified by several methods including homology comparison and amino acid pairing techniques. Certain fragment sequences have been shown to provide homology to various biological activities and are contemplated as potential therapeutic agents. These biological activities ...

05/25/06 - 20060111288 - Peripheral benzodiazepine receptor independent superoxide generation
A method of treating cancer through the application of a compound that causes the intra-mitochondrial generation of reactive oxygen species in tumor cells by a mechanism that is independent of the peripheral benzodiazepine receptor. ...

05/25/06 - 20060111287 - Acetylated protein
An isolated multiply acetylated protein HMGB1; or a variant or fragment thereof, or a polynucleotide encoding therefor. ...

05/25/06 - 20060111286 - Method of modulating endothelial cell activity
The present invention relates generally to a method of modulating endothelial cell activity and to agents useful for same. More particularly, the present invention relates to a method of modulating intercellular vascular endothelial permeability by modulating an intracellular protein kinase C-dependent signalling mechanism. The method for the present invention is ...

05/25/06 - 20060111285 - Use of granme b as an hsp70/hsp70 peptide dependent inducer of apoptosis in tumor cells
The present invention relates to a method of inducing or enhancing the expression of granzyme B in natural killer (NK) cells. The present invention relates also to a use of said NK cells for the preparation of a pharmaceutical composition for the treatment of tumors, viral or bacterial infections or ...

05/25/06 - 20060111284 - Method for treating cancer
A method of treating lymphoma, ovarian cancer, colorectal cancer, or gastric cancer by administering an effective amount of Mesna to a patient is provided. A method for treating and reducing the effective dose of an anti-cancer agent by administering Mesna in conjunction with an anti-cancer agent is also provided. ...

05/25/06 - 20060111283 - Prevention therapy and prognosis/monitoring in sepsis and septic shock
The invention relates to the use of a peptide which binds to lipopolysaccharide (LPS) or lipoteichoic acid (LTA), for manufacturing a pharmaceutical composition for treating sepsis or septic shock, wherein the peptide comprises the amino acid sequence of apolipoprotein CI (apoCI) or a part thereof that comprises at least the ...

05/25/06 - 20060111282 - Factor vii or viia polypeptide variants
The present invention relates to novel polypeptide variants of factor VII (FVII) or factor VIIa (FVIIa) polypeptides, where said variants comprise an amino acid substitution in position 10 and 32 and where said variants further comprise a sugar moiety covalently attached to an introduced in vivo N-glycosylation site located outside ...

05/18/06 - 20060105955 - Topical drug delivery using phosphatidylcholine
The present invention relates to compositions and methods for transdermal drug delivery comprising formulating a phosphatidylcholine carrier composition containing the drug and applying the composition to the skin. ...

05/18/06 - 20060105954 - Glucagon-like peptide-2 and its therapeutic use
Glucagon-like peptide 2, a product of glucagon gene expression, and analogs of glucagon-like peptide 2, have been identified as gastrointestinal tissue growth factors. Their effects on the growth of small bowel and pancreatic islets are described. Their formulation as a pharmaceutical, and their therapeutic use in treating disorders of the ...

05/18/06 - 20060105953 - System for protease mediated protein expression
The present invention provides methods and materials that can be used to detect, examine and exploit protease mediated protein expression. An illustrative embodiment of the invention is a polynucleotide encoding a polypeptide having a plurality of operatively linked elements comprising a polypeptide degradation signal that functions as a proteosome substrate; ...

05/18/06 - 20060105952 - Modified annexin proteins and methods for their use in organ transplantation
Modified annexin proteins, including a homodimer of human annexin V, are provided. Methods for their use, such as to prevent thrombosis without increasing hemorrhage and to attenuate ischemia-reperfusion injury (IPI), are also provided. The modified annexins bind phosphatidylserine (PS) on cell surfaces, thereby preventing the assembly of the prothromkinase complex. ...

05/18/06 - 20060105951 - Melanocortin receptor binding mimetibodies, compositions, methods and uses
Melanocortin receptor binding mimetibody polypeptides are disclosed. Polynucleotides encoding these polypeptides, cells comprising these polynucleotides or expressing the mimetibodies, and methods of making and using the forgoing are also disclosed. ...

05/18/06 - 20060105950 - Morphogen compositions and use thereof to treat wounds
Disclosed are compositions and methods for promoting or accelerating wound healing and preventing, treating, or reducing symptoms associated with wounds or wounding disorders such as diabetic ulcers and burns. In one embodiment, the method includes administering a therapeutically effective amount of a nucleic acid encoding at least one morphogen, or ...

05/18/06 - 20060105949 - Pharmaceutical preparations and methods for inhibiting tumors
The invention provides pharmaceutical compositions and method for inhibiting growth of prostatic adenocarcinoma, stomach cancer, breast cancer, endometrial, ovarian or other cancers of epithelial secretion, or benign prostate hyperplasia (BPH) In one embodiment the pharmaceutical composition includes human rHuPSP94, antigenic portions thereof, and functionally equivalent polypeptides thereof. In another embodiment, ...

05/18/06 - 20060105948 - Glp-2 derivatives
The present invention relates to novel derivatives of human glucagon-like peptide-2 (GLP-2) peptides, which have a protracted profile of action, as well as pharmaceutical compositions, uses and methods of treatment. ...

05/18/06 - 20060105947 - Novel chimeric analgesic peptides
The present invention provides a novel chimeric peptide containing an opioid peptide moiety and a nociceptive peptide moiety for producing analgesia ...

05/18/06 - 20060105946 - Method for treating the central nervous system by administration of igf structural analogs
This invention is directed to a method for treating a disease or disorder of the brain or spinal cord in a mammal, including human, comprising the administration of an effective amount of an insulin-like growth factor (IGF) structural analog at a site outside of the blood-brain, blood-central nervous system, or ...

05/11/06 - 20060100153 - Hsulf-1 nucleic acids, polypeptides and methods of using
HSulf-1 nucleic acids and polypeptides are provided, as are methods of using the nucleic acids and polypeptides. ...

05/11/06 - 20060100152 - Methods and compositions in treating pain and painful disorders using 9949, 14230, 760, 62553, 12216, 17719, 41897, 47174, 33408, 10002, 16209, 314, 636, 27410, 33260, 619, 15985, 69112, 2158, 224, 615, 44373, 95431, 22245, 2387, 16658, 55054, 16314, 1613
The present invention relates to methods for the diagnosis and treatment of pain or painful disorders. Specifically, the present invention identifies the differential expression of 9949, 14230, 760, 62553, 12216, 17719, 41897, 47174, 33408, 10002, 16209, 314, 636, 27410, 33260, 619, 15985, 69112, 2158, 224, 615, 44373, 95431, 22245, 2387, ...

05/11/06 - 20060100151 - Methods of treating osteoarthritis using il-17 receptor proteins in combination with tnf-receptor proteins
Methods for regulating levels of nitric oxide are disclosed. The methods utilize IL-17 receptors, which may be used in conjunction with inhibitor of IL-1 and/or TNF. ...

05/11/06 - 20060100150 - Pharmacokinetic and pharmacodynamic modeling of erythropoietin administration
The present invention relates to systems and methods for obtaining optimized EPO dosage regimens for a desired pharmacodynamic/pharmacokinetic response. The system includes choosing one or more EPO dosage regimens, then using a PK/PD model to determine the pharmacodynamic/pharmacokinetic profile of one or more EPO dosage regimens, and finally selecting one ...

05/11/06 - 20060100149 - Conjugates of membrane translocating agents and pharmaceutically active agents
Membrane translation peptides, compositions comprising them, chimeric molecules comprising them, and methods of using them to achieve transmembrane transport of various agents. ...

05/11/06 - 20060100148 - Peptide viral entry inhibitors
The present invention provides, inter alia, peptide compositions and methods for treating and preventing Flaviviridae virus (e.g., HCV) infections. ...

05/11/06 - 20060100147 - Anticancer peptide
A polypeptide and methods of using the polypeptide for treating malignancy by administering to a subject a composition of the polypeptide. Pharmaceutical compositions of the polypeptide. ...

05/11/06 - 20060100146 - Awat-related methods and articles
This invention provides methods for treating a subject afflicted with acne or another sebaceous gland disorder comprising administering to the subject a therapeutically effective amount of an agent which inhibits acyl-CoA wax alcohol acyltransferase 1 (AWAT1) and/or acyl-CoA wax alcohol acyltransferase 2 (AWAT2), thereby treating the subject. This invention further ...

05/11/06 - 20060100145 - Human chondroosteomodulin (tig2), production, and use for the treatment or diagnosis of bone diseases, cartilage diseases, cartilage diseases, obesity, inflammatory diseases, and skin diseases
The invention relates to the polypeptide COM and its derivatives, and methods for its preparation and recovery in a pure or partially purified form from body fluids and tissues, and its use as a medicament. ...

05/11/06 - 20060100144 - Conjugates of insulin-like growth factor binding protein-4 and poly (ethylene glycol)
A conjugate consisting of insulin-like growth factor binding protein 4 (IGFBP-4) and one or two polyethylene glycol) group(s), said polyethylene glycol) group(s) having an overall molecular weight of from about 30 to about 40 kDa is disclosed. This conjugate is useful for the treatment of cancer. ...

05/11/06 - 20060100143 - Polypeptide
The invention relates to a polypeptide, or part thereof, which inhibits the apoptotic activity of the tumour suppressor protein p53 and including screening methods to identify agents which interfere with the activity of said polypeptide. ...

05/11/06 - 20060100142 - Use of uk114 in the treatment of leishmaniasis
This invention relates to the use of the protein UK114, possibly associated with ubiquitin, for the treatment of leishmaniasis in humans and animals. ...

05/04/06 - 20060094657 - Inhibiting development of microvessels within coronary or peripheral vessel walls for restenosis/atherosclerosis prevention or therapy
Disclosed and claimed are compositions and methods for therapy and/or prevention of restenosis and/or atherosclerosis. The compositions can include an agent for inhibiting VEGF and an agent for including vessel maturation; for instance, the soluble VEGF receptor and ang-1. Embodiments can include kits. ...

05/04/06 - 20060094656 - Method for fostering bone formation and preservation
A method of inducing bone formation in a subject in need of such inducement comprises the steps of mechanically inducing an increase in osteoblast activity in the subject and elevating blood concentration of at least one bone anabolic agent in the subject. The method steps may be performed in any ...

05/04/06 - 20060094655 - Modified growth hormones
Provided are modified growth hormone polypeptides, nucleic acid molecules encoding modified growth hormone polypeptides and methods of generating modified growth hormone polypeptides. Also provided are methods of treatment using modified growth hormone polypeptides. ...

05/04/06 - 20060094654 - Neuroprotective complex for treatment of cerebral ischemia and injury
The invention provides a pharmaceutical composition useful in treating cerebral ischemia and cerebral injury. The pharmaceutical composition is also useful as a prophylactic treatment during surgical procedures wherein the potential for ischemic tissue damage is present. Also included in the invention is a method for preparing the pharmaceutical composition, as ...

05/04/06 - 20060094653 - Pancreatic polypeptide family motifs and polypeptides comprising the same
The present invention relates to novel Pancreatic Polypeptide Family (“PPF”) polypeptides. The PPF polypeptides of the invention generally include at least two PPF motif, have at least 50% sequence identity to PYY (3-36) over its length and will generally retain, at least in part, a biological activity of a PP, ...

05/04/06 - 20060094652 - Hybrid polypeptides with selectable properties
The present invention relates generally to novel, selectable hybrid polypeptides useful as agents for the treatment and prevention of metabolic diseases and disorders which can be alleviated by control plasma glucose levels, insulin levels, and/or insulin secretion, such as diabetes and diabetes-related conditions. Such conditions and disorders include, but are ...

05/04/06 - 20060094651 - Formulations and methods of production of fgf-20
The present invention provides improved formulations comprising FGF-20, its fragments, derivatives, variants, homologs, analogs, or a combination thereof, and improved methods for production. ...

05/04/06 - 20060094650 - Agent for improving life expectancy in therapy of malignant tumor
A medicament for improving prognostic survival in therapy of malignant tumor is provided that may improve prognostic survival in DIC patients where the basal disease is malignant tumor, especially malignant tumor in hematopoietic organs. The medicament according to the invention comprises as a main active ingredient Activated Protein C, which ...

05/04/06 - 20060094649 - Hla-a1,-a2,-a3,-a24,-b7, and-b44 tumor associated antigen peptides and compositions
A peptide or composition comprising at least one epitope or analog from CEA, HER2/neu, MAGE2, MAGE3, or p53. ...

05/04/06 - 20060094648 - Methods for treating or preventing ischemic injury
A therapeutic or prophylactic treatment method of myocardial ischemia, such as due to myocardial infarction, by administering erythropoietin, alone or in combination with other drugs, to a patient suffering from or at risk of cardiac injury, such as myocardial ischemia. The erythropoietin is administered in a concentration such that the ...

05/04/06 - 20060094647 - Treatment of inflammatory bowel disease using growth factors
The present invention is based upon methods of treating inflammatory conditions in the intestinal tract of mammals using growth factor related polypeptides. Methods of using fibroblast growth factor-CX (FGF-CX) polynucleotide sequences and the FGF-CX polypeptides encoded by such nucleic acid sequences, or variants, fragments and homologs thereof, are claimed in ...

04/27/06 - 20060089306 - New epilepsy mutations
An isolated nucleic acid molecule encoding a mutant alpha subunit of a mammalian voltage-gated sodium channel, wherein a mutation event selected from the group consisting of point mutations, deletions, insertions and rearrangements has occurred and said mutation event disrupts the functioning of an assembled sodium channel comprising this mutated subunit ...

04/27/06 - 20060089305 - Compositions and methods for activating toll-like receptor 4
Methods for activating Toll-like receptor 4 via cholesterol-dependent cytolysins isolated from a Gram-positive bacteria are provided. In addition compositions containing an isolated cholesterol-dependent cytolysin or a fragment thereof or a mimetic of the cytolysin or fragment thereof and methods for use of such composition in inhibiting binding and/or interaction of ...

04/27/06 - 20060089304 - Treatment of psoriasis through down-regulation of the egf-receptor with topically-applied egf
From unrelated but similar fields it is deduced that certain forms of psoriasis can be effectively treated through topical application of EGF-containing formulations. This patent application summarizes the theoretical basis for this finding and requests protection for the idea, while clinical evaluation is in preparation. ...

04/27/06 - 20060089303 - Cancer-testis antigens
Cancer-testis (CT) antigens have been identified by screening public databases for transcripts that are expressed in tumor tissues and a limited set of normal tissues, or by screening for genes that are expressed in cancer and testis tissues (but not other normal tissues). The invention relates to nucleic acids and ...

04/27/06 - 20060089302 - Hsp70-derived peptides and uses thereof in the diagnosis and treatment of autoimmune diseases
The invention relates to specific peptides derived from hsp70, and to pharmaceutical compositions comprising the same. The peptides and compositions of the invention are particularly suitable for the prevention or treatment of an autoimmune disease such as Type 1 Diabetes, Systemic Lupus Erithematosus, Multiple Sclerosis or Rheumatoid Arthritis. The invention ...

04/20/06 - 20060084605 - Stable pharmaceutical compositions
Pharmaceutical composition for parenteral administration comprising a glucagon-like peptide and human serum albumin or a variant thereof. ...

04/20/06 - 20060084604 - Transepithelial delivery of peptides with incretin hormone activities
Compositions and methods are disclosed for the treatment of diabetes and related diseases using peptides with incretin hormone activity. Preferably, the peptide with incretin hormone activity is GLP-1, exendin or an analog of GLP-1 or exendin. The peptides with incretin hormone activity are administered transepithelially using a transepithelial carrier peptide. ...

04/20/06 - 20060084603 - Igf-bp3-related methods for inhibiting tumor growth
The subject invention provides a method of inhibiting the proliferation of cells associated with a tumor in a subject which comprises administering to the subject between about 10 μg/kg and about 100 mg/kg of IGF-BP3, thereby inhibiting proliferation of the cells. The subject invention further provides a surgical method which ...

04/20/06 - 20060084602 - Platelet-derived growth factor compositions and methods of use thereof
A method for promoting growth of bone, periodontium, ligament, or cartilage in a mammal by applying to the bone, periodontium, ligament, or cartilage a composition comprising platelet-derived growth factor at a concentration in the range of about 0.1 mg/mL to about 1.0 mg/mL in a pharmaceutically acceptable liquid carrier and ...

04/20/06 - 20060084601 - Method for treating respiratory distress syndrome
The invention provides a method for treating infants, children or adults suffering from pulmonary distress caused by low or insufficient production of surfactant. It is particularly suitable for treating premature infants suffering from Respiratory Distress Syndrome. The method comprises administering a leptin compound to an individual with impaired surfactant production ...

04/20/06 - 20060084600 - Human homologues of fused gene
The invention relates to novel molecules, in particular nucleic acid sequences and the encoded polypeptides, which are the human homologues of the protein-serine/threonine kinase named Fused. ...

04/20/06 - 20060084599 - Compositions, methods and kits relating to notch signaling
The present invention relates to methods and compositions based on the modulation of Src-mediated cortactin phosphorylation. In particular, the invention features methods and compositions for modulating Src-mediated cortactin phosphorylation using Notch ligands to modulate Notch signaling. ...

04/20/06 - 20060084598 - Use of alpha-1 antitrypsin for the preparation of medicaments for the treatment of fibromyalgia
The invention is based on the use of alpha-1 antitrypsin for the preparation of medicaments for the treatment of fibromyalgia, comprising the preparation of therapeutic concentrates of alpha-1 antitrypsin, in any form of administration tolerated by humans, the alpha-1 antitrypsin being obtained by purification of human plasma or being produced ...

04/20/06 - 20060084597 - Use of compounds having gip activity for the treatment of disorders associated with abnormal loss of cells and/or for the treatment of obesity
Use of a compound having 50% activity or more of the activity of gastric inhibitory polypeptide, GIP, when tested in the same assay under the same conditions, and/or the use of GIP, analogues and fragments thereof, for the manufacture of a pharmaceutical composition for prophylaxis and/or treatment of conditions caused ...

04/13/06 - 20060079459 - Stabilized compositions comprising tissue factor pathway inhibitor protein or tissue factor pathway inhibitor variant proteins
Stabilized aqueous compositions of tissue factor pathway inhibitor (TFPI) or TFPI variants comprise a solubilizing agent, an antioxidant, and a buffer. The combination of a solubilizing agent and an antioxidant can lead to a significant improvement in the storage life of TFPI or TFPI variant compositions. The solubilizing agent and ...

04/13/06 - 20060079458 - Using heat shock proteins to improve the therapeutic benefit of a non-vaccine treatment modality
The present invention relates to methods of improving a treatment outcome comprising administering a heat shock protein (HSP) preparation or an α-2-macroglobulin (α2M) preparation with a non-vaccine treatment modality. In particular, an HSP preparation or an α2M preparation is administered in conjunction with a non-vaccine treatment modality for the treatment ...

04/13/06 - 20060079457 - Baff, inhibitors thereof and their use in the modulation of b-cell response
The invention provides methods for treating or preventing disorders associated with expression of BAFF comprising BAFF and fragments thereof, antibodies, agonists and antagonists. ...

04/13/06 - 20060079456 - Vasoactive intestinal polypeptide pharmaceuticals
Pharmaceutical compositions relating to vasoactive intestinal polypeptides and methods for the treatment of metabolic disorders, including diabetes, insulin resistance, metabolic acidosis and obesity are presented. Methods of using the vasoactive intestinal polypeptide compositions are also disclosed. ...

04/13/06 - 20060079455 - Peptide nanostructures encapsulating a foreign material and method of manufacturing same
A composition comprising a material at least partially enclosed by a tubular, spherical or planar nanostructure composed of a plurality of peptides, wherein each of the plurality of peptides includes no more than 4 amino acids and whereas at least one of the 4 amino acids is an aromatic amino ...

04/13/06 - 20060079454 - Peptide nanostructures and methods of generating and using the same
A tubular or spherical nanostructure composed of a plurality of peptides, wherein each of the plurality of peptides includes no more than 4 amino acids and whereas at least one of the 4 amino acids is an aromatic amino acid. ...

04/13/06 - 20060079453 - Hla binding peptides and their uses
Provided herein are peptides in certian pathogens and/or human or murine proteins that are identified as capable of binding one or more MHC molecules and inducing an immume response in a system. Also provided are compositions that include one or more of the peptides and methods for inducing an immune ...

04/13/06 - 20060079452 - Fuel reforming device
Substances that inhibit the action of the members of the IL-1β/NF-κB pathway can be used for protecting and preserving β-cell mass and function in prediabetic and diabetic type 2 patients. Specifically, the present invention relates to the use of an Interleukin 1 receptor antagonist (IL-1Ra) and/or pyrrolidinedithiocarbamate (PDTC) for the ...

04/06/06 - 20060074025 - Therapeutic formulations for transmucosal administration that increase glucagon-like peptide-1 bioavailability
What is described is a pharmaceutical formulation for intranasal delivery of glucagon-like protein-1 (GLP-1), comprising an aqueous mixture of GLP-1, a solubilizing agent, a chelator, and a surface active agent. ...

04/06/06 - 20060074024 - Treatment of congestive heart failure
A mammal with congestive heart failure is treated by administering to the mammal an effective amount of growth hormone. Treatment results in increased left ventricular cystolic pressure, increased left ventricular maximum, increased cardiac output, and increased stroke volume index. Treatment also results in reduced left ventricular end-diastolic pressure and reduced ...

04/06/06 - 20060074023 - Angiogenesis associated proteins, and nucleic acids encoding the same
An isolated polypeptide having at least 80% sequence identity to the sequence SEQ ID NOS:2, 4, 6, 8, 10, 12, 14 or 16, and polynucleotides encoding the same, are useful for modulating angiogenesis. ...

04/06/06 - 20060074022 - Prevention of primary sjogren's syndrome by ica69 deficiency
This invention relates to identification of an autoantigen implicated in the development and progression of Sjögren's Syndrome (pSS); particularly to the disease modifying effect of creating a deficiency in the ICA69 autoantigen; and most particularly to development of diagnostic and therapeutic avenues, means for the differential diagnosis of pSS versus ...

04/06/06 - 20060074021 - Novel antimicrobial agents
A novel class of antimicrobial polymeric agents which are designed to exert antimicrobial activity while being stable, non-toxic and avoiding development of resistance thereto and a process of preparing same are disclosed. Further disclosed are pharmaceutical compositions containing same and a method of treating medical conditions associated with pathological microorganisms, ...

04/06/06 - 20060074020 - Inhibition of angiogenesis by neutrophil alpha-defensins
The present invention relates to the inhibition of angiogenesis by neutrophil alpha-defensins. Further, the present invention relates to methods involving the inhibition of endothelial cell adhesion to the extracellular matrix, endothelial cell apoptosis, and endothelial cell angiogenesis.mediated by alpha-defensins. b) instructions for the use of said α-defensin for the purpose ...

04/06/06 - 20060074019 - Human growth hormone treatment methods
New methods for developing dosing formulas that allow the determination of appropriate dosage regimens for human growth hormone (hGH) compounds; methods for using such formulas to calculate individualized hGH compound dosage regimens; methods for treatment of hGH-responsive syndromes in patients using such determined regimens; systems, devices, and computer-readable media comprising ...

04/06/06 - 20060074018 - Methods of diagnosing & treating diabetes and insulin resistance
The present invention provides compositions and methods for diagnosing and treating diabetes and insulin resistance. In particular, the invention provides methods of identifying modulators of the polynucleotides or polypeptides of the invention and using those modulators to treat diabetes, as well as methods of diagnosing diabetes by measuring the levels ...

04/06/06 - 20060074017 - Active complex of alpha-lactalbumin (hamlet) and cofactor
The use of a biologically active complex of α-lactalbumin, selected from HAMLET (human α-lactalbumin made lethal to tumour cells) or a biologically active modification thereof, or a biologically active fragment of either of these, in the preparation of a medicament for use in the treatment of papilloma, such as cutaneous ...

04/06/06 - 20060074016 - Multifunctional context-activated protides and methods of use
This invention is directed to multifunctional, context-activated protides that have two or more effectors with individually distinct biological functions and one or more corresponding activator sites that can each initiate or amplify the biological function of one or more effectors upon context-activation. The context-activated protides of the invention are useful ...

03/30/06 - 20060069029 - Exendin analog formulations
Novel formulations containing exendins, exendin agonists and/or exendin analogs are provided. ...

03/30/06 - 20060069028 - Therapeutic agents and methods of use thereof for the modulation of angiogenesis
The present invention provides angiogenesis inhibitor compounds comprising a MetAP-2 inhibitory core coupled to a peptide, as well as pharmaceutical compositions comprising the angiogenesis inhibitor compounds and a pharmaceutically acceptable carrier. The present invention also provides methods of treating an angiogenic disease, e.g., cancer, in a subject by administering to ...

03/30/06 - 20060069027 - Inhibitors of hepatitis c virus
The present invention relates to methods that employ peptides or peptide derivatives to inhibit hepatitis C virus infection. The present invention is based in part on the discovery that E2 envelope glycoprotein of hepatitis C virus has previously undescribed domains that are important for interactions with cellular or viral proteins ...

03/30/06 - 20060069026 - Treatment of obesity
A method for the treatment of obesity in an animal such as a human, comprises administering to the animal an effective amount of a peptide which comprises the carboxyl-terminal sequence of a growth hormone, particularly the carboxyl-terminal sequence of human growth hormone containing amine acid residues 177-191. A pharmaceutical composition ...

03/30/06 - 20060069025 - Survivin, a protein that inhibits cellular apoptosis, and its modulation
The present invention provides the amino acid of a protein that inhibits cellular apoptosis, herein termed the Survivin protein and nucleic acid molecules that encode Survivin. Based on this disclosure, the present invention provides isolated Survivin protein, isolated Survivin encoding nucleic acid molecules, methods of isolating other members of the ...

03/30/06 - 20060069024 - Plant pr-5 proteins as mammalian therapeutic agents
Proteins of the PR-5 family having a lectin-like β barrel domain control apoptosis in yeast through receptor binding. Receptors that specifically bind to PR-5 proteins having a lectin-like β barrel domain have been found to be homologous to mammalian adiponectin receptors, and such PR-5 proteins can act as functional homologues ...

03/30/06 - 20060069023 - Animal model for studying hormone signalling and method of modulating the signalling
The present invention relates generally to a method for the treatment and/or prophylaxis of conditions arising from or otherwise associated with aberrations in hormone signalling. The present invention further provides an animal model useful for screening for agents capable of agonizing or antagonizing hormone signalling. More particularly, the present invention ...

03/30/06 - 20060069022 - D-isomers of antimicrobial peptide
This invention provides D-isomers of MUC7-12-mer peptide of human saliva MUC7. The isomers have antimicrobial activity comparable to that of the L-isomers and are resistant to proteolysis. These peptides can be used as antifungal and antimicrobial agents. ...

03/30/06 - 20060069021 - Compositions and methods for intranasal administration of inactive analogs of pth or inactivated preparations of pth or pth analogs
Pharmaceutical compositions and methods are described comprising at inactive forms or parathyroid hormone peptide (PTH) or PTH analogs wherein the inactive forms are activated upon administration into the systemic circulation. Also described is a method of preventing local reaction to a biologically active agent, preparing a formulation comprising said biologically ...

03/30/06 - 20060069020 - Kallikrein inhibitors and anti-thrombolytic agents and uses thereof
Methods, kits and compositions are described that include a non-naturally occurring kallikrein inhibitor and an anti-thrombolytic agent, e.g., an anti-fibrinolytic agent, for preventing or reducing blood loss and/or ischemia, e.g., ischemia associated with perioperative blood loss and cerebral ischemia, the onset of systemic inflammatory response, and/or reperfusion injury, e.g., reperfusion ...

03/30/06 - 20060069019 - Crystal structure of the complex of hepatocyte growth factor beta chain with met receptor and methods of use
The disclosure provides a crystal structure of a complex of the HGF β-chain with am extracellular fragment of the Met receptor, as well as use of the crystal structure in the design, identification, and selection of ligands that modulate the Met Receptor and the interaction of HGF with the Met ...

03/30/06 - 20060069018 - Endogenous repair factor production promoters
It relates to an endogenous repair factor production accelerator which comprises one or at least two selected from prostaglandin (PG) I2 agonist, EP2 agonist and EP4 agonist. Since prostaglandin (PG) I2 agonist, EP2 agonist or EP4 agonist has various endogenous repair factor production accelerating action, angiogenesis acceleration action and stem ...

03/23/06 - 20060063716 - Intermedin and its uses
Intermedin nucleic acid compositions and their encoded polypeptides and variants thereof are provided. Intermedin is a novel ligand for the calcitonin receptor-like receptor. In addition to its use as a therapeutic agent, intermedin sequences are utilized in screening and research methods for the determination of specific analogs, agonists, antagonists and ...

03/23/06 - 20060063715 - Multivalent antigen-binding proteins
Compositions of, genetic constructions coding for, and methods for producing multivalent antigen-binding proteins are described and claimed. The methods include purification of compositions containing both monomeric and multivalent forms of single polypeptide chain molecules, and production of multivalent proteins from purified monomers. Production of multivalent proteins may occur by a ...

03/23/06 - 20060063714 - Liquid, aqueous, pharmaceutical compositions of factor vii polypeptides
The invention relates to a liquid, aqueous pharmaceutical composition comprising a Factor VII polypeptide (e.g. human Factor VIIa) and a buffering agent; wherein the molar ratio of non-complexed calcium ions (Ca2+) to the Factor VII polypeptide is lower than 0.5. The composition may further comprise a stabilizing agent (e.g. copper ...

03/23/06 - 20060063713 - Methods for restoring immune balance for the treatment of t-cell mediated diseases
The invention provides a method of treating a T cell mediated disease. The method includes administering an effective amount of hCG to an asymptomatic subject over a period of time sufficient to restore persistent immune balance between regulatory and effector T cells, wherein restoring the persistent immune balance results in ...

03/23/06 - 20060063712 - Pharmaceutical composition for inhibiting influenza virus infection and reproduction
The present invention relates to a pharmaceutical composition for inhibiting influenza virus infection and reproduction, comprising a effective amount of C-phycocyanin (C-PC), allophycocyanin (APC), spirulina growth factor (SGF) or the mixture thereof. The present invention also provides a method for extracting said pharmaceutical composition, comprising the steps of: (a) adding ...

03/23/06 - 20060063711 - Use of sglt homolog
The present invention provides an agent that inhibits or promotes glucose uptake in the small intestine, etc., comprising a compound that inhibits or promotes the activity of Na+/glucose transporter (SGLT) homologs. ...

03/23/06 - 20060063710 - Flj20647s as modifiers of the p21 pathway and methods of use
Human FLJ20647 genes are identified as modulators of the p21 pathway, and thus are therapeutic targets for disorders associated with defective p21 function. Methods for identifying modulators of p21, comprising screening for agents that modulate the activity of FLJ20647 are provided. ...

03/23/06 - 20060063709 - Nuclear factors associated with transcriptional regulation
Constitutive and tissue-specific protein factors which bind to transcriptional regulatory elements of Ig genes (promoter and enhancer) are described. The factors were identified and isolated by an improved assay for protein-DNA binding. Genes encoding factors which positively regulate transcription can be isolated and employed to enhance transcription of Ig genes. ...

03/16/06 - 20060058239 - Use of the insulin-like-growth factor i isoform mgf for the treatment of neurological disorders
The invention relates to the treatment of neurological disorders with the Insulin-like Growth Factor I (IGF-I) isoform known as mechano growth factor (MGF). ...

03/16/06 - 20060058238 - Fetal skin cell protein compositions for the treatment of skin conditions, disorders or diseases and methods of making and using the same
The present invention provides methods and compositions designed for treating a subject suffering from skin conditions, disorders or diseases. The compositions include fetal skin cell proteins obtained from fetal skin cells after induced cell lysis. ...

03/16/06 - 20060058237 - P49/strap is a novel protein involved in gene regulation and cell proliferation
The invention provides isolated p49/STRAP protein, and isolated nucleic acids encoding a p49/STRAP protein. The inventors have discovered a new protein, named p49/STRAP that is expressed in cardiac tissue and other tissues in mammals. The p49/STRAP protein binds to serum response factor (SRF) and regulates transcription of SRF-responsive genes in ...

03/16/06 - 20060058236 - Endogenously-formed conjugate of albumin
A conjugate formed in vivo and comprised of endogenous albumin and an amine-containing compound, such as a protein or a drug, is described. The conjugate is formed by in vivo cleavage of a polymer-dithiobenzyl-therapeutic agent conjugate to form an albumin-dithiobenzyl-therapeutic agent conjugate. The dithiol moiety of the albumin-therapeutic agent conjugate ...

03/16/06 - 20060058235 - Long lasting synthetic glucagon like peptide (glp-1)
Modified insulinotropic peptides are disclosed. The modified insulinotropic peptides are capable of forming a peptidase stabilized insulinotropic peptide. The modified insulinotropic peptides are capable of forming covalent bonds with one or more blood components to form a conjugate. The conjugates may be formed in vivo or ex vivo. The modified ...

03/16/06 - 20060058234 - Vegf traps and therapeutic uses thereof
Nucleic acid molecules and multimeric proteins capable of binding vascular endothelial growth factor (VEGF). VEGF traps are disclosed which are therapeutically useful for treating VEGF-associated conditions and diseases, and are specifically designed for local administration to specific organs, tissues, and/or cells. ...

03/16/06 - 20060058233 - Prevention and treatment of synucleinopathic and amyloidogenic disease
The invention provides improved agents and methods for treatment of diseases associated with synucleinopathic diseases, including Lewy bodies of alpha-synuclein in the brain of a patient. Such methods entail administering agents that induce a beneficial immunogenic response against the Lewy body. The methods are particularly useful for prophylactic and therapeutic ...

03/16/06 - 20060058232 - Methods of treating cancer using a modified endostatin protein
The present invention provides methods of treating an angiogenesis-related disease of a subject using a therapeutically effective amount of a modified endostatin protein. In particular, the methods encompass treating an angiogenesis-related disease of a subject using a combination of the modified endostatin, and a known cancer therapy agent such as ...

03/16/06 - 20060058231 - Bmp-7 variants with improved properties
The invention relates to variants of BMP-7 with improved properties and methods for their use. ...

03/16/06 - 20060058230 - Analogs of parathyroid hormone and pth-related protein as bone anabolic agents
The invention provides novel parathyroid hormone analogs and parathyroid hormones-related protein analogs. The invention also provides methods of using these analogs to treat osteoporosis, promote the formation of bone, and inhibit bone loss. ...

03/16/06 - 20060058229 - Peptides and methods for cell death regulation
The present invention provides novel peptides, nucleic acids, compounds, compositions and methods for regulating apoptosis, and screening methods for identifying same. Regulation of apoptosis is mediated via IAPi-derived proteins, peptide fragments thereof, and nucleic acids encoding same, stimulating/accelerating or downmodulating/suppressing apoptosis. For stimulation/acceleration of apoptosis, the IAPi-derived proteins or peptide ...

03/16/06 - 20060058228 - Colon tumor specific binding peptides
Phage display was used to screen peptide libraries that distinguish between well-differentiated (HCT116) and poorly-differentiated colon carcinoma cells (HT29). The screening protocol used selection and subtraction on intact, viable cells, resulting in phage libraries exhibiting high binding selectivity for the poorly-differentiated HT29 cells. A nine amino acid, disulfide-constrained peptide (RPM) ...

03/16/06 - 20060058227 - Hedgehog-related prophylaxis, therapy and diagnosis of gi tract carcinogenesis
The present invention is based on the key roles played by Hedgehog proteins in the regulation of homeostasis of the adult intestinal epithelium. Ihh is expressed in the adult mammalian colon and provides a lineage-instructive signal and regulates colonic epithelial morphogenesis in a compartmental fashion. Loss of Ihh expression precedes ...

03/16/06 - 20060058226 - Gd3-mimetic peptides
GD3-Mimetic peptides which contain an amino acid sequence represented by any of SEQ ID NOS: 1 to 4 or an amino acid sequence derived therefrom by substitution, deletion, addition, or insertion of one or more amino acid residues and attaining specific binding to an anti-GD3 antibody; and medicinal compositions containing ...

03/09/06 - 20060052306 - Gras composition for enhanced mucosal delivery of parathyroid hormone
What is described is an aqueous pharmaceutical composition for intranasal delivery of PTH, comprising a PTH molecule, and one or more excipients selected from the group consisting of a chelating agent, an alcohol, and a surface active agent, wherein the PTH molecule selected from the group consisting of SEQ NO: ...

03/09/06 - 20060052305 - Method of treating osteoporosis using intranasal parathyroid hormone
What is described is a method for treating osteoporosis in a mammal comprising administering intranasally a therapeutically effective amount of a PTH formulation to the mammal wherein the PTH formulation is an aqueous formulation comprised of a PTH peptide and one or more excipients selected from the group consisting of ...

03/09/06 - 20060052304 - Method for remodeling bone and related sutures
The invention relates to the discovery that relaxin receptors exist in bone and related sutures. As such, bone can be remodeled, repaired, removed or grown. Particularly, the invention pertains to a method for modifying a target bone by administering a relaxin compound which binds to relaxin receptors and by monitoring ...

03/09/06 - 20060052303 - Use of thyrotropin for regeneration of bone
The invention provides methods for treating or preventing bone degenerative disorders. The disorders treated or prevented include, for example, osteopenia, osteomalacia, osteoporosis, osteomyeloma, osteodystrophy, Paget's disease, osteogenesis imprerfecta, and bone degenerative disorders associated with chronic renal disease, hyperparathyroidism, high levels of endogenous thyrotropin, and long-term use of corticosteroids. The disclosed ...

03/09/06 - 20060052302 - Polymer factor ix moiety conjugates
Conjugates of a Factor IX moiety and one or more water-soluble polymers are provided. Typically, the water-soluble polymer is poly(ethylene glycol) or a derivative thereof. Also provided (among other things) are compositions comprising the conjugates, methods of making the conjugates, and methods of administering to a patient compositions comprising the ...

03/09/06 - 20060052301 - Splice variants of peptide yy, neuropeptide y, pancreatic peptide y and amylin, and uses thereof
The present invention relates to alternative splice variants of Amylin and members of the Pancreatic Polypeptide family, namely PYY, NPY, and PPY, vectors and compositions that include the same, and methods of use thereof. This invention provides peptides, nucleic acid sequences which encode same, analogs and derivatives thereof, antibodies which ...

03/09/06 - 20060052300 - Human kunitz-type inhibitor with enhanced antifibrinolytic activity
A human Kunitz-type inhibitor polypeptide with enhanced antifibrinolytic activity, methods of making, and methods of use. The novel polypeptide is structurally similar to the KD1 domain of human tissue factor pathway inhibitor-2 (TFPI-2). ...

03/09/06 - 20060052299 - Mntf peptides and compositions and methods of use
The present invention is directed to novel peptides and compositions capable of modulating viability and growth in neuronal cells, and to methods of modulating neuronal cell viability and growth employing the novel peptides and compositions of the invention. In one aspect, the invention is directed to novel peptide analogues of ...

03/09/06 - 20060052298 - Use of stable glutamine derivatives to improve drug absorption
The present invention relates to compositions and their use to enhance the uptake of pharmaceutical agents administered to mammalian species, including humans. More particularly, the present invention is directed to the administration of glutamine and stabilized glutamine derivatives to enhance the uptake of orally administered therapeutic agents. ...

03/09/06 - 20060052297 - Method of up-regulating tumor antigen expression using thymalfasin
The present invention provides a method for up-regulating tumor cell antigen expression, comprising administering to the cells an amount of thymalfasin sufficient to increase the expression of TLP relative to that of untreated tumor cells. Also provided are methods for enhancing the sensitivity of a immunodiagnostic or immunotherapeutic method, comprising ...

03/09/06 - 20060052296 - Method of cell growth inhibition with agnoprotein
The growth of normal and abnormally proliferating cells can be inhibited by the introduction of agnoprotein, or biologically active fragments or derivatives of agnoprotein, into the cell in the absence of any other polyoma virus protein or viral replication. ...

03/09/06 - 20060052295 - Intrathecal and intratumoral superantigens to treat malignant disease
The presence of tumor nodules in organs often results in serious clinical manifestations and the permeation by cancer cells of sheaths surrounding organs often produces clinical manifestations of pleural effusion, ascites or cerebral edema. The present invention addresses this problem by providing a method for treating tumors comprising (a) intratumoral ...

03/09/06 - 20060052294 - Muteins of the c5a anaphylatoxin, nucleic acid molecules encoding such muteins, and pharmaceutical uses of muteins of the c5a anaphylatoxin
The present invention refers to muteins of the C5a anaphylatoxin (C5a) which are C5a receptor antagonists, to nucleic acid molecules comprising a nucleotide sequence encoding such muteins of C5a anaphylatoxin, to host cells containing a nucleic acid molecule comprising a nucleotide sequence encoding such muteins of the C5a anaphylatoxin as ...

03/09/06 - 20060052293 - Complex of a human foxc2 protein and a foxc2-interacting protein
The present invention relates to complexes of the FOXC2 protein with other proteins, in particular complexes of FOXC2 with proteins designated p621, NOLP, HSC71, FTP3, CLH1, and Kinase A Anchor Protein 84/149 (AKAP). The protein complexes can be used in methods of identifying agents useful for the treatment of medical ...

03/09/06 - 20060052292 - Adiponectin fragments and conjugates
The invention relates to a conjugate comprising an adiponectin polypeptide, and a first non-polypeptide moiety covalently attached to the adiponectin polypeptide, wherein the adiponectin polypeptide comprises an amino acid residue having an attachment group for said first non-polypeptide moiety, wherein said amino acid residue has been introduced in a position ...

03/09/06 - 20060052291 - Chemically-modified progenipoietin conjugates
The present invention provides a chemically modified Progenipoietins (ProGPs) prepared by binding a water soluble polymer to the protein. The chemically-modified protein according to the present invention may have a much longer lasting neutrophil-increasing activity than that of the un-modified ProGP, enabling reduced dose and scheduling opportunities. ...

03/02/06 - 20060046964 - Pharmaceutical formulations and methods
Stable sodium ferric carbohydrate complex intravenous formulations that are essentially free of sucrose or another disaccharide, methods of making such formulations, and methods for treating anemic conditions in a mammal by administering such compositions. ...

03/02/06 - 20060046963 - Compound for inhibiting the influx of polymorphonuclear leukocytes (pmns) in a tissue, its selection, pharmaceutical compositions and use
The invention relates to a compound suitable for inhibiting the influx of polymorphonuclear leukocytes (PMNs) into a tissue involved in a chronic inflammatory disease. The compound according to the invention is capable of forming a complex with N-acetyl-Pro-Gly-Pro. The invention also relates to a method of selecting such a compound, ...

03/02/06 - 20060046962 - Absorption enhancers for drug administration
A composition including a surfactant and at least one alkyl glycoside and/or saccharide alkyl ester and a drug. The surfactant composition(s) when admixed with a drug is non-toxic and non-irritating, while stabilizing and increasing the bioavailability of the drug. The invention also provides compositions that enhance absorption of drugs via ...

03/02/06 - 20060046961 - Controlled and directed local delivery of anti-inflammatory compositions
The invention provides a method for alleviating pain associated with neuromuscular or skeletal injury or inflammation by controlled and directed delivery of one or more biological response modifiers to inhibit the inflammatory response which ultimately causes acute or chronic pain. Controlled and directed delivery can be provided by implantable or ...

03/02/06 - 20060046960 - Controlled and directed local delivery of anti-inflammatory compositions
The invention provides a method for alleviating pain associated with neuromuscular or skeletal injury or inflammation by controlled and directed delivery of one or more biological response modifiers to inhibit the inflammatory response which ultimately causes acute or chronic pain. Controlled and directed delivery can be provided by implantable or ...

03/02/06 - 20060046959 - Novel leptin antagonist
The present invention relates to an antagonist or inhibitor of leptin signaling via the leptin receptor. The leptin antagonist binds to the leptin receptor, but is unable to induce JAK-STAT signal transduction via the leptin receptor. By binding to the leptin receptor, the leptin antagonist impairs binding of leptin to ...

03/02/06 - 20060046958 - Compositions and methods comprising prostaglandin related compounds and trefoil factor family peptides for the treatment of glaucoma with reduced hyperemia
Compositions, methods, and pharmaceutical products related to prostaglandin-related compounds and trefoil factor family peptides are disclosed herein. Of particular interest are compositions and methods useful for the treatment of glaucoma with a reduced occurrence of hyperemia. ...

02/23/06 - 20060040865 - Platelet production promoting agent
The invention relates to a polypeptide wherein at least one of the amino, carboxyl, mercapto or guanidino group in a polypeptide molecule having human granulocyte colony stimulating factor activity is chemically modified by a chemical modifying agent, and a platelet production promoter comprising said polypeptide, a method for treating a ...

02/23/06 - 20060040864 - Apparatus and method for transdermal delivery of vascular endothelial growth factors
An apparatus and method for transdermally delivering a biologically active agent comprising a delivery system having a microprojection member (or assembly) that includes a plurality of microprojections (or array thereof) that are adapted to pierce through the stratum corneum into the underlying epidermis layer, or epidermis and dermis layers. In ...

02/23/06 - 20060040863 - Methods for treatment of diabetes using peptide analogues of insulin
The present invention is directed toward peptide analogues of insulin B chain that are generally derived from peptides comprising residues 9 to 23 of the native B chain sequence. The analogues are altered from the native sequence at position 12, 13, 15 and/or 16, and may be additionally be altered ...

02/23/06 - 20060040862 - Xaf genes and polypeptides: methods and reagents for modulating apoptosis
The invention provides novel XAF nucleic acid sequences. Also provided are XAF polypeptides, anti-XAF antibodies, and methods for modulating apoptosis and detecting compounds which modulate apoptosis. ...

02/23/06 - 20060040861 - Method of treating, preventing, and diagnosing prostate cancer
A method of treating prostate cancer in a prostate cancer patient is disclosed. In one embodiment of the present invention, the method comprises the step of decreasing or blocking the patient's leptin interaction with leptin receptor or increasing adiponectin interaction with adiponectin receptors. ...

02/23/06 - 20060040860 - Intra-tracheal application of vascular endothelial growth factor (vegf) for the prevention of lung damages caused by hperoxia
The invention relates to the field of pulmonary diseases that are related to oxygen provision that is higher than physiological (hyperoxia) and to the use of vascular endothelial growth factor (VEGF) for treatment and prevention. Hyperoxic exposure causes a direct cellular damage in the lung and disturbs lung development. The ...

02/23/06 - 20060040859 - Peptides, dnas, rnas, and compounds for inhibiting or inducing adrenomedullin activity, and use of the same
Pharmaceutical compositions containing adrenomedullin antagonist peptides, DNA, RNA compounds inhibitory on adrenomedullin activity, resulting in the efficient blockade of the induction of macroangiogenesis or vasculogenesis of more than 8 μm (in case of murine models), suppress the proliferation of cancer cells due to that inhibitory effect and suppress the protective ...

02/16/06 - 20060035836 - Treatment of acute coronary syndrome with an exendin
The invention relates to methods for treating a patient suffering from acute coronary syndrome, but who is not suffering from a Q-wave myocardial infarction, comprising administration of a therapeutically effective amount of a GLP-1 molecule. The GLP-1 can be self-administered, and can be administered in one or more doses, as ...

02/16/06 - 20060035835 - Novel protein, production and use thereof
The present invention relates to a novel SSD (sterol-sensing domain)-containing protein derived from human liver, human testis and human brain, or a salt thereof, and a DNA encoding the same. Studies on the tissue-specificity of the protein expression, the expression change depending the intracellular cholesterol level, production of the transformant, ...

02/16/06 - 20060035834 - Compositions and methods for diagnosing and treating an inflammation
A method of reducing an inflammatory response in a subject is provided. The method comprising providing to a subject in need thereof a therapeutically effective amount of an agent capable of reducing activity and/or expression of a scavenger receptor or of an effector thereof, thereby reducing the inflammatory response in ...

02/16/06 - 20060035833 - Anti-angiogenic compositions and methods of use
The present invention provides compositions comprising an anti-angiogenic factor, and a polymeric carrier. Representative examples of anti-angiogenic factors include Anti-Invasive Factor, Retinoic acids and derivatives thereof, and taxol. Also provided are methods for embolizing blood vessels, and eliminating biliary, urethral, esophageal, and tracheal/bronchial obstructions. ...

02/16/06 - 20060035832 - Anti-angiogenic compositions and methods of use
The present invention provides compositions comprising an anti-angiogenic factor, and a polymeric carrier. Representative examples of anti-angiogenic factors include Anti-Invasive Factor, Retinoic acids and derivatives thereof, and taxol. Also provided are methods for embolizing blood vessels, and eliminating biliary, urethral, esophageal, and tracheal/bronchial obstructions. ...

02/16/06 - 20060035831 - Anti-angiogenic compositions and methods of use
The present invention provides compositions comprising an anti-angiogenic factor, and a polymeric carrier. Representative examples of anti-angiogenic factors include Anti-Invasive Factor, Retinoic acids and derivatives thereof, and taxol. Also provided are methods for embolizing blood vessels, and eliminating biliary, urethral, esophageal, and tracheal/bronchial obstructions. ...

02/16/06 - 20060035830 - Anti-angiogenic compositions and methods of use
The present invention provides compositions comprising an anti-angiogenic factor, and a polymeric carrier. Representative examples of anti-angiogenic factors include Anti-Invasive Factor, Retinoic acids and derivatives thereof, and taxol. Also provided are methods for embolizing blood vessels, and eliminating biliamy, urethral, esophageal, and tracheal/bronchial obstructions. ...

02/16/06 - 20060035829 - Chemokine combinations to mobilize progenitor/stem cells
Methods to elevate progenitor and stem cell counts in animal subjects using compounds which bind to the chemokine receptor CXCR4 in combination with the CXCR2 chemokine GROβ, including its modified forms, are disclosed. ...

02/16/06 - 20060035828 - Direct activation of atiii in whole blood and plasma and uses thereof
Methods of activating ATIII in situ in a blood product are disclosed, as is the use of such methods and blood products in treating infectious diseases, inflammatory disorders and diseases or conditions that are mediated by thrombin activation. ...

02/16/06 - 20060035827 - Compositions and methods for the treatment or prevention of gallbladder disease
Compositions and methods for the treatment or prevention of gallbladder disease are provided. In particular, pharmaceutical compositions containing an amount of serine proteinase inhibitor such as potato proteinase inhibitor II effective to induce gallbladder contraction in a host are provided. The compositions can be administered to individuals having a body ...

02/16/06 - 20060035826 - Promotion of axonal regeneration
The present invention concerns a method of promoting axonal regeneration. In particular, the invention concerns a method of promoting the growth or regeneration of neurons, and treating disease or conditions associated with the loss, loss of function or dysfunction of nerve cells, in particular thalamic nerve cells, by administering a ...

02/16/06 - 20060035825 - Alpha 5 beta 1 and its ability to regulate the cell survival pathway
The present invention provides for identification of agents that induce growth arrest and survival of cancer cells, which remain dormant in bone marrow, thus preventing their eradication through use of standard chemotherapy or radiation therapy. Basic fibroblast growth factor (FGF-2), a mammary differentiation factor abundant in the bone marrow stroma, ...

02/16/06 - 20060035824 - Use of acrp30 globular head to promote increases in muscle mass and muscle differentiation
The present invention relates to the field of muscle research, in particular to the discovery of a compound effective for increasing muscle mass, muscle cell differentiation, and oxidation of free fatty acids in muscle, useful in methods of treating muscle-related diseases and disorders as well as for augmenting muscle mass ...

02/16/06 - 20060035823 - Isolated fragments of p62 nucleoporin and uses thereof
The invention is directed to isolated protein fragments of p62 nucleoporin including deletion isoforms and nucleic acid sequences encoding these deletion isoforms. The isolated deletion isoforms disclosed herein include the sequences: SEQ. ID NO.:1 MSGFNFGGTG APTGGFTFGT AKTATTTPAT GFSFSTSGTG GFNFGAPFQP ATSTPSTGLF SLATQTPATQ TTGFTFGTAT LASGGTGFSL GIGASKLNLS NTAATPAMAN PSGFGLGSSN LTNAISSTVT SSQGTAPTGF VFGPSTTSVA PATTSGGFSF ...

02/09/06 - 20060030531 - Pharmaceutical composition comprising factor vii polypeptide and pai-1 polypeptide
The present invention relates to a composition comprising factor VII or a factor VII-related polypeptide, and PAI-1 or a PAI-1-related polypeptide, and the use thereof for treating bleeding episodes. ...

02/09/06 - 20060030530 - Methods of screening for compounds that modulate the lsr-leptin interaction and their use in the prevention and treatment of obesity-related diseases
The present invention is drawn to methods of screening for new compounds for the treatment of obesity and obesity-related diseases and disorders, as well as methods of treating obesity-related diseases and disorders, based on the discovery of the role of the leptin-LSR interaction in obesity. ...

02/09/06 - 20060030529 - Use of vegf inhibitors for treatment of eye disorders
Modified chimeric polypeptides with improved pharmacokinetics and improved tissue penetration are disclosed useful for treating eye disorders, including age-related macular degeneration and diabetic retinopathy. ...

02/09/06 - 20060030528 - Compositions and methods for treating peripheral vascular disease
The present invention relates to methods of treating intermittent claudication comprising administering glucagon-like peptide-1 (GLP-1) molecules to subjects suffering therefrom. ...

02/09/06 - 20060030527 - Rage fusion proteins and methods of use
Disclosed are RAGE fusion proteins comprising RAGE polypeptide sequences linked to a second, non-RAGE polypeptide. The RAGE fusion protein may utilize a RAGE polypeptide domain comprising a RAGE ligand binding site and an interdomain linker directly linked to an immunoglobulin CH2 domain. Such fusion proteins may provide specific, high affinity ...

02/09/06 - 20060030526 - Stable suspension formulations of erythropoietin receptor agonists
A suspension formulation for therapeutic use includes a non-aqueous, single-phase vehicle exhibiting viscous fluid characteristics and a particle formulation comprising an erythropoietin receptor agonist dispersed in the vehicle. ...

02/09/06 - 20060030525 - Apolipoprotein a-i derivatives with altered immunogenicity
The present invention relates to novel apolipoprotein A-I proteins with altered immunogenicity. ...

02/09/06 - 20060030524 - Treatment of systemic lupus erythematosus by down-regulating the autoimmune response to autoantigens
Systemic lupus erythematosus (SLE) can be prevented or treated by down-regulating the autoimmune response to the C-terminal-DNA-binding domain of the p53 protein (p53) by an active principle selected from the group consisting of: (i) a peptide of, or comprising, the C-terminal DNA-binding domain of the p53 protein; (ii) a monoclonal ...

02/09/06 - 20060030523 - Sclerostin and the inhibition of wnt signaling and bone formation
The loss of the SOST gene product sclerostin leads to sclerosteosis characterized by high bone mass (HBM). In this report, we found that sclerostin could antagonize canonical Wnt signaling in human embryonic kidney A293 cells and mouse osteoblastic MC3T3 cells. This sclerostin-mediated antagonism could be reversed by over-expression of Wnt ...

02/09/06 - 20060030522 - Alk7 and myostatin inhibitors and uses thereof
The invention relates to ALK7 soluble receptors and their uses as antagonists of the function of certain ligands such as GDF-8 (Myostatin) and GDF-11. The ALK7 soluble receptor of the invention is useful as antagonists of GDF-8 and GDF-11 in the treatment of neuronal diseases or conditions such as stroke, ...

02/02/06 - 20060025343 - Angiogenically effective unit dose fo fgf and method of adminstering
The present invention has multiple aspects. In particular, in one aspect, the present invention is directed to a unit dose comprising 0.2 μg/kg to 36 μg/kg of a recombinant FGF or an angiogenically active fragment or mutein thereof. In another aspect, the present invention is directed to a pharmaceutical composition ...

02/02/06 - 20060025342 - Treatment of bone disorders with skeletal anabolic drugs
Disclosed herein are methods for the prevention and treatment of a variety of mammalian conditions manifested by loss of bone mass, including osteoporosis. The present invention provides methods of using PTHrP, or analogs thereof, for the treatment of metabolic bone disorders that are both effective and have an increased safety. ...

02/02/06 - 20060025341 - Follistatin-3
The present invention relates to a novel follistatin-3 protein which is a member of the family of inhibin-related proteins. In particular, isolated nucleic acid molecules are provided encoding the human follistatin-3 protein. Follistatin-3 polypeptides are also provided as are vectors, host cells and recombinant methods for producing the same. The ...

02/02/06 - 20060025340 - Cerberus/coco derivatives and uses thereof
The invention relates to Cerberus/Dan/Gremlin polypeptides or variants thereof for use in treating a variety of disorders associated with myostatin, nodal and GDF-11. Preferred polypeptides are Coco or Cerberus derivatives. ...

02/02/06 - 20060025339 - Corticotropin releasing factor 2 receptor agonists
Isolated corticotropin releasing factor derivatives, and nucleic acids encoding the same, are effective for treating corticotropin releasing factor 2 receptor modulated disorders such as muscular dystrophy. ...

02/02/06 - 20060025338 - Compositions and methods for treatment of lymphatic and venous vessel arterialization
The present invention is directed to methods and compositions that may be used in disrupting the association of smooth muscle cells with lymphatic endothelial cells and in correcting the valvular dysfunction in veins and lymphatic vessels. Such compositions are useful for therapeutic and prophylactic treatment of impaired lymphatic and venous ...

02/02/06 - 20060025337 - Sirtuin related therapeutics and diagnostics for neurodegenerative diseases
Provided herein are methods and compositions for modulating the activity of sirtuin deacetylase protein family members; p53 activity; apoptosis; lifespan and sensitivity to stress of cells and organisms. Exemplary methods comprise contacting a cell with an activating compound, such as a flavone, stilbene, flavanone, isoflavone, catechin, chalcone, tannin or anthocyanidin; ...

02/02/06 - 20060025336 - Pharmaceutical compositions comprising combinations of factor vii polypeptides and aprotinin polypeptides
Compositions comprising factor VII or a factor VII-related polypeptide and aprotinin or an aprotinin-related polypeptide and uses thereof are provided. ...

02/02/06 - 20060025335 - Netrin compositions and methods of using the same
The present invention provides methods and compositions to modulate inflammation and inflammatory responses using Netrin polypeptides and Netrin receptors. Methods of the present invention comprise the use of Netrin polypeptides and Netrin receptors to decrease migration of inflammatory cells of the immune system to a site of injury or infection. ...

02/02/06 - 20060025334 - Vanilloid receptor-2 ligands for treating anxiety or depression
The present invention relates to the use of a compound selected from: (a) a VR2 polypeptide; (b) a compound which modulates the activity of a VR2 polypeptide; (c) a polynucleotide encoding a VR2 polypeptide; or (d) an antisense polynucleotide to a polynucleotide encoding a VR2 polypeptide, for the manufacture of ...

01/26/06 - 20060019899 - Epha2 t-cell epitopes and uses therefor
EphA2 T-cell epitope are provided herein. The epitopes include peptides corresponding to specific fragments of human EphA2 protein containing one or more T-cell epitopes, and conservative derivatives thereof. The EphA2 T-cell epitopes are useful in an assay, such as an ELISPOT assay, that may be used to determine and/or quantify ...

01/26/06 - 20060019898 - Methods of treating intestinal ischemia using heparin-binding epidermal growth factor
The present invention provides methods of treating pathologic conditions associated with intestinal ischemia. In the methods, patients at risk for or suffering from intestinal ischemia are treated with a heparin-binding epidermal growth factor product. ...

01/26/06 - 20060019897 - Anti-angiogenic polypeptides
The invention relates to anti-angiogenic effects of polypeptides derived from fibrinogen. ...

01/26/06 - 20060019896 - Netrin-related compositions and uses
The present invention provides methods and compositions for modulating proliferation, differentiation, migration, and adhesion of cardiovascular cell types. ...

01/26/06 - 20060019895 - Molecular determinants of myeloma bone disease and uses thereof
To identify molecular determinants of lytic bone disease in multiple myeloma, the expression profiles of ˜12,000 genes in CD138-enriched plasma cells from newly diagnosed multiple myeloma patients exhibiting no radiological evidence of lytic lesions (n=28) were compared to those with ≧3 lytic lesions (n=47). Two secreted WNT signaling antagonists, soluble ...

01/26/06 - 20060019894 - Use of factor viia or factor viia equivalents for preventing or attenuating haemorrhage growth, and/or oedema generation following intracerebral haemorrhage
The invention relates to the use of Factor VIIa or a Factor VIIa equivalent for the manufacture of a medicament for preventing complications in ICH patients. ...

01/26/06 - 20060019893 - Factor viia variants
Novel compounds are provided which modulate a FVIIa mediated or associated process or event such as the catalytic conversion of FX to FXa, FVII to FVIIa or FIX to FIXa. In particular aspects, the compounds of the invention are variants of Factor VIIa (FVIIa). Pharmaceutical compositions are also provided which ...

01/26/06 - 20060019892 - Conopeptides and methods of use
Isolation, synthesis and therapeutic use of compounds and related compositions based on a new class of conopeptides comprising the modified amino acid γ-hydroxyvaline (Hyv=V*). These isolated peptides are the first known example of a naturally occurring polypeptide chain containing Hyv. The active peptides, termed γ-Hydroxyconophans are heavily hydroxylated small peptides. ...

01/26/06 - 20060019891 - Protection of cardiac myocardium
The invention provides compositions and methods for protecting vascular tissues from injury that occurs, for example, during occlusion of one or more arteries. In some embodiments, the injury is myocardial infarction. The compositions of the invention include combinations of platelet derived growth factor, vascular endothelial growth factor, and angiopoietin-2. ...

01/26/06 - 20060019890 - Method for treating cardiac remodeling following myocardial injury
The invention concerns methods for treating cardiac remodeling in a subject who has undergone myocardial injury, said method comprising the administration of natriuretic peptide to said subject. Preferably the natriuretic peptide is brain natriuretic peptide. The invention also concerns methods for treating structural heart disorders arising from myocardial injury, said ...

01/26/06 - 20060019889 - Anti-osteolytic therapy involving adiponectin
Administering an effective amount of adiponectin into an osteolytic region. ...

01/26/06 - 20060019888 - Neuregulin based methods and compositions for treating cardiovascular diseases
The present invention relates to compositions and methods for preventing, treating or delaying various cardiovascular diseases or disorders in mammals, particularly in humans. More particularly, the present invention provides for compositions and methods for preventing, treating or delaying various cardiovascular diseases or disorders using, inter alia, a neuregulin protein, or ...

01/26/06 - 20060019887 - Compositions and methods for the prevention or treatment of cancer and bone loss associated with cancer
The present invention relates to compositions and methods for the prevention and/or treatment of bone loss associated with cancer. More particularly, the invention relates to OPG compositions and methods for the prevention and/or treatment of bone loss comprising said compositions. The invention also relates to the use of OPG compositions ...

01/26/06 - 20060019886 - Monomer protein with bone morphogenetic activity and medicinal agent containing the same for preventing and treating diseases of cartilage and bone
This invention provides for a protein of the TGF-β superfamily in which the cysteine involved in the normal formation of homodimers is changed to another amino acid. These mutant proteins, as monomers, display higher bone morphogenetic activity than the wild-type protein dimers. Also provided is a method for producing and ...

01/26/06 - 20060019885 - Modified bryodin 1 with reduced immunogenicity
The invention relates to the modification of bryodin 1 to result in bryodin 1 proteins that are substantially non-immunogenic or less immunogenic than any non-modified counterpart when used in vivo. The invention relates furthermore to T-cell epitope peptides derived from said nonmodified protein by means of which it is possible ...

01/26/06 - 20060019884 - Peptide composition
Provided is use of a peptide, or a derivative of a peptide, in the manufacture of a medicament effective in stimulating fibroblasts to produce fibrillin, wherein the peptide comprises an amino acid sequence present in an α-S2 casein precursor, said sequence comprising 3 or more amino acids, and not comprising ...

01/19/06 - 20060014692 - Methods of using non-human animal apoliprotein a-i protein
The invention provides methods and compositions for treating disorders using non-human animal Apolipoprotein A-I (ApoA-I) protein. The invention provides methods and compositions for treating disorders in animals, including humans, associated with dyslipidemia, including hyperlipidemia, hyperlipoproteinemia, hypertriglyceridemia, hypercholesterolemia, HDL deficiency, ApoA-I deficiency, cardiovascular disease, atherosclerosis, restenosis, and other disorders such as ...

01/19/06 - 20060014691 - Mechanically activated channel blocker
The present invention discloses a peptide of SEQ ID NO:1 and its variants that blocks stretch-activated ion channels. All amino acids in this peptide are D-amino acids. The peptide, designated as D-GsMTx4, is an enantiomer of a peptide GsMTX-4 present in the venom of the spider Grammostola spatulata. The present ...

01/19/06 - 20060014690 - Epidermal growth factor receptor antagonists and methods of use
The present invention features epidermal growth factor receptor (EGFR) antagonists. These EGFR antagonists are polypeptide variants of ligands of EGFR. The EGFR ligand polypeptide variants of the invention possess EGFR antagonistic properties and can inhibit at least one EGFR-mediated biological activity such as inhibition of the receptor's kinase activation activity ...

01/19/06 - 20060014689 - Method of treatment of cancer using guanosine 3', 5' cyclic monophosphate (cyclic gmp)
A method of treating cancer through use of guanosine 3′,5′-cyclic monophosphate (cyclic GMP). Cyclic GMP decreases the number of human breast cancer and prostate adenocarcinoma as well as small-cell and squamous lung cells in culture by 30% (1 μM), 84% (1 mM), 31% (1 μM), and 30% (1 μM), respectively. ...

01/19/06 - 20060014688 - Methods of inhibiting tumor cell proliferation
The invention provides methods for inhibiting tumor cell proliferation by inhibiting FoxM1B activity, expression, or nuclear localization in a tumor cell. The invention also provides methods for preventing tumor progression in an animal comprising inhibiting FoxM1B activity, expression, or nuclear localization. Furthermore, the invention provides methods for inhibiting tumor cell ...

01/19/06 - 20060014687 - Bone delivery conjugates and method of using same to target proteins to bone
A bone delivery conjugate having a structure selected from the group consisting of: A) X-Dn-Y-protein-Z; and B) Z-protein-Y-Dn-X, wherein X is absent or is an amino acid sequence of at least one amino acid; Y is absent or is an amino acid sequence of at least one amino acid; Z ...

01/19/06 - 20060014686 - Diagnoses and therapeutics for cancer
Methods and compositions for treating and diagnosing cancer and screening for agents for such treatment and diagnosis are provided. The methods involve screening for agents that modulate the activity or expression of FOXM1, which has been discovered herein to play a role in cell growth and cell cycle regulation. Methods ...

01/19/06 - 20060014685 - Glucagon-like peptide-1 analogs with long duration of action
Novel GLP-1 analogs having improved biological potency as well as extended pharmacological activity are described herein. More specifically, the present invention relates to GLP-1 analogs (28 or 29 aa long) comprising amino acid substitutions at one or more of the following positions: 8, 20, 27, 30 and 33. ...

01/19/06 - 20060014684 - Novel uses of egf
This invention relates to treating or preventing pathogenic infections with an epidermal growth factor (EGF). EGF is capable of inhibiting pathogenic colonization of pathogens in a variety of tissue or cell types. Since pathogenic colonization is essential for pathogenic infection, EGF can be used as an effective preventive and therapeutic ...

01/19/06 - 20060014683 - Inactivation resistant factor viii
The present invention provides novel purified and isolated nucleic acid sequences encoding procoagulant-active FVIII proteins. The nucleic acid sequences of the present invention encode amino acid sequences corresponding to known human FVIII sequences, wherein residue Phe309 is mutated. The nucleic acid sequences of the present invention also encode amino acid ...

01/19/06 - 20060014682 - Cxcr4 antagonist treatment of hematopoietic cells
In accordance with various aspects of the invention, CXCR4 antagonists may be used to treat hematopoietic cells, such as progenitor or stem cells, to promote the rate of cellular multiplication, self-renewal, proliferation or expansion. CXCR4 antagonists may be used therapeutically to stimulate hematopoietic stem/progenitor cell multiplication/self-renewal. ...

01/19/06 - 20060014681 - Three-dimensional structure of complement receptor type 2 and uses thereof
Disclosed is a crystalline human CR2 protein in complex with C3d, and the three dimensional structure of the crystalline complex. Also disclosed are methods of use of the structure, particularly for structure-based identification of compounds that bind to CR2 and inhibit or enhance the binding of CR2 to a natural ...

01/19/06 - 20060014680 - Peptides and compounds that bind to the il-5 receptor
New IL-5 receptor antagonists and methods of use are described, e.g., in the treatment of IL-5 receptor mediated disorders. The compounds include both monomers and dimers that were identified using one or more of alanine scans, lysine scans, other residue substitutions, and C- and N-terminal truncations and additions vis a ...

01/19/06 - 20060014679 - Insulin resistance improving agents
A compound or its salt inhibiting the activity of a protein having an amino acid sequence which is the same or substantially the same amino acid sequence as the amino acid sequence represented by SEQ ID NO: 1, an extracellular domain of the protein above, an antibody, an antisense polynucleotide, ...

01/19/06 - 20060014678 - Modification of feeding behavior
Methods are disclosed for decreasing calorie intake, food intake, and appetite in a subject. The methods include peripherally administering PYY or an agonist thereof and GLP-1 or an agonist thereof to the subject, simultaneously or sequentially, thereby decreasing the calorie intake of the subject. ...

01/12/06 - 20060009390 - Dose of an angiogenic factor and method of administering to improve myocardial blood flow
The present invention has multiple aspects. In one aspect, the present invention is directed to a unit dose pharmaceutical composition comprising from about 5 ng/dose to less than 135,000 ng of an angiogenic agent, typically from 5 ng to 67,500 ng. Preferably, the angiogenic agent is FGF, more preferably it ...

01/12/06 - 20060009389 - Pharmaceutical composition comprising fgf18 and il-1 antagonist and method of use
FGF18 is known to stimulate the proliferation of chondrocytes, bone, and nervous tissue, resulting in repair of diseased tissue. When an IL-1 antagonist is administered in addition to FGF18, the effects on the IL-1 mediated disease and also, the effect on cartilage, bone, and nervous cell proliferation, are found to ...

01/12/06 - 20060009388 - Treatment of conditions involving demyelination
The invention provides methods of treating diseases, disorsers or injuries involving demyelination and dysmyelination, including multiple sclerosis, by the administration of an Sp35 antagonist. ...

01/12/06 - 20060009387 - Apo-2 ligand/trail formulations
The present invention relates generally to Apo2L/TRAIL purification involving crystallization. ...

01/12/06 - 20060009386 - Use of gelsolin to treat infections
The invention relates to the use of gelsolin to treat infections and to monitor the treatment of infections. The invention also provides methods up-regulating interleukin expression and methods for down-regulating pro-inflammatory cytokine expression. ...

01/12/06 - 20060009385 - Multiple-variable dose regimen for treating tnfalpha-related disorders
Multiple-variable dose methods for treating TNFα-related disorders, including Crohn's disease and psoriasis, comprising administering TNFα inhibitors, including TNFα antibodies, are described. Multiple-variable dose methods include administration of a TNF-inhibitor in an induction or loading phase followed by administration of the agent in a maintenance or treatment phase, wherein the TNF-inhibitor ...

01/12/06 - 20060009384 - Novel use of peptide compounds for treating status epilepticus or related conditions
The present invention is directed to the novel use of a class of peptide compounds for treating status epilepticus or related conditions, e.g. acute repetitive seizures, seizure clusters, etc. ...

01/12/06 - 20060009383 - Stable bactericidal/permeability-increasing protein products and pharmaceutical compositions containing the same
Disclosed are novel bactericidal/permeability-increasing (BPI) protein products wherein cysteine residue number 132 or 135 is replaced by another amino acid residue, preferably an alanine or serine residue and/or wherein the leucine residue at position 193 is the carboxy terminal residue. Also disclosed are DNA sequences encoding methods for the production ...

01/12/06 - 20060009382 - Use of a cd28 binding pharmaceutical substance for making a pharmaceutical composition with dose-dependent effect
The invention relates to the use of a CD28-specific superagonistic monoclonal antibody (MAB) or of a mimetic compound of the same, for producing a pharmaceutical composition, wherein the dosage is below or above a defined dosage limit. ...

01/12/06 - 20060009381 - Annexins, derivatives thereof, and annexin-cys variants, as well as therapeutic and diagnostic uses thereof
The present invention provides methods and compositions for the treatment, diagnosis, and prevention of diseases, such as neoplastic diseases, neurodegenerative diseases, cardiovascular diseases, autoimmune diseases, and inflammatory diseases. The methods include the administration of pharmaceutical complexes comprising annexins coupled to pharmaceutical compounds or carriers to subjects. The present invention also ...

01/12/06 - 20060009380 - Isolated polypeptide of the stratum corneum and its use
The invention concerns an isolated polypeptide, of the family of calcium-fixing proteins, a mixture of polypeptides derived from proteolysis of the isolated polypeptide, compositions containing them, the uses of said polypeptide and a cosmetic treatment method for dry skin, hyperkeratosis, parakeratosis, psoriasis, ichthyosis, and neoplasia. The invention also concerns a ...

01/12/06 - 20060009379 - Methods for controlling proliferation of cells
An isolated nucleostemin polypeptide is disclosed herein. The nucleostemin polypeptide includes an amino acid sequence at least 85% identical to SEQ ID NO: 2. In several examples, the polypeptide regulates cell differentiation, cell proliferation, or both. Nucleic acids encoding these polypeptides, vectors including the nucleic acids, and host cells transfected ...

01/05/06 - 20060003938 - Novel pyrrhocoricin-derived peptides and methods of use thereof
Modifications of the peptide pyrrhocoricin permit the production of a variety of anti-bacterial or anti-fungal peptides having the general formula R1-Asp-Lys-Gly-X-Y-Leu-Pro-Arg-Pro-Thr-Pro-Pro-Arg-Pro-Ile-Tyr-X′-Y′-R2 [SEQ ID NO: 1] or multimeric compositions containing more than a single peptide of that formula. These peptides may be straight chain or cyclic peptides, and may contain one ...

01/05/06 - 20060003937 - Urocortin-iii and uses thereof
A search of the public human genome database identified a human EST, GenBank accession number AW293249, which has high homology to known pufferfish urocortin sequences. The full length sequence was amplified from human genomic DNA and sequenced. Sequence homology comparisons of the novel sequence with human urocortin I and urocortin ...

01/05/06 - 20060003936 - Method for modulating the production of a selected protein in vivo
A method is provided for use in producing a selected protein in mammalian cells, and to cDNA molecules useful in the method, and fusion proteins produced from expression of the cDNA. In the method, cDNA encoding a fusion protein that includes a mammalian DHFR and the selected protein is introduced ...

01/05/06 - 20060003935 - Peptides acting as both glp-1 receptor agonists and glucagon receptor antagonists and their pharmacological methods of use
The invention provides polypeptides that act both as an agonist of the GLP-1 receptor and an antagonist of the glucagon receptor. Such polypeptides are useful for treating individuals with type 2 diabetes or other metabolic disorders. ...

01/05/06 - 20060003934 - Peptides acting as both glp-1 receptor agonists and glucagon receptor antagonists and their pharmacological methods of use
The invention provides polypeptides that act both as an agonist of the GLP-1 receptor and an antagonist of the glucagon receptor. Such polypeptides are useful for treating individuals with type 2 diabetes or other metabolic disorders. ...

01/05/06 - 20060003933 - Compositions and methods for treatment of neovascular diseases
The present invention provides compositions and methods of treating neovascular diseases, such as a retinal neovascular diseases and tumors, by administering to a patient suffering from a neovascular disease or tumor a vascular development inhibiting amount of a combination of the angiogenesis suppressing drugs comprising an angiostatic fragment of tryptophanyl-tRNA ...

01/05/06 - 20060003932 - Method for promoting neovascularization
The present invention relates to a method for enhancing angiogenic activity to promote neovascularization comprising administering to a subject a formulation comprising a synergistically effective amount of a TWEAK agonist and an angiogenic factor. ...

01/05/06 - 20060003931 - Crystal structure of the hepatocyte growth factor and methods of use
The disclosure provides a crystal and crystal structure of the Hepatocyte Growth Factor Beta (HGF β) Chain, as well as use of the crystal structure in the design, identification, and selection of modulators of HGF or Met activity. ...

01/05/06 - 20060003930 - Cd39/ecto-adpase for treatment of thrombotic and ischemic disorders
The present invention relates to a method for treating an ischemic disorder in a subject which comprises administering to the subject a CD39 polypeptide (SEQ ID NO:2) or an active fragment thereof which inhibits ADP or ATP mediated platelet aggregation or leukocyte accumulation so as to treat the ischemic disorder ...

01/05/06 - 20060003929 - Peptide inhibitor of tgf-beta growth factors
A potent peptide inhibitor (SuperSog) of TGF-β family growth factor signaling, peptide variants thereof and nucleotide coding sequences therefore are provided by the invention. The Super-Sog peptide comprises a fragment of the Drosophilia short gastrulation (Sog) gene which includes the CR-1 cysteine-rich repeat of Sog. Methods and compositions for use ...

01/05/06 - 20060003928 - Use of osteoprotegerin for the treatment and/or prevention of fibrotic disease
The invention relates to the use of osteoprotegerin for treatment and/or prevention of fibrotic diseases, in particular of scleroderma. ...

12/29/05 - 20050288228 - Bile-acid conjugates for providing sustained systemic concentrations of drugs
This invention is directed to compounds that provide for sustained systemic concentrations of therapeutic or prophylactic agents following administration to animals. This invention is also directed to pharmaceutical compositions including and methods using such compounds. ...

12/29/05 - 20050288227 - Use of thioredoxin measurements for diagnostics and treatments
The invention relates to methods for monitoring patient response to histone deacetylase inhibitors (e.g., suberoylanilide hydroxamic acid (SAHA)) or other therapeutic agents by measuring the level of thioredoxin in body fluids, tissues, and/or cells, such as peripheral blood mononuclear cells, plasma, or serum. The invention also relates to methods of ...

12/29/05 - 20050288226 - Methods for treating and diagnosing cancer with wnt inhibitory factor-1 (wif-1)
This invention provides compositions, methods and kits for the diagnosis and treatment of cancers wherein Wnt Inhibitory Factor-1 (WIF-1) is underexpressed. ...

12/29/05 - 20050288225 - Modulators of intracellular inflammation, cell death and cell survival pathways
A B1 protein, its isoforms, analogs, fragments and derivatives, are provided. The protein is useful in the modulation of intracellular inflammation, cell death and/or cell survival pathways. ...

12/29/05 - 20050288224 - Novel protein, a gene coding therefor and a method of using the same
The object of the present invention is to screen and identify a novel antimicrobial protein which can inhibit the growth of plant pathogenic microorganisms at a relatively low concentration such as Pyricularia oryzae and Rhizoctonia solani causative of two major diseases causing damage to rice crops and, further, to clone ...

12/29/05 - 20050288223 - Obg3 fragments inhibiting the conversion of active obg3 into less active obg3 and other compositions for treatment of metabolic disorders
The present invention relates to the field of obesity research. Fragments of OBG3 have been identified that reduce weight gain in animals. These fragments of OBG3 should be effective for reducing body mass and for treating obesity-related diseases and disorders. These obesity-related diseases and disorders include hyperlipidemias, atherosclerosis, diabetes, and ...

12/22/05 - 20050282753 - Bacteriocins and novel bacterial strains
Novel bacteriocins produced by novel bacterial strains are used for at least reducing the levels of colonization by at least one target bacteria in animals, especially poultry. ...

12/22/05 - 20050282752 - Il-1ra variants
The present invention provides for an IL-1ra having reduced aggregation, methods of reducing aggregation of IL-1ra, and kits comprising an IL-1ra having reduced aggregation. ...

12/22/05 - 20050282751 - Therapeutic agent for renal anemia
There is provided an agent for preventing or treating renal anemia, which contains arginine as an active ingredient. This agent for preventing or treating renal anemia can be easily administered and the administration can be controlled at home to obtain excellent effect in preventing or treating renal anemia. ...

12/22/05 - 20050282750 - Treatment for dark adaptation
The present invention addresses the treatment of age-related macular degeneration using regulation of pathogenic mechanisms similar to atherosclerosis. In further specific embodiments, compositions that increase reverse cholesterol transport are utilized as therapeutic targets for age-related macular degeneration. In a specific embodiment, the lipid content of the retinal pigment epithelium, and/or ...

12/22/05 - 20050282749 - Use of glp-2 and related compounds for the treatment, prevention, diagnosis, and prognosis of bone-related disorders and calcium homeostasis related syndromes
The present invention relates to methods for prevention and treatment of bone-related disorders and calcium homeostasis related syndromes using a GLP-2 molecule or GLP-2 activator either alone or in combination with another therapeutic. The present invention also encompasses methods of diagnosing or monitoring the progression of a disorder. The invention ...

12/22/05 - 20050282748 - Glue compositions for lung volume reduction
The present invention relates to methods and compositions for sealing localized regions of damaged lung tissue to reduce overall lung volume. The glue compositions provide a glue featuring an adhering moiety coupled to one or more other moieties including, for example, a cross-linkable moiety and/or one other adhering moiety. The ...

12/22/05 - 20050282747 - Methods and compositions for wound healing
Migration-inducing peptide fragments or domains from native human fibronectin are attached through a linker to hyaluronic acid. Such agents are useful for in vivo wound healing, including but not limited to deep wounds and chronic wounds. ...

12/22/05 - 20050282746 - Novel glutamate receptor and utilization thereof
It is intended to disclose a glutamate sensor in taste sensation and digestion and provide techniques using the same. A glutamate-receptor protein having the following characteristics is reacted with a substance binding thereto in the presence of a test substance and thus the inhibition or acceleration of the reaction is ...

12/22/05 - 20050282745 - Non-mammalian gnrh analogs and uses thereof in regulation of fertility and pregnancy
Chicken II and salmon GnRH analog decapeptides resistant to degradation by peptidase incorporating D-arginine, D-leucine, D-tBu-Serine, D-Trp or other active D amino acids at position 6 and ethylamide, aza-Gly-amide or other Gly amide at position 10. The analogs demonstrate preferential binding to male and female reproductive system GnRH receptors. Biopotency ...

12/22/05 - 20050282744 - Compositions and methods for preventing or treating cancer
The present invention relates to a MUC1 cytoplasmic tail peptide or portion thereof. These peptides are useful for inducing an immune response to MUC1-expressing tumor cells and thus for preventing or treating cancer. ...

12/22/05 - 20050282743 - Molecular interactions in cells
The invention provides reagents and methods for inhibiting or enhancing interactions between proteins in cells, particularly interactions between a PDZ protein and a PL protein. Reagents and methods that are provided are useful for treatment of a variety of diseases and conditions in a variety of cell types. ...

12/15/05 - 20050