REGISTER now for FREE 
|
FREE patent keyword monitoring and additional FREE benefits. REGISTER now for FREE
|
|
|
Chemistry: Molecular Biology And Microbiology > Measuring Or Testing Process Involving Enzymes Or Micro-organisms; Composition Or Test Strip Therefore; Processes Of Forming Such Composition Or Test Strip > Involving Antigen-antibody Binding, Specific Binding Protein Assay Or Specific Ligand-receptor Binding Assay > Involving A Micro-organism Or Cell Membrane Bound Antigen Or Cell Membrane Bound Receptor Or Cell Membrane Bound Antibody Or Microbial Lysate > Animal Cell > Tumor Cell Or Cancer Cell Tumor Cell Or Cancer CellTumor Cell Or Cancer Cell patent applications listed are from June 2005 to current and include Date, Patent Application Number, Patent Title, Patent Abstract summary and are linked to the corresponding patent application page.04/19/07 - 20070087394 - Epidermal growth factor receptor gene copy number Methods of predicting whether an anti-epidermal growth factor receptor (“EGFr”)-specific binding agent treatment will be efficacious in treating cancer, and methods of treating patients with anti-EGFr-specific binding agents, are provided. ... 04/19/07 - 20070087393 - Quantitative zap-70 assay An quantitative ZAP-70 assay is provided, with ZAP-70+ and ZAP-70− controls, normal human blood controls, an improved antibody with better signal to noise ratio, and using the median MEFL that is calibrated using a standard curve. ... 04/19/07 - 20070087392 - Method for diagnosing head and neck squamous cell carcinoma Disclosed are protein biomarkers and their use in diagnosing head and neck squamous cell carcinoma (HNSCC) or to make a negative diagnosis in patients. Also disclosed are kits for the diagnosis of HNSCC that detect the protein biomarkers of the invention, as well as methods using a plurality of classifiers ... 04/12/07 - 20070082371 - Family of genes encoding apoptosis-related peptides, peptides encoded thereby and methods of use thereof An isolated polynucleotide at least 60% homologous to SEQ ID NO: 1, 3, 5 or 18 encoding a SARP polypeptide; vectors comprising a polynucleotide sequence encoding at least 11 consecutive amino acids of αSARP polypeptide; a host cell transformed with an isolated polynucleotide or vector; antibodies specific for SARP and ... 04/05/07 - 20070077606 - Methods and compositions to correlate trichomonas infection with prostate cancer The present invention provides methods and compositions for identifying a subject at increased risk of having prostate cancer by detecting an antibody that specifically binds a Trichomonas α-actinin protein in a sample of the subject. ... 03/29/07 - 20070072251 - In vivo imaging using peptide derivatives The present invention relates to the use of phage display LLG peptide derivatives as tumor targeting agents for diagnostic purposes, and to a method for targeting and imaging tumors and infections/inflammation. A diagnostic composition comprising said peptide derivatives is also disclosed. ... 03/29/07 - 20070072250 - Method and system for analysis of cancer biomarkers using proteome image mining The present invention provide a system and a method for detection of cancer, by producing a serum proteome standard by an image mining technique, and provide cancer-specific biomarkers. Disclosed is a method of analyzing cancer, comprising the steps of transforming serum proteomes from normal individuals and individuals having cancer into ... 03/22/07 - 20070065890 - Method for promoting formation of facultative heterochromatin The present invention is a method for promoting facultative heterochromatin formation using SirT1. Using novel anti-SirT1 and anti-acetylated histone H1 antibodies, human SirT1 protein was shown to interact with and deacetylate histone H1 at lysine 26. Moreover, SirT1 was shown to mediate deactylation of histones H3 and H4 and spreading ... 03/22/07 - 20070065889 - Compositions and methods to diagnose and treat lung cancer The present invention provides methods for aiding in the diagnoses of the condition of a lung cell, and methods of screening for a potential therapeutic agents for cytolysis or apoptosis of lung cancer cells. ... 03/22/07 - 20070065888 - Reagents and methods for use in cancer diagnosis, classification and therapy Methods and reagents for classifying tumors and for identifying new tumor classes and subclasses. Methods for correlating tumor class or subclass with therapeutic regimen or outcome, for identifying appropriate (new or known) therapies for particular classes or subclasses, and for predicting outcomes based on class or subclass. New therapeutic agents ... 03/22/07 - 20070065887 - Diagnosis of pre-cancerous conditions using pcdgf agents The present invention relates to methods and compositions designed for the treatment or management of pre-cancerous conditions, especially in order to prevent, delay, or decrease the likelihood that the pre-cancerous condition will progress to malignant cancer. The methods of the invention comprise the administration of an effective amount of one ... 03/15/07 - 20070059785 - Biomarkers in cancer Biomarkers may be used in the treatment of cancer, and as an aid in clinical decision making regarding which anti-cancer therapy to use in a particular patient. Described herein are methods of assessing whether a subject with a solid tumor is suitable for treatment with a dual EGFR/erbB2 tyrosine kinase ... 03/15/07 - 20070059784 - Methods for measuring the insulin receptor alpha subunit Presence of free insulin receptor α-subunit in blood was discovered. Furthermore, methods for measuring the insulin receptor α-subunit was provided, the method comprising the steps of contacting the insulin receptor α-subunit in a blood sample with an antibody recognizing the insulin receptor α-subunit, and detecting the binding between the two. ... 03/15/07 - 20070059783 - Method of identifying markers diagnostic of disease and uses therefor in the diagnosis of cancer This invention provides methods for the diagnosis of cancer by identifying novel glycans that are diagnostic of cancerous cells or tumors in an human or animal subject, and methods for identifying markers of disease states in humans and/or animals using mass spectrometry on partially purified glycan-containing samples. ... 03/08/07 - 20070054333 - Tumor suppressor designated ts10q23.3 A specific region of chromosome 10 (10q23.3) has been implicated by series of studies to contain a tumor suppressor gene involved in gliomas, as well as a number of other human cancers. One gene within this region was identified, and the corresponding coding region of the gene represents a novel ... 03/08/07 - 20070054332 - Syndecan 1 ectodomain inhibits cancer The present invention provides for the treatment of cancers, e.g., carcinomas, using the ectodomain of syndecan 1, where the ectodomain lacks heparan sulfate residues. In addition, agents that bind the ectodomain of syndecan 1 also are useful as anti-cancer therapeutics. ... 03/08/07 - 20070054331 - System and method of evaluation of stochastic interactions of a soluble ligand with a target cell population for optimization of drug design and delivery A computer system for recommending an optimal treatment protocol comprising a model of biological processes related to a disease. A treatment protocol generator generates a plurality of treatment protocols for treating a disease using drugs. A selector selects an optimal treatment protocol from said plurality of treatment protocols based on ... 03/08/07 - 20070054330 - Determination of responders to chemotherapy The present invention relates to a method of determining whether a biological sample comprising human lung cancer cells is sensitive to a combination of an epidermal growth factor receptor inhibitor and a chemotherapeutic agent by determining the overexpression of a phosphorylated AKT protein and/or a phosphorylated MAPK protein in the ... 03/08/07 - 20070054329 - Biomarker for ovarian and endometrial cancer: hepcidin The present invention provides protein-based biomarkers and biomarker combinations that are useful in qualifying ovarian cancer status as well as endometrical cancer status in a patient. In particular, it has been found that hepcidin is a biomarker for both ovarian cancer and endometrial cancer and that a panel of biomarkers, ... 03/08/07 - 20070054328 - Methods A method for identifying a compound for modulating the cellular activity or location of PTPL1, comprising the step of identifying a compound that modulates the interaction of PTPL1 with TAPP; or which modulates or mimics the interaction of TAPP with Ptdlns(3, 4)P2; or which modulates the cellular location of TAPP. ... 03/01/07 - 20070048811 - Tumor suppressor designated ts10q23.3 A specific region of chromosome 10 (10q23.3) has been implicated by series of studies to contain a tumor suppressor gene involved in gliomas, as well as a number of other human cancers. One gene within this region was identified, and the corresponding coding region of the gene represents a novel ... 03/01/07 - 20070048810 - Atp-binding cassette protein responsible for cytotoxin resistance This invention provides for a novel ATP-binding cassette protein which is responsible for cytotoxin resistance. The invention also provides for methods of expressing the protein and assays for identification of inhibitors of the protein. ... 03/01/07 - 20070048809 - Detection and treatment of prostate cancer An antigen is shown to be associated with prostate cancer, and is useful for new methods and compositions for diagnosing or treating prostate cancer. This is particularly useful for individuals with prostate cancer who test negative for Prostate Specific Antigen. Additionally, this is useful for distinguishing between benign prostate disease ... 03/01/07 - 20070048808 - Hepatocellular carcinoma screening A method for identifying individuals at risk for developing hepatocellular carcinoma is described. The method detects differential patterns of gene expression that are caused by the presence of hepatitis B virus x antigen. ... 02/22/07 - 20070042447 - Use of anti-ferritin monoclonal antibodies in the treatment of some cancers (divisional) The invention concerns the use, in the preparation of a medicine for treating cancer whereof the cells exhibit overexpression of a product of a gene of the myc-related family, of an anti-ferritin monoclonal antibody or a fragment thereof, said antibody or said fragment identifying an epitope common to acidic and ... 02/22/07 - 20070042446 - Mammalian iap gene family, primers, probes and detection methods Disclosed is substantially pure DNA encoding mammalian IAP polypeptides; and methods of using such DNA to express the IAP polypeptides in cells and animals to inhibit apoptosis. Also disclosed are conserved regions characteristic of the IAP family and primer and probes for the identification and isolation of additional IAP genes. ... 02/22/07 - 20070042445 - Method for demonstration of a molecular event in a cell by means of fluorescent marker proteins The invention relates to a method for demonstration of the occurrence of a molecular event, particularly in a cell, characterised by the detection of the “solubilisation” of a fixed protein marker (or the fixing of a solubilised protein marker) which is a direct or indirect marker for the occurrence of ... 02/22/07 - 20070042444 - Multiple-channel test device, method for producing the same and use thereof The object of the invention is a multiple-channel test devise based on immunodiffusion and immunochromatography, which enables the simultaneous or parallel determination of several analytes. In the test devise, it is possible to group together different combinations of markers recognizing allergens, myocardial infarction markers, venereal disease analytes, blood screening analytes, ... 02/15/07 - 20070037229 - Altered intracellular localization of brk/sik protein tyrosine kinase in human prostate tumors The invention provides methods for detecting abnormal prostate conditions, such as benign prostatic hyperplasia (BPH), prostatic intraepithelial neoplasia (PIN), and adenocarcinoma, in an animal by comparing the amount of the Breast Tumor Kinase (BRK) tyrosine kinase in the nuclei of prostate luminal epithelial cells in a test sample with an ... 02/15/07 - 20070037228 - Method for predicting the response to a treatment The invention is related to a method of predicting the response to a treatment with a HER inhibitor in a patient comprising the steps of assessing a biomarker or a combination of biomarkers selected from the group consisting of amphiregulin, an epidermal growth factor, a transforming growth factor alpha, and ... 02/15/07 - 20070037227 - Annexin proteins and autoantibodies as serum markers for cancer The present invention relates to screening methods for diagnosis, prognosis, or susceptibility to cancer in a subject by means of detecting the presence of serum autoantibodies to specific annexin protein antigens in sera from subjects. The present invention also provides screening methods for diagnosis and prognosis of cancer in a ... 02/15/07 - 20070037226 - Diagnostics and therapeutics for diseases associated with g-protein coupled receptor adipor1(adipor1) The invention provides a human AdipoR1 which is associated with the cardiovascular diseases, dermatological diseases, gastroenterological diseases, cancer, hematological diseases, inflammation, respiratory diseases, neurological diseases and urological diseases. The invention also provides assays for the identification of compounds useful in the treatment or prevention of cardiovascular diseases, dermatological diseases, gastroenterological ... 02/08/07 - 20070031905 - Soluble fas urinary marker for the detection of bladder transitional cell carcinoma The present invention is an apparatus, system and method for detecting bladder cancer are provided that includes a substrate including one or more sFas binding agents and one or more reagents that indicate the amount of sFas present in the sample. ... 02/08/07 - 20070031904 - Mammalian iap gene family, primers, probes and detection methods Disclosed is substantially pure DNA encoding mammalian IAP polypeptides; and methods of using such DNA to express the IAP polypeptides in cells and animals to inhibit apoptosis. Also disclosed are conserved regions characteristic of the IAP family and primer and probes for the identification and isolation of additional IAP genes. ... 02/08/07 - 20070031903 - Mammalian iap gene family, primers, probes and detection methods Disclosed is substantially pure DNA encoding mammalian IAP polypeptides; and methods of using such DNA to express the IAP polypeptides in cells and animals to inhibit apoptosis. Also disclosed are conserved regions characteristic of the IAP family and primer and probes for the identification and isolation of additional IAP genes. ... 02/08/07 - 20070031902 - Predictive methods for cancer chemotherapy This invention provides methods and reagents for determining or predicting response to cancer therapy, as well as dual therapy treatments. ... 02/08/07 - 20070031901 - Compositions and methods for the diagnosis and treatment of tumor The present invention is directed to compositions of matter useful for the diagnosis and treatment of tumor in mammals and to methods of using those compositions of matter for the same. ... 02/08/07 - 20070031900 - Diagnosing and grading gliomas using a proteomics approach The present invention provides for a proteomic approach to grading gliomas, and for predicting patient survival. In addition to employing global protein expression patterns, such as by mass spectrometry, particular target proteins whose expression is altered in various gliomas can be used to predict the stage/classificiation of a glioma, as ... 02/08/07 - 20070031899 - Drug An objective of the present invention is to provide methods of screening for novel compounds that exhibit anticancer activity. The screening methods of the present invention comprise using serine/threonine kinase Pim-1, or partial peptides or salts thereof. ... 02/01/07 - 20070026471 - Glypican-1 in human breast cancer Glycosylphosphatidylinositol-(GPI-) anchored HSPG glypican-1 is strongly expressed in human breast and pancreatic cancer—both by the cancer cells and in the case of pancreatic cancer the adjacent fibroblasts—whereas expression of glypican-1 is low in the normal pancreas and in chronic pancreatitis. Treatment of two pancreatic cancer cell lines, which express glypican-1, ... 02/01/07 - 20070026470 - Mammalian iap gene family, primers, probes and detection methods Disclosed is substantially pure DNA encoding mammalian IAP polypeptides; and methods of using such DNA to express the IAP polypeptides in cells and animals to inhibit apoptosis. Also disclosed are conserved regions characteristic of the IAP family and primer and probes for the identification and isolation of additional IAP genes. ... 02/01/07 - 20070026469 - Devices and methods for enrichment and alteration of circulating tumor cells and other particles The invention features devices and methods for detecting, enriching, and analyzing circulating tumor cells and other particles. The invention further features methods of diagnosing a condition, e.g., cancer, in a subject by analyzing a cellular sample from the subject. ... 01/25/07 - 20070020710 - Antibodies that spefically recognize inactive psa, and uses thereof An immunoassay for the quantitative determination of inactive, non-zymogen, free PSA in a biological sample taken from an individual, including contacting the biological sample with a reagent, where the reagent comprises an antibody or antibody fragments that bind specifically to inactive, non-zymogen, free PSA, the antibody being a purified polyclonal ... 01/25/07 - 20070020709 - Igf binding proteins IGFBP-3 fusion proteins are provided that are useful, for example, in cell-based assays, as IGF antagonists, and in mapping IGF-I and IGF-II binding sites on other molecules such as wild-type IGFBP-3 and IGF agonist peptides identified by phage display. Methods for making such fusion proteins are also provided. ... 01/25/07 - 20070020708 - Paad domain-containing polypeptides, encoding nucleic acids, and methods of use The invention provides isolated nucleic acid molecules encoding PAAD-domain containing polypeptides and functional fragments thereof, including fragments containing PAAD domains, NACHT domains and ARED domains, encoded polypeptides, and antibodies. Also provided are methods of identifying polypeptides and agents that associate with a PAAD-domain containing polypeptide or fragment thereof, or that ... 01/25/07 - 20070020707 - Tissue inhibitor of matrix metalloproteinases type-1 (timp-1) as a cancer marker The present invention describes a method for determining whether an individual is likely to have cancer by determining a parameter representing the TIMP-1 concentration in body fluid samples from the individual. ... 01/25/07 - 20070020706 - Truncated proteins as cancer markers Methods/reagents for detecting and/or treating cancers or potential cancers are disclosed. In one embodiment, methods and reagents for detecting truncated forms of P2X7 protein in cells are described. In one embodiment, methods and reagents for increasing the amount and/or activity of full-length P2X7 in cells are described. In one embodiment, ... 01/25/07 - 20070020705 - Method for prognostic evaluation of carcinoma using anti-p-lap antibody The present invention provides a reagent for prognostic evaluation of carcinoma patients, comprising an anti-P-LAP antibody as an active ingredient. Also, the present invention provides a method for determination of P-LAP which is a prognostic factor in carcinoma patients comprising (a) a step of contacting carcinoma tissues obtained from carcinoma ... 01/18/07 - 20070015226 - Method for detecting cancer using metal-oxide or metal-sulfide nanoparticle fluorescent material It is an object of the present invention to provide a nanoparticle fluorescent material for detecting cancer with which cancer can be detected with high sensitivity, using highly safe and broad light emission on a simple device. The present invention provides a nanoparticle fluorescent material which comprises a metal-oxide or ... 01/18/07 - 20070015225 - Methods for increasing the proliferation of b cells Disclosed herein are methods of increasing the proliferation of non-tumorigenic B cells. The methods involve administering PCDGF and optionally other B cells stimulators (e.g., IgM, LPS) to B cells resulting in an increase in B cell proliferation. The methods of the invention can be used, for example, to establish B ... 01/11/07 - 20070009973 - Method for screening candidate compounds for antitumor drug Investigation on the frequency of FLT3/ITD found in various blood cancers has revealed that the frequency is high in acute myeloblastic leukemia in particular. Studies on the effects of FLT3/ITD in the blood cell lines revealed that the tyrosine residues in FLT3/ITD is constitutively phosphorylated in these cell lines and ... 01/11/07 - 20070009972 - Epidermal growth factor receptor polypeptides and antibodies Antibodies and polypeptides that bind to and/or modulate the activity of receptors in the epidermal growth factor family are provided herein. ... 01/11/07 - 20070009971 - Mammalian iap gene family, primers, probes, and detection methods Disclosed is substantially pure DNA encoding mammalian IAP polypeptides; substantially pure polypeptides; and methods of using such DNA to express the IAP polypeptides in cells and animals to inhibit apoptosis. Also disclosed are conserved regions characteristic of the IAP family and primers and probes for the identification and isolation of ... 01/11/07 - 20070009970 - Biological patterns for diagnosis and treatment of cancer The present invention provides methods for diagnosing cancers, such as prostate cancer. Also, methods for evaluating the prostate cancer state of a patient are described herein. These methods involve the detection, analysis, and classification of biological patterns in biological samples. The biological patterns are obtained using, for example, mass spectrometry ... 01/04/07 - 20070003990 - Novel genes, compositions, kits, and methods for identification, assessment, prevention and therapy of cervical cancer The invention relates to newly discovered nucleic acid molecules and proteins associated with cervical cancer including pre-malignant conditions such as dysplasia. Compositions, kits, and methods for detecting, characterizing, preventing, and treating human cervical cancers are provided. ... 01/04/07 - 20070003989 - Methods of prostate cancer diagnosis and prostate tumour analysis The invention relates to a method of diagnosing prostate cancer in a subject, which method comprises determining the concentration of a relevant biochemical marker in the periprostatic tissue or lymph nodes of said subject, also to methods which categorise a prostate tumour and/or identify a prostate tumour which has extended ... 01/04/07 - 20070003988 - Method for cancer detection, progression analysis and malign tumour prognosis based on the study of metabolic markers of the cell Described is a method for cancer detection, progression analysis and malign tumour prognosis based on the study of metabolic markers of the cell. The method consists in using the study of the protein expression of the bioenergetic function of the mitochondrion, such as the beta-catalytic subunit of the H-ATP synthase, ... 12/28/06 - 20060292645 - Method and reagent for measuring kinase activity A method of measuring the activity of a kinase to which imatinib mesylate can bind is described. In the method, a kinase contained in a sample, to which imatinib mesylate can bind, a substrate for the kinase, and ATP are mixed. A phosphate group of ATP is thereby transferred to ... 12/28/06 - 20060292644 - Novel tumor-associated marker The present invention provides monoclonal antibody-producing hybridomas designated 27.F7 and 27.B1. The invention provides a method of detecting TIP-2 antigen bearing cancer cells in a sample. The invention provides a method of detecting TIP-2 antigen on the surface of cancer cells. The invention provides a method for diagnosing cancer in ... 12/28/06 - 20060292643 - Recognition molecules for the treatment and detection of tumours The invention relates to recognition molecules directed towards tumors, and it also relates to pharmaceutical compositions comprising said recognition molecules, methods for the production of said recognition molecules, and to the use of said recognition molecules in the diagnosis and therapy of tumor diseases. ... 12/21/06 - 20060286611 - Antibodies against biotinylated histones and related proteins and assays related thereto Described are specific biotinylation sites in histones, polypeptide fragments of histones comprising such biotinylation sites, and antibodies that selectively bind to such biotinylated sites. Also described are methods to detect biotinylation in a sample, to detect biotinyl transferase activity in a sample, to identify regulators of biotinylation, and to detect ... 12/14/06 - 20060281138 - Methods for diagnosis of low grade astrocytoma A method for identifying low grade astrocytoma cells in a sample is provided, wherein the method distinguishes between low grade astrocytoma cells and normal astrocytes, thus permitting early diagnosis of astrocytoma. The method uses antibody directed against JI-31 to test astrocytes in the sample for the presence or absence of ... 12/07/06 - 20060275846 - Detection of antigen specific immunocomplexes The present invention relates to methods and devices for detecting biological entities and components associated with hypersensitivity reactions in patients with allergies, cancer or autoimmune disease. Specifically, the assays of the invention are capable of qualitatively and/or quantitatively detecting allergen specific immunocomplexes by assaying for immobilized C3b in a biological ... 12/07/06 - 20060275845 - Annexin proteins and autoantibodies as serum markers for cancer The present invention relates to screening methods for diagnosis, prognosis, or susceptibility to cancer in a subject by means of detecting the presence of serum autoantibodies to specific annexin protein antigens in sera from subjects. The present invention also provides screening methods for diagnosis and prognosis of cancer in a ... 12/07/06 - 20060275844 - Diagnostic markers of breast cancer treatment and progression and methods of use thereof To maximize both the life expectancy and quality of life of patients with operable breast cancer, it is important to predict adjuvant treatment outcome and likelihood of progression before treatment. A machine-learning based method is used to develop a cross-validated model to predict (1) the outcome of adjuvant treatment, particularly ... 12/07/06 - 20060275843 - Methods for diagnosing the presence or stage of cancer The present invention provides antibodies to truncated isoforms of CCAAT-displacement protein/Cut homeobox (CDP/Cux) which are useful in diagnostic and prognostic methods for detecting cancer. Further provided are methods for detecting RNA transcripts encoding p75 for the detection of cancer. ... 11/30/06 - 20060269974 - Glycosylation markers for cancer diagnosing and monitoring One can identify and quantify one or more glycosylation markers of cancer by utilizing quantitative HPLC analysis of glycans which have been released from unpurified glycoproteins. The unpurified glycoproteins can be total glycoproteins or a selection of the total glycoproteins. The identified glycosylation marker can be a native glycan or ... 11/30/06 - 20060269973 - Methods of using il-21 for adoptive immunotherapy and identification of tumor antigens Methods for preparing ex vivo T cell cultures using IL-21 compositions for use in adoptive immunotherapy are described. Addition of IL-21 to cultures of non-terminally differentiated T cells population, either isolated or present in peripheral blood mononuclear cells are exposed to one or more tumor antigens, and in the presence ... 11/30/06 - 20060269972 - Method of diagnosing colorectal adenomas and cancer using infrared spectroscopy Infrared spectroscopy of human stool can be used as a non-invasive method of detecting the presence of colorectal cancer and/or clinically significant adenomas. The spectrum of a patient's stool is compared with that of stool from non-cancerous subjects, observed differences in spectra being indicative of cancer and/or clinically significant adenomas. ... 11/30/06 - 20060269971 - Methods for detecting prostate cancer The invention relates to the application of kallikrein 11, free PSA, and total PSA in the detection of prostate cancer. These markers may be used for the diagnosis, monitoring, staging, progression, prevention, treatment, and prognosis of prostate cancer, and as indicators before surgery or after relapse. A particular aspect of ... 11/23/06 - 20060263834 - Functional multi-drug resistance assay The invention provides methods for determining multi-drug resistance activity of a tumor cell that is present in a heterogeneous mixture of normal cells. The present invention relates particularly to improved quantitative methods for characterizing multi-drug resistance of selected populations of cells, including hematopoietic cell populations containing malignant cells. More specifically, ... 11/23/06 - 20060263833 - System, method, and article for detecting abnormal cells using multi-dimensional analysis A system, method, and article for diagnosing a test set of biological cells. For example, in one embodiment a normal set of cells is characterized using flow cytometry. A centroid and radius are defined for a set of clusters in an n-dimensional space corresponding to a normal maturation for a ... 11/16/06 - 20060257954 - At-home cancer test The at home cancer test permits a layperson to qualitatively test for the presence of carcinoma in the privacy of their home. The test includes a test strip coated or impregnated with at least one monoclonal antibody that binds to β-hCG/CGH found in the patient's urine, together with a chromophore ... 11/16/06 - 20060257953 - Artificial antibody polypeptides A fibronectin type III (Fn3) polypeptide monobody, a nucleic acid molecule encoding said monobody, and a variegated nucleic acid library encoding said monobody, are provided by the invention. Also provided are methods of preparing a Fn3 polypeptide monobody, and kits to perform said methods. Further provided is a method of ... 11/16/06 - 20060257952 - Use of protein asc as a marker for breast cancer The present invention relates to the diagnosis of breast cancer. It discloses the use of protein ASC in the diagnosis of breast cancer. It relates to a method for diagnosis of breast cancer from a liquid sample, derived from an individual by measuring ASC in the sample. Measurement of ASC ... 11/16/06 - 20060257951 - Use of protein spee as a marker for breast cancer The present invention relates to the diagnosis of breast cancer. It discloses the use of spermidine synthase (SPEE) in the diagnosis of breast cancer. It relates to a method for diagnosis of breast cancer from a liquid sample, derived from an individual by measuring SPEE in the sample. Measurement of ... 11/16/06 - 20060257950 - Use of protein ubc13 as a marker for breast cancer The present invention relates to the diagnosis of breast cancer. It discloses the use of ubiquitin-conjugating enzyme E2N (UBC13) in the diagnosis of breast cancer. It relates to a method for diagnosis of breast cancer from a liquid sample, derived from an individual by measuring UBC13 in the sample. Measurement ... 11/16/06 - 20060257949 - Methods of diagnosing and treating brain tumors The invention relates to methods and compositions for the diagnosis and treatment of brain tumors. ... 11/16/06 - 20060257948 - Antibody tools for the diagnostic use in the medical therapy with inhibitors of histone deacetylases The invention relates to a method for determining whether a treatment of a disorder with an HDAC inhibitor is to be started/continued or not comprising determining the level of histone acetylation in the sample by use of an antibody capable of binding to acetylated histone, and classifying the disorder as ... 11/16/06 - 20060257947 - Thrombospondin fragments and uses thereof in clinical assays for cancer and generation of antibdies and other binding agents The invention relates to thrombospondin fragments found in plasma, their use or use of portions thereof in diagnostic methods, as method calibrators, method indicators, and as immunogens, and as analytes for methods with substantial clinical utility; and their detection in plasma or other bodily fluids for purpose of diagnostic methods, ... 11/09/06 - 20060252106 - Monoclonal antibodies and methods for their use in the detection of cervical disease Compositions and methods for diagnosing high-grade cervical disease in a patient sample are provided. The compositions include novel monoclonal antibodies, and variants and fragments thereof, that specifically bind to MCM2. Monoclonal antibodies having the binding characteristics of an MCM2 antibody of the invention are further provided. Hybridoma cell lines that ... 11/09/06 - 20060252105 - Monoclonal antibody and hybridoma producing the same The present invention establishes a simple and a highly sensitive detection method for hEPR and provides a novel detection method for human tumors which express hEPR. In particular, the present invention provides a monoclonal antibody which specifically recognizes human epiregulin (hEPR), hybridoma which produces the monoclonal antibody, and a highly ... 11/02/06 - 20060246521 - Serum tumor marker in rodent prostate cancer models VQFHPENCTYSVVDRKNPGKTCRVDSWTM. ... 11/02/06 - 20060246520 - Gamma delta t cell-mediated therapy The present invention relates to compositions and methods for determining or modulating the activity of immune and/or target cells in vitro, ex vivo or in vivo. The invention more specifically relates to methods and compositions for determining sensitivity of cells to the activity of γδT cells, as well as to ... 10/26/06 - 20060240492 - Carbon nanotube based immunosensors and methods of making and using An immunoassay device comprises a plurality of carbon nanotubes having a first end and a second end, wherein the nanotubes are aligned substantially parallel relative to one another; a substrate responsive to an electrochemical signal, the substrate being attached to the first end of at least a portion of the ... 10/19/06 - 20060234319 - Disease determination method, data generation method for disease determination and data generation system for disease determination Supernatant of the urinary sample (SP1) was mixed with an acid or alkali and heated (SP2) and the sample for fluorescence assay was prepared after adjusting its acidity to alkaline (SP3). Next, using fluorometry, three-dimensional fluorescence spectrum consisted of an excitation light wavelength, fluorescence wavelength and fluorescence intensity (SP4). Then, ... 10/19/06 - 20060234318 - Cancer associated gene mina 53, protein mina 53 and monoclonal antibody thereof Myc protein is an unevenly distributed intermediate agent for cell proliferation, and activates a gene expression via E.box. Mina 53 gene encodes a protein of 53 kDa molecular weight and is present in the nucleoplasm and nucleolus. Mina 53 mRNA and protein expression are induced by artificial introduction of c-Myc ... 10/12/06 - 20060228761 - Novel rip3 associated cell cycle proteins, compositions and methods of use The present invention is directed to novel polypeptides, nucleic acids and related molecules which have an effect on or are related to the cell cycle. Also provided herein are vectors and host cells comprising those nucleic acid sequences, chimeric polypeptide molecules comprising the polypeptides of the present invention fused to ... 10/05/06 - 20060223129 - Compounds for immunodiagnosis of prostate cancer and methods for their use Compounds and methods for diagnosing prostate cancer are provided. The inventive compounds include polypeptides containing at least a portion of a prostate tumor protein. The inventive polypeptides may be used to generate antibodies useful for the diagnosis and monitoring of prostate cancer. Nucleic acid sequences for preparing probes, primers, and ... 10/05/06 - 20060223128 - Method for detecting multi-drug resistance The present invention stems from the realization that the cell surface content of sialic acids is associated with drug susceptibility and resistance in neoplastic and damaged cells. A general decrease in the amounts of the α2-6 linked sialic acid has been confirmed in resistant phenotype compare to its corresponding sensitive ... 10/05/06 - 20060223127 - Serum biomarkers in lung cancer Certain biomarkers and biomarker combinations are useful in a qualifying lung cancer status in a subject. A diagnostic methodology employing these biomarkers and combinations can detect whether a subject has lung cancer. ... 09/28/06 - 20060216764 - Pin1 as a marker for prostate cancer This invention provides methods for diagnosing prostate cancer, methods for measuring the aggressiveness of prostate cancer, and methods for identifying prostate cancer likely to metastasize. The diagnostic and prognostic assays of this invention include methods involving the antibody-based detection of Pin1 and the amplification of Pin1 RNA. The diagnostic and ... 09/28/06 - 20060216763 - Methods for predicting and/or diagnosing the risk of gastric cancer The present invention relates to methods of predicting the risk of developing cancer and in particular to a method for diagnosing, and/or predicting the risk of developing gastric cancer in a subject infected with Helicobacter. ... 09/21/06 - 20060211060 - Biological markers predictive of anti-cancer response to epidermal growth factor receptor kinase inhibitors The present invention provides diagnostic and prognostic methods for predicting the effectiveness of treatment of a cancer patient with an EGFR kinase inhibitor. Methods are provided for predicting the sensitivity of tumor cell growth to inhibition by an EGFR kinase inhibitor, comprising assessing whether the tumor cell has undergone an ... 09/21/06 - 20060211059 - Methods of improving screening, diagnosis and staging of prostate cancer using serum testosterone The present invention provides methods of screening for, detecting or diagnosing prostate cancer in a subject by determining the level of prostate specific antigen (PSA), complexed PSA (cPSA), free PSA, B-PSA, PRO-PSA or HK2 in a biological sample from the subject and correcting this level for free/bioavailable serum testosterone, total ... 09/21/06 - 20060211058 - Diagnosis and treatment of malignant neoplasms The invention features a method for diagnosing a malignant neoplasm in a mammal by contacting a bodily fluid from the mammal with an antibody which binds to an human aspartyl (asparaginyl) beta-hydroxylase (HAAH) polypeptide and methods of treating malignant neoplasms by inhibiting HAAH. ... 09/21/06 - 20060211057 - Methods and compounds for promoting vessel regression The present invention relates, at least in part, to methods and compositions for treating and diagnosing disorders associated with neovascularization, and methods for identifying targets and compositions used in treating and diagnosing such disorders. ... 09/14/06 - 20060205021 - Mammalian iap gene family, primers, probes and detection methods Disclosed is substantially pure DNA encoding mammalian IAP polypeptides; substantially pure polypeptides; and methods of using such DNA to express the IAP polypeptides in cells and animals to inhibit apoptosis. Also disclosed are conserved regions characteristic of the IAP family and primers and probes for the identification and isolation of ... 09/14/06 - 20060205020 - Cell-cycle checkpoint genes This invention relates to a class of checkpoint genes and their polypeptide products which control progression through the cell cycle in eukaryotic cells. In particular, this invention relates to Schizosaccharomyces pombe rad3 gene, to its human homologue (ATR), and to their encoded proteins. The invention further relates to assay methods ... 09/07/06 - 20060199233 - Mir-155 assay The invention provides methods for diagnosing B-cell lymphoma in an animal. In particular, the invention provides methods for distinguishing an animal having diffuse large B-cell lymphoma (DLBCL) with an activated B-cell (ABC) phenotype from an animal having DLBCL with a non-activated germinal-center (GC) phenotype. The invention also provides methods for ... 09/07/06 - 20060199232 - Use of protein pse3 as a marker for colorectal cancer The present invention relates to the diagnosis of colorectal cancer. It discloses the use of protein PSE3 (proteasome activator subunit 3) in the diagnosis of colorectal cancer. It relates to a method for diagnosis of colorectal cancer from a liquid sample, derived from an individual by measuring PSE3 in said ... 09/07/06 - 20060199231 - Detection of activation of endothelial cells as surrogate marker for angiogenesis Methods, compositions and kits are provided for assessing angiogenesis through sensitive, direct detection of activation of endothelial cells at molecular levels. In general, activation of endothelial cells is detected by measuring the levels of cellular components and their protein complexes participating in a specific angiogenesis signaling pathway in endothelial cells. ... 09/07/06 - 20060199230 - Use of prostate specific antigen to predict drug response A method of determining the likelihood for a subject to respond to a drug, comprising: measuring at least one PSA-related value in a subject suffering from a PSA-related disorder and having been administered a drug for treating the PSA-related disorder; comparing the PSA-related value with its respective control value; and ... 08/31/06 - 20060194266 - Use of protein rla-0 as a marker for colorectal cancer The present invention relates to the diagnosis of colorectal cancer. It discloses the use of protein RLA-0 (60S acidic ribosomal protein P0) in the diagnosis of colorectal cancer. It relates to a method for diagnosis of colorectal cancer from a liquid sample, derived from an individual by measuring RLA-0 in ... 08/31/06 - 20060194265 - Novel therapeutic targets in cancer The present invention relates to novel sequences for use in detection, diagnosis and treatment of cancers, especially lymphomas. The invention provides cancer-associated (CA) polynucleotide sequences whose expression is associated with cancer. The present invention provides CA polypeptides associated with cancer that are present on the cell surface and present novel ... 08/24/06 - 20060188950 - Use of protein spee as a marker for colorectal cancer The present invention relates to the diagnosis of colorectal cancer. It discloses the use of protein SPEE (sperrnidine synthase) in the diagnosis of colorectal cancer. It relates to a method for diagnosis of colorectal cancer from a liquid sample, derived from an individual by measuring SPEE in said sample. Measurement ... 08/24/06 - 20060188949 - Use of protein plst as a marker for colorectal cancer The present invention relates to the diagnosis of colorectal cancer. It discloses the use of protein PLST (T-plastin) in the diagnosis of colorectal cancer. It relates to a method for diagnosis of colorectal cancer from a liquid sample, derived from an individual by measuring PLST in said sample. Measurement of ... 08/24/06 - 20060188948 - Methods for identifying agents that modulate apoptosis in cells that over-express a bcl-2 family member protein The present invention provides methods and combinations of methods for identifying agents that modulate the apoptotic state of a cell by binding to the hydrophobic groove of a Bcl-2 family member anti-apoptotic protein. In certain embodiments, the methods generally comprise the use of Bcl-2 family member proteins having one or ... 08/17/06 - 20060183169 - Interleukin-8 homologous polypeptides and therapeutic uses thereof The present invention is directed to novel polypeptides having structural homology to IL-8 and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid sequences, chimeric polypeptide molecules comprising the polypeptides of the present invention fused to heterologous polypeptide sequences, antibodies ... 08/17/06 - 20060183168 - Method for optimizing therapeutic efficacy of nemorubicin The present invention relates to products and methods for characterizing cancer patients in order to predict therapeutic benefit with a drug metabolized by CYP3A, especially nemorubicin. ... 08/10/06 - 20060177880 - Use of prn3/ileu as a marker for colorectal cancer The present invention relates to the diagnosis of colorectal cancer. It discloses the use of protein PRN3/ILEU and/or unbound PRN3 in the diagnosis of colorectal cancer. It relates to a method for diagnosis of colorectal cancer from a liquid sample, derived from an individual by measuring PRN3/ILEU and/or unbound PRN3 ... 08/03/06 - 20060172352 - Nuclear matrix proteins Nuclear matrix proteins (NMP) which are characterized by a defined expression in tissue are provided. These NMPs are useful markers in diagnosing and monitoring the stage of malignancy of a cell and treating cell proliferative disorders associated with the NMP. Also provided are substantially purified polypeptides and nucleotide sequences encoding ... 08/03/06 - 20060172351 - Reagent for an immunoassay The present invention relates to (1) A reagent for an immunoassay of a target substance existing in a free form and a bound form in a specimen, comprising a latex 1 which is immobilized with a monoclonal antibody 1 for the target substance, and a latex 2 which has a ... 08/03/06 - 20060172350 - Adam-9 modulators The invention provides the identification and characterization of a disease and cancer-associated antigen, KID24. The invention also provides modulators of KID24, including a family of monoclonal antibodies that bind to antigen KID24, and methods of diagnosing and treating various human cancers and diseases associated with KID24. ... 08/03/06 - 20060172349 - Luca2 and antibodies that bind thereto The invention provides the identification and characterization of disease and cancer-associated antigen, LUCA2. The invention also provides a family of monoclonal antibodies that bind to antigen LUCA2, methods of diagnosing and treating various human cancers and diseases that express LUCA2. ... 08/03/06 - 20060172348 - Use of neuronal apoptosis inhibitor protein (naip) The invention provides a novel NAIP nucleic and sequences. Also provided are anti-NAIP antibodies and methods for modulating apoptosis and detecting compounds which modulate apoptosis. ... 08/03/06 - 20060172347 - Method of diagnosis, treatment and useful agents for conditions characterised by modulation in the level of activin ssc The present invention relates generally to a method of diagnosing, predicting or monitoring the development or progress of a condition characterised by modulation in the level of activin expression and, more particularly, a method of diagnosing, predicting or monitoring the development or progress of a condition characterised by modulation in ... 07/27/06 - 20060166294 - Apoptosis marker antibodies and methods of use Disclosed are antibodies that specifically recognize the new amino terminus of a protein cleaved by a protease during apoptosis. Methods of using and making the antibodies are also provided. The antibodies are particularly useful in methods of detecting apoptosis and testing candidate compounds for enhancing or inhibiting apoptosis. ... 07/27/06 - 20060166293 - Zinc alpha-2-glycoprotein as indicator of cancer The present invention relates, in general, to methods of diagnosing and monitoring cancer and inflammatory diseases/disorders and, in particular, to methods of diagnosing and monitoring cancer and inflammatory diseases/disorders that comprise assaying for elevated levels of zinc alpha-2-glycoprotein (ZAG) in serum and other body fluids. The invention also relates to ... 07/27/06 - 20060166292 - Methods of diagnosing and treating prostate cancer The invention provides for novel diagnostic methods for detecting prostate cancer. The invention also provides methods for determining the effectiveness of prostate cancer treatment. These methods take advantage of the finding that a cellular protein termed Beta Protein 1 (BP1) is expressed at elevated levels in prostate cancer tissue and ... 07/27/06 - 20060166291 - Kid31 and antibodies that bind thereto The invention provides the identification and characterization of disease and cancer-associated antigen, KID31. The invention also provides a family of monoclonal antibodies that bind to antigen KID31, methods of diagnosing and treating various human cancers and diseases that express KID31. ... 07/27/06 - 20060166290 - Primary central nervous system tumor specific behab isoforms The present invention comprises compositions and methods related to a glycosylation-variant BEHAB polypeptide, a poly-sialyated BEHAB polypeptide, and methods of use thereof. ... 07/27/06 - 20060166289 - Method for analyzing tumor agressivity comprising measurement of polymerized actin The invention concerns a method for analyzing tumor agressivity of cancer cells comprising measurement of the amount of stationary polymerized actin in a lysate of said cells. Advantageously, the measurement of the amount of stationary actin is carried out by fluorescence static polarization. ... 07/27/06 - 20060166288 - Assay for the screening of compounds acting through erbb-2 The invention provides a cellular proliferation assay for a compound acting through erbB-2 which comprises: i) a cell comprising erbB-2 and erbB-3 and said cell is responsive to ligand stimulated cell proliferation under conditions suitable for cell proliferation; ii) a first ligand which is a ligand for erbB-3 capable of ... 07/27/06 - 20060166287 - Method for identifying compounds for suppressing metastasizing tumor cells The present invention relates to a method for identifying compounds which suppress and/or delay the development of invasive or metastasizing tumor cells of the colon, of the pancreas, of the ovaries or of the thyroid. ... 07/20/06 - 20060160157 - Method, compositions and classification for tumor diagnostics and treatment The present invention is directed towards classifying tumor biomarkers, particularly membrane receptors, and more particularly the gastrin-releasing peptide (GPR) receptors, identified in patient samples, then linking therapeutic agents (chemical, radiological, or biological) to patient-specific ligands that bind to such receptors, clinicians can produce diagnostic and treatment compositions and implement treatment ... 07/20/06 - 20060160156 - Tears as a screening medium The present invention is directed to the use of surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF-MS) on tears of breast cancer patients. The present invention demonstrates the use of this highly sensitive and specific method to identify proteins and protein patterns in tears that show promise as a diagnostic indicator. ... 07/20/06 - 20060160155 - Serum levels of her2/neu as an indicator of clinical state and prognosis of prostate cancer The present invention relates to methods of diagnosing prostate cancer, predicting disease progression of prostate cancer, prognosing the stage and state of prostate cancer, and identifying appropriate treatment indication for prostate cancer patients. Methods encompass determining the levels of HER-2/neu in fluid biological samples (e.g., blood and serum) from patients. ... 07/20/06 - 20060160154 - Materials and methods for detection and treatment of breast cancer The invention provides a wide range of methods and compositions for detecting and treating breast cancer in an individual. Specifically, the invention provides target breast cancer-associated proteins, which permit a rapid detection, preferably before metastases occur, of breast cancer. The target breast cancer-associated protein may be detected, for example, by ... 07/13/06 - 20060154313 - Human b7 polypeptide b7-h3a This invention relates to B7-H3A, a new member of the human B7 polypeptide family, methods of making such polypeptides, and to methods of using them to treat immunological conditions and to identify compounds that alter B7-H3A polypeptide activities. ... 07/13/06 - 20060154312 - Tubulin isotype screening in cancer therapy using halichondrin b analogs Chemotherapeutic agents that interfere with microtubule assembly or disassembly in the cell are potent inhibitors of cell replication. Examples of such agents include halichondrin B analogs. It has been shown that the susceptibility of certain cancers to analogs of halichondrin B correlates with the expression of particular tubulin isotypes or ... 07/13/06 - 20060154311 - Novel bladder matrix protein peptides and methods of detection of bladder cancer Nuclear matrix proteins (NMP) which are characterized by a defined expression in tissue are provided. These NMPs are useful markers in diagnosing and monitoring the stage of malignancy of a cell and treating cell proliferative disorders associated with the NMP. Also provided are substantially purified polypeptides and polynucleotide sequences encoding ... 07/13/06 - 20060154310 - Diagnosis and therapy of cancer using sgp28-related molecules The present invention relates to methods and compositions for the diagnosis and therapy of prostate cancer which utilize isolated polynucleotides corresponding to the human SGP28 gene, proteins encoded by the SGP28 gene and fragments thereof, and antibodies capable of specifically recognizing and binding to SGP28 proteins. ... 07/13/06 - 20060154309 - Method of examining cancer cells and reagent therefor A method for examining cancer cells by which examination of cancer cells may be carried out simply and efficiently without using an expensive apparatus, and a reagent therefor are disclosed. In the method for examining cancer cells according to the present invention, cancer cells separated from the body, which cells ... 07/06/06 - 20060148014 - Tubulin isotype screening in cancer therapy using hemiasterlin analogs Chemotherapeutic agents that interfere with microtubule assembly or disassembly in the cell are potent inhibitors of cell replication. Examples of such agents include hemiasterlin analogs. It has been shown that the susceptibility of certain cancers to analogs of hemiasterlin correlates with the expression of particular tubulin isotypes or other microtubule-associated ... 07/06/06 - 20060148013 - Tumor marker and its use The invention provides a new kind of tumor marker RL9/RL10 protein, the polynucleotide encoding the polypeptide, and the method of producing RL9/RL10 protein by recombinant technology. The invention also discloses the use of RL9/RL10 protein and the polynucleotides encoding RL9/RL10 protein, e.g., in diagnosing and treating tumor, as well as ... 07/06/06 - 20060148012 - Assay for identifying antibody producing cells The present invention provides a homogeneous assay for identifying an antibody producing cell producing an antibody which binds to a selected antigen comprising: a) providing a population of antibody producing cells; b) incubating said population of antibody producing cells with a selected antigen and a labeled anti-antibody antibody, wherein said ... 07/06/06 - 20060148011 - Early prostate cancer antigens (epca), polynucleotide sequences encoding them, and their use A novel prostate cancer marker is described that is found in cancerous and normal prostate cells of individuals that have prostate cancer but is not found in the prostate of individuals without prostate cancer. The marker also is present in normal tissue adjacent to tumor tissue in individuals having prostate ... 06/29/06 - 20060141545 - Cancer treatment kits using antibodies to aminophospholipids Disclosed are the surprising discoveries that aminophospholipids, such as phosphatidylserine and phosphatidylethanolamine, are stable and specific markers accessible on the luminal surface of tumor blood vessels, and that the administration of an anti-aminophospholipid antibody alone is sufficient to induce thrombosis, tumor necrosis and tumor regression in vivo. This invention therefore ... 06/29/06 - 20060141544 - Compositions for binding to assay substrata and methods of using Compositions and methods for binding to assay substrata in a stable and protective manner, thereby enhancing assay performance, are provided. The compositions comprise lyotropic materials (for example, lyotropic liquid and/or liquid crystalline materials) and may contain macromolecular standards, markers or capture compounds. The compositions are capable of binding to assay ... 06/29/06 - 20060141543 - Cellular retinoic acid binding protein ii as a marker for breast cancer The present invention relates to the diagnosis of breast cancer. It discloses the use of protein cellular retinoic acid binding protein II in the diagnosis of breast cancer. It relates to a method for diagnosis of breast cancer from a liquid sample, derived from an individual by measuring cellular retinoic ... 06/22/06 - 20060134709 - Engineering fc antibody regions to confer effector function The present invention relates to molecules having a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region. These modified molecules confer an effector function to a molecule, where the parent molecule does not detectably exhibit this effector function. ... 06/22/06 - 20060134708 - Detection and treatment of renal cancer The present invention relates to compositions and methods for cancer therapies and diagnostics, including but not limited to, cancer markers. In particular, the present invention provides cancer markers associated with specific cancers and diagnostic assays for the detection of such markers as indicative of the presence of kidney and urothelial ... 06/15/06 - 20060127958 - Immunoassay for the detection of cancer The present invention relates to a broad cancer immunoassay. Specifically, an immunoassay for peptides associated with oncogenic processes such as metastatic proteolysis is disclosed. In an illustrative embodiment, the immunoassay utilizes antibodies which bind to peptides which are generated by proteolytic processes and which contain epitopes which are masked in ... 06/15/06 - 20060127957 - Novel biologicalcancer marker and methods for determining the cancerous or non-cancerous phenotype of cells The present invention relates to the use of the frequency value of filopodia generation in a sample cell population as a biological marker for determining the cancerous, metastatic cancerous or normal phenotype of said cell population. It also relates to a method for determining in vitro the cancerous, metastatic cancerous ... 06/08/06 - 20060121542 - Insulin-like growth factor system and cancer Method of monitoring or diagnosing disease conditions, including disease of the prostrate, that involve measuring a combination of tumor markers and at least one component of the IGF axis. The invention is exemplified with prostate cancer and benign prostrate hyperplasia, the tumor marker prostate specific antigen and the insulin-like growth ... 06/08/06 - 20060121541 - Use of endosialin binding proteins to isolate endosialin positive cells Monoclonal antibodies and other proteins that specifically bind to cells positive for endosialin are provided. The antibodies and proteins are useful in the isolation of endosialin-positive cells, particularly cells associated with neovascularization associated with cancer and neovascular disease. The invention is also related to cells that are isolated using monoclonal ... 06/08/06 - 20060121540 - Use of protein masp as a marker for colorectal cancer The present invention relates to the diagnosis of colorectal cancer. It discloses the use of protein MASP in the diagnosis of colorectal cancer. It relates to a method for diagnosis of colorectal cancer from a liquid sample, derived from an individual by measuring MASP in said sample. Measurement of MASP ... 06/08/06 - 20060121539 - Eph receptor tumor biomarkers Specific, differential expression of EphA2 in both GBM cells and human GBM tumors compared to normal brain are shown. EphA2 serves as a useful molecular marker for cancer in such areas as diagnosis and prognosis. In addition, EphA2 is used in the development of new therapeutics for tumors, such as ... 06/08/06 - 20060121538 - Peptides having affinity for the gp120 viral protein and use thereof The present invention relates to a family of peptides exhibiting high affinity and specificity for the viral protein gp120, to methods for producing these peptides, and to the use of these peptides. ... 06/01/06 - 20060115862 - Anti-tenascin monoclonal antibody immunoassays and diagnostic kits The present invention provides immunoassays for detecting a tumor in a subject, comprising producing an antibody that specifically binds to tenascin, contacting the antibody with a biological sample suspected of containing tumor cells and determining the binding of the antibody to the biological sample. The present invention further provides methods ... 05/25/06 - 20060110779 - Method for detecting a lectin-like substance The present invention provides a method for detecting lectin-like substances, which comprises the steps of (a) providing a first carbohydrate molecule and a test target, wherein the first carbohydrate molecule specifically binds to the lectin-like substance to be detected; (b) contacting the test target with the first carbohydrate molecule so ... 05/18/06 - 20060105405 - Migration inhibitory factor in serum as a tumor marker for prostate, bladder, breast, ovarian, kidney, pancreatic and lung cancer and for diagnosis of endometriosis Macrophage migration inhibitory factor (MIF) has been found to be overexpressed in blood of individuals having various cancers, including prostate, PIN, lung, breast, ovary, kidney, pancreatic and bladder, as well as inflammatory diseases and endometriosis. Normal levels of MIF in serum of males and females without these cancers have been ... 05/18/06 - 20060105404 - Fluorescence polarization assay for determining histidine decarboxylase activity A fluorescence polarization assay for determining the HDC modulating activity of a candidate compound comprising the steps of: a) providing a reaction mixture comprising a HDC, histidine, a fluorescently labeled histamine probe, a candidate compound and an anti histamine antibody having selectivity for histamine at least 10 fold greater than ... 05/18/06 - 20060105403 - Braca1/acc alpha molecular complexes, diagnostic and therapeutic applications The invention concerns a molecular complex comprising: a first polypeptide including the sequence of amino acids 1640 to 1863 the human BRCA1 protein or a similar sequence of amino acids of the protein BRCA1 in another animal species, and a second polypeptide including a fragment of the ACC-α protein capable ... 05/11/06 - 20060099659 - Method to detect ige The present invention includes a method to detect IgE using a human Fc epsilon receptor (FcεR) to detect IgE antibodies in a biological sample from a cat, a dog, or a horse. The present invention also relates to kits to perform such methods. ... 05/11/06 - 20060099658 - Pca3, pca3 genes, and methods of use The present invention relates, in general, to a prostate-specific antigen, PCA3. In particular, the present invention relates to nucleic acid molecules coding for the PCA3 protein; purified PCA3 proteins and polypeptides; recombinant nucleic acid molecules; cells containing the recombinant nucleic acid molecules; antibodies having binding affinity specifically to PCA3 proteins ... 05/11/06 - 20060099657 - Antibodies to a polypeptide encoded by a nucleic acid underexpressed in melanoma The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid sequences, chimeric polypeptide molecules comprising the polypeptides of the present invention fused to heterologous polypeptide sequences, antibodies which bind to the polypeptides ... 05/04/06 - 20060094069 - Tumour marker proteins and uses thereof The invention relates to tumour marker proteins and their preparation from fluids from one or more cancer patients, wherein said fluids are those which collect in a body cavity or space which is naturally occurring or which is the result of cancer or medical intervention for cancer. The invention also ... 05/04/06 - 20060094068 - Predictive markers in cancer therapy Molecular markers useful in medicine response tests are provided, as an aid in determining whether an individual subject s tumor is responding to treatment with EGF and/or erbB2 inhibitors. Markers include phosphorylated ERK protein ... 05/04/06 - 20060094067 - Method for the determination of characteristics and/or the classification of circulating macrophages, and analysis arrangement for carrying out said method The invention relates to a method and an analysis arrangement for the determination of characteristics and/or classification of circulating macrophages. A whole blood sample is subjected to a gradient centrifugation for isolating macrophages. The macrophage cells are then perforated and provided with an intracellular staining with at least one selected ... 04/27/06 - 20060088894 - Prostate cancer biomarkers Protein biomarkers that may advantageously be utilized in diagnosing prostate cancer, benign prostate hyperplasia or to make a negative diagnosis are described. Accordingly, in one aspect of the invention, methods for aiding in, or otherwise making, a diagnosis of prostate cancer or benign prostate hyperplasia are provided. In one form ... 04/27/06 - 20060088893 - Prostate cancer therapeutics and diagnostics based on conformers of prostatic cid phosphatase The signals that determine important characteristics of prostate cancer, such as loss of dependence on androgens are described. A key protein, prostatic acid phosphatase, is shown to fold in different ways in response to cellular signals, and the conformer “mix” of this protein in prostatic cells may represent a fundamental ... 04/20/06 - 20060084126 - Migration inhibitory factor in serum as a tumor marker for prostate, bladder, breast, ovarian, kidney and lung cancer Macrophage migration inhibitory factor (MIF) has been found to be overexpressed in blood of individuals having various cancers, including prostate, PIN, lung, breast, ovary, kidney and bladder. Normal levels of MIF in serum of males and females without these cancers have been quantified via immunoassay. MIF can be used as ... 04/20/06 - 20060084125 - Methods, devices, and systems for detection of cancer Disclosed are methods, devices, and systems for early detection of cancer. The cancer may be a glandular cancer, such as breast cancer or prostate cancer. A gland may be made to secrete fluids such that the fluids carry malignant cells that are excreted from the gland or that may be ... 04/20/06 - 20060084124 - Localization of a2b ador on human normal and diseased tissue: the use of anti-a2b antibody to diagnose and treat human tumors The invention provides methods of detection, prevention, amelioration, and treatment for angiogenesis, including angiogenesis associated with colon cancer and glioma. The methods comprise the use of an anti-A2B antibody. ... 04/20/06 - 20060084123 - Mn and hypoxia The MN/CA IX protein is identified herein as a hypoxia marker. The MN/CA9 gene promoter is characterized, and the location of the HIF-1 binding site within the MN/CA9 promoter is identified. Further, the hypoxia inducibility of the MN/CA9 gene and the uses of such inducibility are disclosed. In one aspect, ... 04/20/06 - 20060084122 - Method of judging leukemia, pre-leukemia or aleukemic malignant blood disease and diagnostic therefor The present invention relates to a method for diagnosing leukemia, pre-leukemia or aleukemic malignant blood diseases, a method of discriminating leukemia from pre-leukemia or aleukemic malignant blood diseases, a method of discriminating aplastic anemia from myelodysplastic syndrome, a method of diagnosing delayed engraftment of the hematopoietic stem cells after transplantation ... 04/06/06 - 20060073529 - Luciferyl peptide substrate Provided are luciferyl peptide substrates that are produced by attaching specifically prepared peptide conjugates to luciferin, and/or its analogs and derivatives. The luciferyl peptide substrates are incapable of penetrating cell membranes and tissue barriers. Cleavage of the peptide conjugates from the luciferyl peptide substrates releases the luciferin, which upon contact ... 04/06/06 - 20060073528 - Measurement methods The invention relates to methods for measuring unconjugated molecules, e.g. antibodies, in a mixture that also includes conjugated molecules, e.g. antibodies. ... 04/06/06 - 20060073527 - Using plasma proteomic pattern for diagnosis, classification, prediction of response to therapy and clinical behavior, stratification of therapy, and monitoring disease in hematologic malignancies The present invention demonstrates that the diagnosis and prediction of clinical behavior in patients with hematologic malignancies, such as leukemia, can be accomplished by analysis of proteins present in a plasma sample. Thus, in particular embodiments the present invention uses plasma to create a diagnostic or prognostic protein profile of ... 04/06/06 - 20060073526 - Antibodies, assay method by using them and judgment method for pancreas cancer An antibody which specifically binds to carboxypeptidase A1 (CPA1) and procarboxypeptidase A1 (PCPA1), an antibody which specifically binds to carboxypeptidase A2 (CPA2) and procarboxypeptidase A2 (PCPA2), an antibody which specifically binds to PCPA1, and an antibody which specifically binds to PCPA2, and a hybridoma which produces a monoclonal antibody thereof, ... 04/06/06 - 20060073525 - Methods for detecting breast and ovarian cancer Kallikrein 5 constitutes a novel biomarker for diagnosis, treatment and monitoring of breast and ovarian cancer. A method is provided for diagnosing and monitoring breast or ovarian cancer or a predisposition to breast or ovarian cancer, in a subject comprising detecting kallikrein 5 in a sample from the subject. Imaging ... 03/30/06 - 20060068453 - Survivin, a protein that inhibits cellular apoptosis, and its modulation The present invention provides the amino acid of a protein that inhibits cellular apoptosis, herein termed the Survivin protein and nucleic acid molecules that encode Survivin. Based on this disclosure, the present invention provides isolated Survivin protein, isolated Survivin encoding nucleic acid molecules, methods of isolating other members of the ... 03/30/06 - 20060068452 - Differential protein expression patterns related to disease states The present invention is a method for determining protein expression profiles in disease or an altered biological state. The method is based on the use of two-dimensional (2D) gel electrophoresis where the gel images are assigned two different colors. The gels are then compared by an overlay procedure that allows ... 03/23/06 - 20060063215 - Human gak-related gene variants associated with lung cancer The invention relates to the nucleic acid and polypeptide sequences of two novel human GAK-related gene variants. The invention also relates to the process for producing the polypeptides of the variants. The invention further relates to the use of the nucleic acid and polypeptide sequences of the gene variants in ... 03/23/06 - 20060063214 - Methods and compositions for diagnosing neoplastic disease Methods and compositions for determining whether a subject at least has a neoplastic disease are provided. In practicing the subject methods, a sample from a subject is assayed for a soluble filamin analyte, such as a filamin A analyte, to determine whether the subject at least has the neoplastic disease. ... 03/16/06 - 20060057652 - Methods for identifying therapeutic agents and for treating disease Included are methods of identifying compounds that mimic the interaction of Apoptin and APC1, e.g., binding of Apoptin to APC1, e.g., dissociation of APC1 from the APC/C, and compounds identified by the methods. Compounds that specifically mimic an interaction of Apoptin and APC1, e.g., cause dissociation of APC1 from the ... 03/16/06 - 20060057651 - Polypeptides and antibodies derived from chronic lymphocytic leukemia cells and uses thereof Small animal models for assessing immunomodulatory effects of compounds are provided. ... 03/16/06 - 20060057650 - Method for the immunocytological or molecular detection of disseminated tumor cells from a body fluid and kit that is suitable therefor The invention relates to a method for enriching tumor cells from a body fluid, in which a cell separation medium of a specific density is overlaid with the body fluid and it is subsequently determined whether the enriched cells express an epithelial marker, for example a cytokeratin. A kit suitable ... 03/16/06 - 20060057649 - Screening method and anti-tumor drug candidate obtained therefrom A method for identifying a test compound that has an anti-tumoral effect whilst not significantly activating unrelated transduction signals, the method comprising the steps of: (a) selecting at least one test compound; (b) assaying the compound for anti-tumoral effect; (c) selecting at least one distinct intracellular event which is modulated, ... 03/09/06 - 20060051819 - Detection, evaluation and treatment for advanced prostate cancer The present invention includes novel compositions, methods and systems for detecting, evaluating and inhibiting the proliferation of prostate cancer cells by detecting and inhibiting the expression and activity of the proteoglycan Perlecan. ... 03/09/06 - 20060051818 - Method for ngf assay for in vitro diagnosis of breast cancer and therapeutic use The present invention concerns a method for the in vitro diagnosis of breast cancer which consists in determining the presence of NGF in a biological sample derived from a patient suspected of suffering from breast cancer. Said method may be used both in early diagnosis, screening, therapeutic follow-up and prognosis, ... 03/09/06 - 20060051817 - Method for diagnosing neoplasms Disclosed are uses of Gangliosides GM1 and/or asialo-GM1 substances simulating the carbohydrate portion of said gangliosides with regard to bonding to anti-GM1 antibodies and/or anti-ADM1 antibodies for producing agents which bind or block anti-GM1 antibodies and/or anti-AGM1 antibodies which bond to natural killer cells (NKC) or for blocking antigen-presenting cells ... 02/23/06 - 20060040331 - Methods of screening apoptosis modulating compounds, compounds identified by said methods and use of said compounds as therapeutic agents A method of screening cellular polypeptides for pro-apoptotic or anti-apoptotic activity in a cell of a particular cell-type, said method comprising: (a) culturing cells of said particular cell-type under non apoptotic conditions and culturing cells of said particular cell-type under apoptotic conditions, and (b) determining subcellular localisation of said cellular ... 02/23/06 - 20060040330 - Method of cancer screening Erythrocyte sedimentation rate (“ESR”) determinations of a patient's blood that has been combined either with blood serum from pregnant mammals or with fetal embryonic serum yield measurable results correlating well with the presence of an on-going cancer. This cancer detection method based on differential ESR determinations consists of paired in ... 02/16/06 - 20060035292 - Differential diagnosis of cancer and other conditions based on expression of p63 This invention relates to methods of distinguishing among various types of differentiated and undifferentiated epithelial carcinomas, and non-epithelial carcinomas, by detecting the presence of p63 nucleic acid or protein expression. The invention also provides methods for detecting p63 nucleic acids and proteins, as well as methods for diagnosing and treating ... 02/16/06 - 20060035291 - Method of detecting cellular immunity and application thereof to drugs It is intended to provide a convenient immunity monitoring system whereby T cell frequencies specific to a plural number of antigen peptides can be assayed by using a relatively small amount of blood. Peripheral monocytes are collected and frequently stimulated with an antigen without directly using any antigen presenting cells. ... 02/09/06 - 20060029989 - Targeting cells having mad2 mutation for treatment and/or prevention of disease The present invention relates to composition and methods of identifying one or more secondary drug targets and their use in the identification of drugs or drug candidates, particularly for the treatment of cancer or cell replication disorders. The yeast-based synthetic lethal screens are used to functionally identify and validate new ... 02/09/06 - 20060029988 - Method and compositions for treating diseases targeting e-cadherin Methods and compositions for diagnosing, detecting and treating a pancreatic disease associated with differential expression of E-cadherin in comparison to healthy cells. Also provided are antagonists or agonists of E-cadherin, and methods for screening agents that modulate the E-cadherin level or activity in vivo or in vitro. ... 02/09/06 - 20060029987 - Diagnosis of pancreatic cancer by using pancreatic targets Methods and compositions for diagnosing, detecting a pancreatic disease associated with differential expression of PCATs (e.g., CD49b, CD51, CD71 and E-Cadherin) in comparison to healthy cells. ... 01/26/06 - 20060019322 - Compositions and methods relating to prostate specific genes and proteins The present invention relates to newly identified nucleic acids and polypeptides present in normal and neoplastic prostate cells, including fragments, variants and derivatives of the nucleic acids and polypeptides. The present invention also relates to antibodies to the polypeptides of the invention, as well as agonists and antagonists of the ... 01/26/06 - 20060019321 - Planar optical waveguide based sandwich assay sensors and processes for the detection of biological targets including early detection of cancers An assay element is described including recognition ligands adapted for binding to carcinoembryonic antigen (CEA) bound to a film on a single mode planar optical waveguide, the film from the group of a membrane, a polymerized bilayer membrane, and a self-assembled monolayer containing polyethylene glycol or polypropylene glycol groups therein ... 01/26/06 - 20060019320 - Wnt mediated erbb signalling, compositions and uses related thereto The present invention makes available assays and reagents inhibiting ErbB signals produced by Wnt protein comprising contacting a cell expressing ErbB and Wnt receptor (Frizzled) with a Wnt antagonist in a sufficient amount to reduce the sensitivity of the cell to ErbB signaling. ... 01/19/06 - 20060014225 - Vimentin directed diagnostics and therapeutics for multidrug resistant neoplastic disease Disclosed are methods for treating or preventing a neoplastic or a multidrug resistant neoplasm in a subject using cell surface vimentin targeted therapeutic. ... 01/19/06 - 20060014224 - Method for detecting, screening and/or monitoring a cancer in an individual The invention relates to a method for screening and/or detecting and/or monitoring a cancer in an individual, said method comprising determining a first parameter represented by the concentration of TIMP-1 in at least one excreta, e.g. saliva, from the individual. The invention provides a method that without the need to ... 01/19/06 - 20060014223 - Method for diagnosing cancer by detecting gpc3 Provided is a method for diagnosing cancer by detecting a novel cancer marker. Cancer can be diagnosed by detecting soluble glypican 3 in a test sample. ... 01/19/06 - 20060014222 - Antibodies The use of an ScFv Ab (ScFv Ab) capable of recognising a disease associated molecule (DAM) in the manufacture of a medicament for the prevention and/or treatment of a disease condition associated with a DAM is described. The ScFv Ab has therapeutic, diagnostic and prognostic applications. ... 01/12/06 - 20060008858 - Osteoblast factor(s) that regulates human prostate cancer migration to and invasion of bone Human osteogenic cells secrete biological activities that stimulate cancer cells to migrate to and/or invade tissues. Conditioned medium (CM) produced by human pre-osteoblasts and osteoblasts induced migration and tissue invasion of human prostate cancer cells. Thus, conditioned media and/or proteins isolated therefrom may be used to identify metastasis-inducing factors. Also ... 01/12/06 - 20060008857 - Cap-binding protein A novel polypeptide which is useful in screening of an agent for improving insulin resistance and an agent for improving glucose metabolism, a polynucleotide encoding the polypeptide, an expression vector comprising the polynucleotide, and a cell transformed with the expression vector are disclosed. The polypeptide is a protein expressed in ... 01/05/06 - 20060003391 - Reagents and methods for use in cancer diagnosis, classification and therapy Methods and reagents for classifying tumors and for identifying new tumor classes and subclasses. Methods for correlating tumor class or subclass with therapeutic regimen or outcome, for identifying appropriate (new or known) therapies for particular classes or subclasses, and for predicting outcomes based on class or subclass. New therapeutic agents ... 12/29/05 - 20050287611 - |