REGISTER now for FREE 
|
FREE patent keyword monitoring and additional FREE benefits. REGISTER now for FREE
|
|
|
Drug, Bio-affecting And Body Treating Compositions > Immunoglobulin, Antiserum, Antibody, Or Antibody Fragment, Except Conjugate Or Complex Of The Same With Nonimmunoglobulin Material > Monoclonal Antibody Or Fragment Thereof (i.e., Produced By Any Cloning Technology) > Binds Eukaryotic Cell Or Component Thereof Or Substance Produced By Said Eukaryotic Cell > Cancer Cell Cancer CellCancer Cell patent applications listed are from June 2005 to current and include Date, Patent Application Number, Patent Title, Patent Abstract summary and are linked to the corresponding patent application page.08/02/07 - 20070178108 - Colon specific gene and protein and cancer Human Colon Specific Polynucleotides (DNA and RNA), Polypeptides, and Antibodies, as well as methods for using and producing such polynucleotides, polypeptides, and antibodies are disclosed. More particularly, methods are disclosed for utilizing such polynucleotides, polypeptides, and antibodies to detect, diagnose, prevent, treat, and/or ameliorate cancer (particularly gastrointestinal tract cancers such ... 08/02/07 - 20070178106 - Compositions and methods for enhancing nk cell activity The present invention relates to methods of treating malignancies and infections, methods of identifying patients suitable for treatment or for inclusion in clinical trials, and methods of producing antibodies for use in therapeutic applications. Generally, the present methods involve the use of antibodies that target activating receptors present on the ... 08/02/07 - 20070178105 - Fhit proteins and nucleic acids and methods based thereon The present invention relates to nucleotide sequences of FHIT genes and amino acid sequences of their encoded proteins, as well as derivatives and analogs thereof, and antibodies thereto. The FHIT gene sequence is mutated in diseases involving cell overproliferation, particularly malignancies of the digestive tract. The present invention further relates ... 08/02/07 - 20070178104 - Methods and means for treating solid tumors The present invention relates to method and means for treating a vascularized solid tumor using a number of, in vitro prepared, anticellular agent(s)-carrying blood platelets to induce a thrombus formation within the tumor vasculature, and at the same time to deliver a high concentration of an anticellular agent within the ... 08/02/07 - 20070178103 - Cd19-specific immunotoxin and treatment method An immunotoxin for use in, and a method for treating a subject having a cancer associated with malignant B-lineage cells or an autoimmune condition, are disclosed. The immunotoxin includes (a) an anti-CD19 antibody lacking an Fc fragment, (b) a modified exotoxin A protein having both Domains II and III, but ... 08/02/07 - 20070178102 - Methods of identifying combinations of antibodies with an improved anti-tumor activity and compositions and methods using the antibodies A method of identifying a combination of antibodies with a combined improved anti tumor activity is provided. The method comprising identifying at least two anti RTK antibodies capable of inducing synergistic endocytosis of the RTK in a cell expressing the RTK, thereby identifying the combination of antibodies with the combined ... 08/02/07 - 20070178101 - Ovr110 antibody compositions and methods of use The invention provides isolated anti-ovarian, pancreatic, lung or breast cancer antigen (Ovr110) antibodies that internalize upon binding to Ovr110 on a mammalian in vivo. The invention also encompasses compositions comprising an anti-Ovr110 antibody and a carrier. These compositions can be provided in an article of manufacture or a kit. Another ... 07/26/07 - 20070172488 - Cell growth inhibitors containing anti-glypican 3 antibody Provided is a cell growth inhibitor that can be used for treating diseases based on abnormal cell proliferation, and in particular cancer. The cell growth inhibitor contains an anti-glypican 3 antibody as an active ingredient. ... 07/26/07 - 20070172487 - Alpha-enolase specific antibody and method of use This invention relates to a method of monitoring cancer development by determining the abundance of alpha-enolase protein wherein increased abundance is an indication of the severity of cancer. In another embodiment, the invention relates to a method of detecting cancer malignancy by determining the abundance of alpha-enolase antibodies in a ... 07/26/07 - 20070172486 - Expression of cyclin g1 in tumors A method of treating a tumor (in particular osteosarcoma or Ewing's sarcoma) in a host by administering to a host or to the tumor cells an agent which inhibits cyclin G1 protein in an amount effective to inhibit cyclin G1 protein in tumor cells of the host. The agent may ... 07/26/07 - 20070172485 - Glycopeptides derived from pancreatic structures, antibodies and applications thereof in diagnostics and therapeutics The invention relates to a glycopeptide comprising between 1 and 40 repeated C-terminal polypeptides, with 11 amino acids, of BSDL or FAPP, whereby the aforementioned polypeptides are glycosylated and bear glycosylated epitopes giving rise to a specific immunological reaction with induced antibodies in a patient suffering from type 1 diabetes, ... 07/19/07 - 20070166314 - Epa2 monoclonal antibodies and methods of use thereof The present invention relates to methods and compositions designed for the treatment, management, or prevention of cancer, particularly, metastatic cancer. In one embodiment, the methods of the invention comprise the administration of an effective amount of an antibody that binds to EphA2 and agonizes EphA2, thereby increasing EphA2 phosphorylation and ... 07/19/07 - 20070166313 - Administration of gamma globulins to treat cancer This invention relates to cancer therapy and in particular to the administration of gamma globulins to inhibit both primary tumor and metastasis and augment treatment of primary cancerous tumors. In accordance with this invention, the treatment of various cancerous diseases is accomplished by administering a preparation containing intact gamma globulins ... 07/19/07 - 20070166312 - Antibody against tumor specific antigen as target The present invention relates to a method of detecting cancer by use of an oncogene, a method of screening for an active compound useful to treat and/or prevent cancer, and a pharmaceutical composition for treatment and/or prevention of cancer. More specifically, the present invention provides a method of detecting cancer ... 07/12/07 - 20070160619 - Ctla-4 antibody dosage escalation regimens A disease or condition, such as cancer or an infectious disease, can be treated in a patient by administering a CTLA-4 antibody in an escalating dosage regimen until a partial or complete response is elicited in the patient or a predetermined maximum dosage is reached. ... 07/12/07 - 20070160618 - Cardiotrophin-1 compositions and methods for the treatment of tumor The invention concerns compositions and methods for the diagnosis and treatment of neoplastic cell growth and proliferation in mammals, including humans. The invention is based on the identification of cardiotrophin-1 gene amplified in the genome of tumor cells. Such gene amplification is expected to be associated with the overexpression of ... 07/12/07 - 20070160617 - Psma antibody-drug conjugates This invention relates generally to antibody-drug conjugates (ADCs). In particular, the invention relates to ADCs which comprise an antibody or antigen-binding fragment thereof which binds to prostate-specific membrane antigen (PSMA) and is conjugated to monomethylauristatin norephedrine or monomethylauristatin phenylalanine. The antibody-drug conjugate has a PC-3™ cell to C4-2 or LNCaP™ ... 07/05/07 - 20070154483 - Treatment with anti-vegf antibodies This invention concerns in general treatment of diseases and pathological conditions with anti-VEGF antibodies. More specifically, the invention concerns the treatment of human patients susceptible to or diagnosed with cancer using an anti-VEGF antibody, preferably in combination with one or more additional anti-tumor therapeutic agents. ... 06/28/07 - 20070148179 - Gankyrin Gankyrin having the amino acid sequence as set forth in SEQ ID NO: 2, or modified gankyrin comprising an amino acid sequence modified by the deletion and/or addition of one or a plurality of amino acids and/or the substitution with other amino acids in the amino acid sequence of SEQ ... 06/28/07 - 20070148178 - Treatment with anti-vegf antibodies This invention concerns in general treatment of diseases and pathological conditions with anti-VEGF antibodies. More specifically, the invention concerns the treatment of human patients susceptible to or diagnosed with cancer using an anti-VEGF antibody, preferably in combination with one or more additional anti-tumor therapeutic agents. ... 06/28/07 - 20070148177 - Treatment with anti-vegf antibodies This invention concerns in general treatment of diseases and pathological conditions with anti-VEGF antibodies. More specifically, the invention concerns the treatment of human patients susceptible to or diagnosed with cancer using an anti-VEGF antibody, preferably in combination with one or more additional anti-tumor therapeutic agents. ... 06/28/07 - 20070148176 - Isolation of five novel genes coding for new fc receptors-type melanoma involved in the pathogenesis of lymphoma/melanoma This invention provides an isolated nucleic acid molecule which encodes immunoglobulin receptor, Immunoglobulin superfamily Receptor Translocation Associated, IRTA, protein. Provided too, are the IRTA proteins encoded by the isolated nucleic acid molecules, IRTA1, IRTA2, IRTA3, IRTA4 or IRTA5 proteins, having the amino acid sequences set forth in any of FIGS. ... 06/28/07 - 20070148175 - Diagnostics and therapeutics for diseases associated with kallikrein 12 (klk12) The invention provides a human KLK12 which is associated with the gastrointestinal and liver diseases, cancer disorders, hematological diseases, inflammatory diseases, respiratory diseases, neurological disorders, cardiovascular disorders, reproduction disorders and urological disorders. The invention also provides assays for the identification of compounds useful in the treatment or prevention of gastrointestinal ... 06/21/07 - 20070141069 - Method for use of igf-binding protein for selective sensitization of target cells in vivo New methods for the treatment of human disease are provided. IGFBP-3 is administered together with a co-administered agent to subjects having disease, thereby alleviating the symptoms of the disease, under conditions where administration of IGFBP-3 alone at the maximum practicable dose has no measurable beneficial effect on the disease condition. ... 06/21/07 - 20070141068 - Methods for the treatment of carcinoma The invention concerns compositions and methods for the diagnosis and treatment of neoplastic cell growth and proliferation in mammals, including humans. The invention is based upon the identification of genes that are amplified in the genome of tumor cells, such as renal cell carcinoma. Such gene amplification is expected to ... 06/21/07 - 20070141067 - Targeted cancer therapy Methods and compositions are described for determining the expression profile of a tumor and subsequently determining an appropriate cancer therapy. Accordingly, a database can correlate expression profile data of a particular tumor before a chemotherapeutic is administered, and after the chemotherapeutic is administered and after tumor progression, such as when ... 06/21/07 - 20070141066 - Method for diagnosing, prognosing and treating glioma The invention provides generally a method of monitoring, diagnosing, prognosing and treating glioma. Specifically, the invention provides for three (3) prognostic subclasses of glioma, which are differentially associated with activation of the akt and notch signaling pathways. Tumor displaying neural or proneural PN lineage markers (including notch pathway elements) show ... 06/21/07 - 20070141065 - Anti-vegf antibodies Anti-VEGF antibodies and variants thereof, including those having high affinity for binding to VEGF, are disclosed. Also provided are methods of using phage display technology with naive libraries to generate and select the anti-VEGF antibodies with desired binding and other biological activities. Further contemplated are uses of the antibodies in ... 06/21/07 - 20070141064 - Fully human hybridoma fusion partner cell lines Certain aspects of the present invention are directed to new fully human fusion partner cell lines called human Karyochi cells, and to methods for making them. Human Karyochi cells are then fused with human antibody-secreting lymphoid cells to make fully human hybridomas called Karyochi-based hybridomas, which likewise secrete fully human ... 06/21/07 - 20070141063 - Peptide having ability to activate cancer-related gene To provide a cancer diagnostic reagent for determining malignancy of a cancer patient or a cancer cell and a tendency of canceration of a healthy subject, the reagent including a peptide having an ability to activate a cancer-related gene and extracted from cell membrane surfaces of human squamous-cell carcinoma cells ... 06/21/07 - 20070141062 - Control of proliferation and apoptosis in cancer cells The invention includes a method of inhibiting or reducing cellular proliferation through the use of one or more agents that prevent the association or interaction of pp32 polypeptides with the hyperphosphorylated form of Retinoblastoma protein. The invention also discloses agents that are useful in preventing the association or interaction of ... 06/21/07 - 20070141061 - Protein involved in carcinoma The present invention provides a polypeptide, MAL2, of use in the treatment and/or prophylaxis of carcinoma, in particular liver cancer, stomach cancer and/or colon cancer. Also provided are agents which interact with or modulate the expression or activity of the polypeptide, methods for the identification of such agents and the ... 06/14/07 - 20070134254 - Epha2 agonistic monoclonal antibodies and methods of use thereof The present invention relates to methods and compositions designed for the treatment, management, or prevention of cancer, particularly, metastatic cancer. The methods of the invention comprise the administration of an effective amount of one or more antibodies that bind to and agonize EphA2, thereby increasing EphA2 phosphorylation and decreasing EphA2 ... 06/14/07 - 20070134253 - Novel serpentine transmembrane antigens expressed in human cancers and uses thereof Described is a novel family of cell surface serpentine transmembrane antigens. Two of the proteins in this family are exclusively or predominantly expressed in the prostate, as well as in prostate cancer, and thus members of this family have been termed “STEAP” (Six Transmembrane Epithelial Antigen of the Prostate). Four ... 06/14/07 - 20070134252 - Method for predicting response to epidermal growth factor receptor-directed therapy This invention provides methods for determining or predicting response to cancer therapy in an individual. ... 06/14/07 - 20070134251 - Assays and methods using biomarkers Methods and assays examining expression of one or more biomarkers in a mammalian tissue or cell sample are provided. According to the disclosed methods and assays, detection of the expression of one or more such biomarkers is predictive or indicative that the tissue or cell sample will be sensitive to ... 06/14/07 - 20070134250 - Composition comprising and method of using angiopoietin-like protein 3 angptl3 The present invention is directed to methods and means for making and using Angpt13 polypeptides. The invention specifically concerns the use of Angpt13 polypeptides in inducing liver regeneration and angiogenesis. Further methods include the use of Angpt13 polypeptides in the diagnosis and treatment of liver disease. Also provided herein are ... 06/14/07 - 20070134249 - Combination therapy and antibody panels The present invention provides combination immunotherapy for Non-Hodgkin's Lymphoma. In one embodiment, the combination immunotherapy first provides for the administration of a monoclonal antibody directed to a non-idotypic portion of a lymphoma cell surface immunoglobulin (e.g. a framework region of a variable region). The combination immunotherapy next provides for the ... 06/14/07 - 20070134248 - Combination therapy and antibody panels The present invention provides combination immunotherapy for Non-Hodgkin's Lymphoma. In one embodiment, the combination immunotherapy first provides for the administration of a monoclonal antibody directed to a non-idotypic portion of a lymphoma cell surface immunoglobulin (e.g. a framework region of a variable region). The combination immunotherapy next provides for the ... 06/07/07 - 20070128204 - Methods and compositions for inducing apoptosis in cancer cells Anti-DR5 antibody agonists, combined with apoptosis-inducing agents, synergistically induce apoptosis in cancer cells. ... 06/07/07 - 20070128203 - Anti-integrin antibodies, compositions, methods and uses The present invention relates to at least one novel anti-alpha-V subunit antibodies, including isolated nucleic acids that encode at least one anti-alpha-V subunit antibody, alpha-V subunit, vectors, host cells, transgenic animals or plants, and methods of making and using thereof, including therapeutic compositions, methods and devices. ... 06/07/07 - 20070128202 - Antibodies that bind to cancer-associated antigen cd46 and methods of use thereof Provided herein is disclosure about the development and characterization of an antibody (mPA7) which binds to antigen CD46 which is present on a variety of human cancers from ovary, breast, lung, prostate, colon, kidney, and pancreas. Methods of diagnosing and treating various cancers by using antibodies such as mPA7 directed ... 06/07/07 - 20070128201 - Combined use of ecteinascidin-743 and platinum antineoplastic compounds ET-743 can be used to mitigate resistance to and potentiate the cytotoxic effects of a platinum coordination complex anti-neoplastic agent in a human cancer patient. ... 05/31/07 - 20070122414 - Surface marker-directed cancer therapeutics Disclosed are methods for treating and/or preventing neoplasms in a patient by contacting the neoplasm with therapeutic agents capable of binding, hybridizing, or interacting with proteins on the cell surface of neoplastic cells. In addition, therapeutic compositions are disclosed for the treatment and/or prevention of a neoplasm in a patient ... 05/24/07 - 20070116708 - Antibodies directed to monocyte chemo-attractant protein-1 (mcp-1) and uses thereof Embodiments of the invention described herein relate to antibodies directed to the antigen monocyte chemo-attractant protein-1 (MCP-1) and uses of such antibodies. In particular, in accordance with some embodiments, there are provided fully human monoclonal antibodies directed to the antigen MCP-1. Nucleotide sequences encoding, and amino acid sequences comprising, heavy ... 05/24/07 - 20070116707 - Antibody and antibody fragments for inhibiting the growth of tumors Chimerized and humanized versions of anti EGF receptor antibody 225 and fragments thereof for treatment of tumors. ... 05/17/07 - 20070110756 - Method for modulating p53 activity via methylation The present invention relates to the modulation of p53 activity based upon the stabilization of p53 via methylation by Set9. Stabilization or destablization of p53 is useful in methods for modulating apoptosis and treating cancer, either alone or in combination with exogenous p53 or antineoplastic agents. Antibodies which specifically recognize ... 05/17/07 - 20070110755 - Vascular endothelial cell growth factor antagonists The present invention provides vascular endothelial cell growth factor (hVEGF) antagonists, including monoclonal antibodies, hVEGF receptors, and hVEGF variants that inhibit the mitogenic, angiogenic, or other biological activity of hVEGF. The antagonists thus are useful for the treatment of diseases and disorders characterized by undesirable or excessive endothelial cell proliferation ... 05/17/07 - 20070110754 - Use of antagonist anti-cd40 antibodies for treatment of chronic lymphocytic leukemia Methods of therapy for treating a subject for chronic lymphocytic leukemia are provided. The methods comprise administering a therapeutically effective amount of an antagonist anti-CN40 antibody or antigen-binding fragment thereof to a patient in need thereof. The antagonist anti-CD40 antibody or antigen-binding fragment thereof is free of significant agonist activity, ... 05/17/07 - 20070110753 - Therapeutic agents for solid tumors A therapeutic agent for solid tumors, said agent comprising as an active ingredient, an antibody that specifically binds to a protein having the amino acid sequence as set forth in SEQ ID NO: 2 or an antibody fragment that maintains the antibody activity. ... 05/10/07 - 20070104721 - Antineoplastic combinations with mtor inhibitor,herceptin, and/or hki-272 A combination of temsirolimus and herceptin in the treatment of cancer is provided. A combination of temsirolimus and HKI-272 is provided. A combination of herceptin and HKI-272 is also provided. Regimens and kits for treatment of metastatic breast cancer, containing herceptin, temsirolimus and/or HKI-272, optionally in combination with other anti-neoplastic ... 05/10/07 - 20070104720 - Novel serpentine transmembrane antigens expressed in human cancers and uses thereof Described is a novel family of cell surface serpentine transmembrane antigens. Two of the proteins in this family are exclusively or predominantly expressed in the prostate, as well as in prostate cancer, and thus members of this family have been termed “STEAP” (SIX Transmembrane Epithelial Antigens of the Prostate). Four ... 05/10/07 - 20070104719 - Caspase activated prodrugs therapy The invention provides novel method for the localized delivery of pharmaceutical agents by the administration of a caspase conjugate that targets a cell type of interest and the additional administration of a pro-agent that is locally converted, in the presence of the caspase, to an active agent. The invention further ... 05/10/07 - 20070104718 - Gene brcc-1 and diagnostic and therapeutic uses thereof A gene that is a modulator of tumor growth and metastasis in certain cancer types is provided. This gene and corresponding polypeptide have diagnostic and therapeutic application for detecting and treating cancers that involve expression of BRCC-1 such as breast cancer and lung cancer. ... 05/10/07 - 20070104717 - Compositions and methods for detecting and treating cancer The present invention relates to compositions and methods for cancer diagnostics and treatment, including but not limited to, CD55 and/or CD97 cancer markers. In particular, the present invention provides compositions and methods of using CD55 and/or CD97 in the diagnosis and treatment of prostate cancers. ... 05/10/07 - 20070104716 - Methods for controlling pathological angiogenesis by inhibition of a6b4 integrin It has now been determined that α6β4 integrin is a pro-angiogenic receptor, and thus that it provides a novel and heretofore unrecognized target for anti-angiogenic therapy. Thus, angiogenesis, particularly pathological angiogenesis, can be inhibited, and conditions with which pathological angiogenesis is associated treated using inhibitors of α6β4 integrin. A tissue ... 05/03/07 - 20070098730 - Multiple antigen glycopeptide carbohydrate, vaccine comprising the same and use thereof A carbohydrate peptide conjugate comprising a carrier comprising a dendrimeric poly-Lysine enabling multipic epitopes to be covalently attached thereto, at least one peptide comprising one T epitope or several identical or different T epitopes, at least one carbohydrate moiety, or a derivative thereof, containing B epitope, provided it is not ... 05/03/07 - 20070098729 - Novel serpentine transmembrane antigens expressed in human cancers and uses thereof Described is a novel family of cell surface serpentine transmembrane antigens. Two of the proteins in this family are exclusively or predominantly expressed in the prostate, as well as in prostate cancer, and thus members of this family have been termed “STEAP” (Six Transmembrane Epithelial Antigen of the Prostate). Four ... 05/03/07 - 20070098728 - Novel compositions and methods in cancer This invention is in the field of cancer-associated (CA) genes. Specifically it relates to methods for detecting and diagnosing cancer or the likelihood of developing cancer based on the presence or absence of expression of PI3KR1, GNAS, NESP5, JAK1, neurogranin, HIPK1, or Nrf2, or proteins encoded by those genes. The ... 04/26/07 - 20070092522 - Method and composition for reconforming multi-epitopic antigens to initiate an immune response The invention concerns methods and compositions for initiating and/or enhancing an immune response by contacting a binding reagent with a soluble antigen, wherein the binding reagent-antigen pair generates an immune response to the antigen. ... 04/26/07 - 20070092521 - Antibody-based therapeutics with enhanced adcc activity Methods for producing antibody-based therapeutics with enhanced ADCC activity are disclosed. The enhanced ADCC activity is attributed to oligomannose-type N-glycans on the antibodies and Fc fusion proteins of the invention. Also disclosed are methods of using such antibody-based therapeutics for targeted killing of cells in a mammal, including therapeutic methods ... 04/26/07 - 20070092520 - Humanized anti-cmet antagonists The invention provides therapeutic anti-c-met antibodies, and compositions comprising and methods of using these antibodies. ... 04/26/07 - 20070092519 - Method for diagnosing chronic myeloid leukemia Objective methods for detecting and diagnosing Chronic myeloid leukemia (CML) are described herein. In one embodiment, the diagnostic method involves the determining a expression level of CML-associated gene that discriminate between CML and normal cell. The present invention further provides methods of screening for therapeutic agents useful in the treatment ... 04/19/07 - 20070087007 - Compounds, compositions and methods for the treatment of diseases characterized by a-33 related antigens The present invention relates to compositions and methods of treating and diagnosing disorders characterized the by the presence of antigens associated with inflammatory diseases and/or cancer, and nucleotide sequences, including expressed sequence tags (ESTs), oligonucleotide probes, polypeptides, vectors and host cells expressing such antigens PRO301, PRO362 or PRO245. ... 04/19/07 - 20070087006 - Compositions and methods for the diagnosis and treatment of tumor The present invention is directed to compositions of matter useful for the diagnosis and treatment of tumor in mammals and to methods of using those compositions of matter for the same. ... 04/19/07 - 20070087005 - Anti-glypican-3 antibody An anti-glypican-3 antibody comprising one or more amino acid substitutions introduced in the Fc region is disclosed. Preferably, in the anti-glypican-3 antibody, one or more of the amino acid residues at the positions 239, 298, 326, 330 and 332 in the Fc region are substituted with other amino acid residues. ... 04/19/07 - 20070087004 - Pro104 antibody compositions and methods of use The invention provides isolated anti-ovarian, pancreatic, lung or breast cancer antigen (Pro104) antibodies that bind to Pro 104 on a mammalian cell in vivo. The invention also encompasses compositions comprising an anti-Pro104 antibody and a carrier. These compositions can be provided in an article of manufacture or a kit Another ... 04/12/07 - 20070082001 - Novel engineered superantigen for human therapy The present invention relates to compositions and methods of use, wherein the composition comprises a conjugate of a bacterial superantigen and an antibody moiety. More particularly, the bacterial superantigen has been modified to decrease seroreactivity with retained superantigen activity. ... 04/12/07 - 20070082000 - D1-1 nucleic acids, polypeptides and related methods The disclosure provides, among other things, novel angiogenesis-related nucleic acids, polypeptides and methods of use. ... 04/05/07 - 20070077252 - Laminin chains: diagnostic uses The instant invention provides for the identification, diagnosis, monitoring, and treatment of invasive cells using the laminin 5 gamma-2 chain protein or nucleic acid sequence, or antibodies thereto. ... 03/29/07 - 20070071762 - Comprehensive diagnostic testing procedures for personalized anticancer chemotherapy (pac) The present invention provides methods of assessing and selecting treatment modalities for cancer. ... 03/29/07 - 20070071761 - Method for increasing the efficacy of anti-tumor agents by anti-endoglin antibody The present invention provides a method for enhancing the efficacy of chemotherapeutic agents for therapy of cancer including tumors and other angiogenesis-associated diseases such as rheumatoid arthritis. The method comprises the steps of administering to an individual in need of treatment, a combination of an anti-endoglin antibody and a chemotherapeutic ... 03/29/07 - 20070071760 - Methods for treating b-cell malignancies using a taci-ig fusion molecule The present invention provides methods and compositions for treatment of B-cell malignancies, including non-Hodgkin's lymphoma, comprising administering to a patient in need of the treatment a TACI-Ig fusion molecule in amount sufficient to suppress proliferation-inducing functions of BlyS and APRIL. ... 03/29/07 - 20070071759 - Antibody-immune cell ligand fusion protein for cancer therapy Compositions for treatment of cancer comprising chimeric fusion molecules that bind to an antigen on a pathogenic cell and to an immune cell. The molecules redirect the immune cells to a pathogenic cell. The purified fusion proteins demonstrated ability to bind antigen on the surface of tumor cells and cell ... 03/29/07 - 20070071758 - Ceacam1 based cancer therapy and diagnosis The invention relates to methods and compositions for the treatment and diagnosis of cancers. At least one aspect of the present invention relates to methods and compositions for enhancing the efficacy of tumor-infiltrating lymphocyte (TIL) therapy in the treatment of cancer by negatively modulating the activity of the CEACAM1 protein. ... 03/29/07 - 20070071757 - Novel compositions and methods in cancer This invention is in the field of cancer-associated (CA) genes. Specifically it relates to methods for detecting and diagnosing cancer or the likelihood of developing cancer based on the presence or absence of expression of PRDM11 or TBX21 or proteins encoded by those genes. The invention also provides methods and ... 03/29/07 - 20070071756 - Delivery of an agent to ameliorate inflammation A method delivering an anti-vascular endothelial growth factor (VEGF) agent to ameliorate inflammation at a site in the body that may be the eye, a joint, the brain, etc. or to reduce corneal neovascularization. In one embodiment, one or more other agents, such as non-steroidal anti-inflammatory agents, steroids, etc., may ... 03/29/07 - 20070071755 - Novel nucleolar gtpases and method for controlling proliferation of cells There is provided an isolated polypeptide comprising an amino acid sequence at least 85% homologous to SEQ ID NO: 2 or SEQ ID N: 4, or a conservative variant thereof, wherein the polypeptide regulates proliferation of a cell. There is also provided an isolated polynucleotide encoding the polypeptide of the ... 03/29/07 - 20070071754 - Method to ameliorate inflammation Administering to a patient a concentration of at least one anti-inflammatory agent and bevacizumab at a concentration sufficient to reduce fluid leakage from new vessels associated with angiogenesis. ... 03/29/07 - 20070071753 - Diagnostics and therapeutics for diseases associated with g protein-coupled receptor 85 (gpr85) The invention provides a human GPR85 which is associated with the cardiovascular disorders, hematological disorders, inflammatory diseases, metabolic diseases, neurological disorders, urological disorders, respiratory diseases, cancer disorders and reproduction disorders. The invention also provides assays for the identification of compounds useful in the treatment or prevention of cardiovascular disorders, hematological ... 03/22/07 - 20070065451 - Enhancement of intracellular delivery and tissue targeting of drugs and genes A method for enhancing intracellular delivery of effector molecules is provided. The method involves modifying selected antibodies with biotin and streptavidin, conjugating these antibodies with an effector molecule, and delivering the conjugated effector to an intracellular target specifically recognized by the antibody. ... 03/22/07 - 20070065450 - Snail, a new marker for tumour invasion and target protein of new antitumoral compounds The Snail transcription factor has been identified as a repressor of the expression of E-cadherin. The expression of Snail induces invasive and metastatic capacity in tumour cells. This invention presents: a new target protein, Snail, for the identification of new antitumoral compounds and a new diagnostic tumour marker, indicative of ... 03/22/07 - 20070065449 - Method of treating cancer, especially soft tissue sarcoma utilizing gemcitabine in combination with docetaxel and anti-vegf therapy (bevacizumab) The present invention relates to a pharmaceutical cocktail, in particular, effective amounts of gemcitabine, in combination with effective amounts of docetaxel and angiogenesis inhibitor, especially a vascular endothelial growth factor (VEGF) inhibitor, such as bevacizumab for the treatment of cancer, in particular sarcoma, especially soft tissue sarcoma. Pharmaceutical compositions and ... 03/22/07 - 20070065448 - Methods and compositions for treating diseases targeting maba1 Methods and compositions for diagnosing, detecting and treating a colon disease associated with differential expression of MABA1 in comparison to healthy cells. Also provided are antagonists or agonists of MABA1, and methods for screening agents that modulate the MABA1 level or activity in vivo or in vitro. ... 03/22/07 - 20070065447 - Laminin-5 gamma2-binding peptides, related compositions, and use thereof Novel peptides that specifically bind the γ2 chain of laminin-5 and other γ2-associated proteins; related compositions (e.g., derivatives and variants of such peptides; nucleic acids comprising sequences encoding such peptides; pharmaceutical compositions comprising either of such molecules; etc.); methods of using the same for diagnostic, prophylactic, and therapeutic purposes; and ... 03/22/07 - 20070065446 - Anti-bambi antibody and diagnostic or remedy for colon cancer and liver cancer The present invention provides an antibody (anti-BAMBI antibody) which recognizes a polypeptide having the amino acid sequence of SEQ ID No: 1 or a polypeptide having an amino acid sequence containing deletion, substitution or addition of one or more amino acids as compared to the amino acid sequence of SEQ ... 03/15/07 - 20070059315 - Prostate stem cell antigen vaccines and uses thereof This invention relates to the identification of prostate stem cell antigen (PSCA) as a target of clinically relevant antitumor immune responses. The invention provides vaccines comprising PSCA, or fragments thereof, which are useful in inducing antitumor immune responses, including PSCA specific CD8+ T cell responses. Methods of using the compositions ... 03/08/07 - 20070053915 - Gips, a family of polypeptides with transcription factor activity that interact with goodpasture antigen binding protein The present invention provides isolated GPBP-interacting 90 and 130 kDa polypeptides, and portions thereof (GIP90/130 polypeptides), antibodies to the GIP90/130 polypeptides, and pharmaceutical compositions thereof. The present invention also provides isolated GIP90/130 nucleic acid sequences, expression vectors comprising the nucleic acid sequences, and host cells transfected with the expression vectors. ... 03/08/07 - 20070053914 - Antitumor antibodies, proteins, and uses thereof Antibodies that bind to a 40 kDa protein which is expressed on tumors, but is not expressed on normal adult hemopoietic cells are disclosed. Also disclosed are methods for production and the use of such antibodies. ... 03/01/07 - 20070048326 - Compositions and methods for the diagnosis and treatment of tumor The present invention is directed to compositions of matter useful for the diagnosis and treatment of tumor in mammals and to methods of using those compositions of matter for the same. ... 03/01/07 - 20070048325 - Combination therapies for inhibiting integrin-extracellular matrix interactions The present application relates to compositions of ECM antagonists and their use in methods for treating angiogenic-dependent conditions. The ECM antagonists can bind the same or different ECM component. The present application also relates to compositions of ECM antagonists and cancer therapies and their use in methods for preventing, treating ... 03/01/07 - 20070048324 - Antitumor antibodies, proteins, and uses thereof Antibodies that bind to a 40 kDa protein which is expressed on tumors, but is not expressed on normal adult hemopoietic cells are disclosed. Also disclosed are methods for production and the use of such antibodies. ... 03/01/07 - 20070048323 - Antibody treatment of lipomatous tumors A method of treating lipomatous tumors in mammals such as humans or companion animals is described. The treatment of lipomatous tumors use antibodies derived from adipose tissue of a mammal donor. The methods of the present invention are effective against both benign and malignant lipomatous tumors. The antibodies of the ... 02/22/07 - 20070041984 - Novel methods of cancer diagnosis and therapy targeted against a cancer stem line Improved methods for treatment of cancer which involve the targeting of slow-growing, relatively mutationally-spared cancer stem line are provided. These methods are an improvement over previous cancer therapeutic methods because they provide for very early cancer treatment and reduce the likelihood of clinical relapse after treatment. ... 02/22/07 - 20070041983 - Method for treating tumors using anti-osteopontin antibodies The present invention is directed to compositions of matter useful for the treatment of tumor in mammals and to methods of using those compositions of matter for the same. ... 02/22/07 - 20070041982 - Ilt3 binding molecules and uses therefor The present invention provides binding molecules that specifically bind to ILT3, e.g., human ILT3 (hILT3), on antigen presenting cells, such as for example, monocytes, macrophages and dendritic cells (DC), e.g., monocyte-derived dendritic cells (MDDC). The binding molecules of the invention are characterized by binding to hILT3 with high affinity and ... 02/22/07 - 20070041981 - Compositions and methods for altering immune function The present invention relates to molecules that stabilize and/or enhance CD154 activity, compositions comprising these molecules, methods for using these molecules and compositions (e.g., pharmaceutical compositions) comprising them. Specifically, the molecules can be used for enhancing immune function (e.g., enhancing Th1 cytokine expression), stimulating immune responses, and/or treating certain disorders ... 02/22/07 - 20070041980 - Ca6 antigen-specific cytotoxic conjugate and methods of using the same Cytotoxic conjugates comprising a cell binding agent and a cytotoxic agent, therapeutic compositions comprising the conjugate, methods for using the conjugates in the inhibition of cell growth and the treatment of disease, and a kit comprising the cytotoxic conjugate are disclosed are all embodiments of the invention. In particular, the ... 02/15/07 - 20070036804 - Novel methods of cancer diagnosis and therapy targeted against a cancer stem line Improved methods for treatment of cancer which involve the targeting of slow-growing, relatively mutationally-spared cancer stem line are provided. These methods are an improvement over previous cancer therapeutic methods because they provide for very early cancer treatment and reduce the likelihood of clinical relapse after treatment. ... 02/15/07 - 20070036803 - Novel methods of cancer diagnosis and therapy targeted against a cancer stem line Improved methods for treatment of cancer which involve the targeting of slow-growing, relatively mutationally-spared cancer stem line are provided. These methods are an improvement over previous cancer therapeutic methods because they provide for very early cancer treatment and reduce the likelihood of clinical relapse after treatment. ... 02/15/07 - 20070036802 - Novel methods of cancer diagnosis and therapy targeted against a cancer stem line Improved methods for treatment of cancer which involve the targeting of slow-growing, relatively mutationally-spared cancer stem line are provided. These methods are an improvement over previous cancer therapeutic methods because they provide for very early cancer treatment and reduce the likelihood of clinical relapse after treatment. ... 02/15/07 - 20070036801 - Novel methods of cancer diagnosis and therapy targeted against a cancer stem line Improved methods for treatment of cancer which involve the targeting of slow-growing, relatively mutationally-spared cancer stem line are provided. These methods are an improvement over previous cancer therapeutic methods because they provide for very early cancer treatment and reduce the likelihood of clinical relapse after treatment. ... 02/15/07 - 20070036800 - Novel methods of cancer diagnosis and therapy targeted against a cancer stem line Improved methods for treatment of cancer which involve the targeting of slow-growing, relatively mutationally-spared cancer stem line are provided. These methods are an improvement over previous cancer therapeutic methods because they provide for very early cancer treatment and reduce the likelihood of clinical relapse after treatment. ... 02/15/07 - 20070036799 - Identification and engineering of antibodies with variant fc regions and methods of using same The present invention relates to molecules, particularly polypeptides, more particularly immunoglobulins (e.g., antibodies), comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, which variant Fc region binds FcγRIIIA and/or FcγRIIA with a greater affinity, relative to ... 02/15/07 - 20070036798 - Method and composition for reconforming multi-epitopic antigens to initiate an immune response The invention concerns methods and compositions for intiating and/or enhancing an immune response by contacting a binding reagent with a soluble antigen, wherein the binding reagent-antigen pair generates an immune response to the antigen. ... 02/15/07 - 20070036797 - Methods of treating brain tumors with antibodies The application is directed toward a method of treating a brain tumor in a patient comprising systemically administering a monoclonal antibody. ... 02/15/07 - 20070036796 - Antibodies against ccr5 and uses thereof Antibodies that specifically bind to CCR5 are useful for treating immunosuppressive disease. ... 02/15/07 - 20070036795 - Method of inhibiting receptor tyrosine kinases with an extracellular antagonist and an intracellular agonist The present invention relates to methods of inhibiting receptor tyrosine kinases by utilizing a combination of both an extracellular and an intracellular RTK antagonist. The extracellular RTK antagonist is a biological molecule or a small molecule that inhibits activation of the receptor tyrosine kinase by interacting with the extracellular binding ... 02/08/07 - 20070031439 - Novel protein related to melanoma-inhibiting protein and uses thereof Novel TANGO 130 nucleic acid molecules which encode proteins having homology to melanoma-inhibiting protein are disclosed. In addition to TANGO 130 nucleic acid molecules and proteins, the invention further provides isolated TANGO 130 fusion proteins, antigenic peptides and anti-TANGO 130 antibodies. The invention also provides vectors containing nucleic acid molecules ... 02/08/07 - 20070031438 - Antibodies as chimeric effector cell receptors against tumor antigens This invention relates to specific antibodies against ganglioside GD3 called MB3.6 and against protein prostate specific membrane antigen (PSMA) called 3D8, 4D4 and 3E11 when prepared as chimeric molecules with signaling molecules of T cells and other effector cells, and the use thereof in the treatment of cancers expressing these ... 02/08/07 - 20070031437 - Compositions and methods for modulating vascular development The present invention provides methods of using EGFL7 antagonist to modulate vascular development. Also provided herein are methods of screening for modulators of EGFL7 activity. Furthermore, methods of treatment using EGFL7 antagonists are provided. ... 02/08/07 - 20070031436 - Multivalent antibody contructs The present invention relates to a multivalent Fv antibody construct having at least four variable domains which are linked with each over via the peptide linkers 1, 2 and 3. The invention also concerns expression plasmids which code for such an Fv antibody construct and a method of producing the ... 02/08/07 - 20070031435 - Polypeptide compounds for inhibiting angiogenesis and tumor growth In certain embodiments, this present invention provides polypeptide compositions, and methods for inhibiting Ephrin B2 or EphB4 activity. In other embodiments, the present invention provides methods and compositions for treating cancer or for treating angiogenesis-associated diseases. ... 02/08/07 - 20070031434 - Uses for eph receptor antagonists and agonists The present application describes methods of inhibiting or stimulating angiogenesis in a mammal comprising administering to the mammal an effective amount of an Eph receptor antagonist or agonist, respectively. Articles of manufacture for use in relation to these methods are also described. ... 02/08/07 - 20070031433 - Tumor antigen Tumor antigen inducing and/or activating HLA-A2-restricted tumor-specific cytotoxic T lymphocytes that is activated by recognizing HLA-A2 and a tumor antigen peptide, and a peptide or polypeptide derived from the tumor antigen, a polynucleotide encoding the peptide or a complementary strand polynucleotide thereof, a transformant comprising a recombinant vector which comprises ... 02/08/07 - 20070031432 - Tumor antigen Tumor antigen inducing and/or activating HLA-A2-restricted tumor-specific cytotoxic T lymphocytes that is activated by recognizing HLA-A2 and a tumor antigen peptide, and a peptide or polypeptide derived from the tumor antigen, a polynucleotide encoding the peptide or a complementary strand polynucleotide thereof, a transformant comprising a recombinant vector which comprises ... 02/08/07 - 20070031431 - Tumor antigen Tumor antigen inducing and/or activating HLA-A2-restricted tumor-specific cytoxic T lymphocytes that is activated by recognizing HLA-A2 and a tumor antigen peptide, and a peptide or polypeptide derived from the tumor antigen, a polynucleotide encoding the peptide or a complementary strand polynucleotide thereof, a transformant comprising a recombinant vector which comprises ... 02/08/07 - 20070031430 - Immunoconjugates The present invention relates to novel immunoconjugates that are devoid of light chains and comprise at least one variable domain of a heavy chain antibody. The immunoconjugates of the present invention can be used for the preparation of a medicament to treat tumours. ... 02/08/07 - 20070031429 - Cancerous desease modifying antibodies The present invention relates to a method for producing patient cancerous disease modifying antibodies using a novel paradigm of screening. By segregating the anti-cancer antibodies using cancer cell cytotoxicity as an end point, the process makes possible the production of anti-cancer antibodies for therapeutic and diagnostic purposes. The antibodies can ... 02/08/07 - 20070031428 - Cancerous disease modifying antibodies The present invention relates to a method for producing patient cancerous disease modifying antibodies using a novel paradigm of screening. By segregating the anti-cancer antibodies using cancer cell cytotoxicity as an end point, the process makes possible the production of anti-cancer antibodies for therapeutic and diagnostic purposes. The antibodies can ... 02/08/07 - 20070031427 - Cancerous disease modifying antibodies The present invention relates to a method for producing patient cancerous disease modifying antibodies using a novel paradigm of screening. By segregating the anti-cancer antibodies using cancer cell cytotoxicity as an end point, the process makes possible the production of anti-cancer antibodies for therapeutic and diagnostic purposes. The antibodies can ... 02/08/07 - 20070031426 - Cancerous disease modifying antibodies The present invention relates to a method for producing patient cancerous disease modifying antibodies using a novel paradigm of screening. By segregating the anti-cancer antibodies using cancer cell cytotoxicity as an end point, the process makes possible the production of anti-cancer antibodies for therapeutic and diagnostic purposes. The antibodies can ... 02/08/07 - 20070031425 - Cancerous disease modifying antibodies The present invention relates to a method for producing patient cancerous disease modifying antibodies using a novel paradigm of screening. By segregating the anti-cancer antibodies using cancer cell cytotoxicity as an end point, the process makes possible the production of anti-cancer antibodies for therapeutic and diagnostic purposes. The antibodies can ... 02/08/07 - 20070031424 - Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof The present invention relates to functional heavy chain antibodies, functional single domain heavy chain antibodies, functional VH domains, or functional fragments thereof comprising an amino acid which is neither a charged amino acid nor a C at position 45, and comprising an amino acid at position 103 independently chosen from ... 02/08/07 - 20070031423 - Antibodies to treat cancer Compositions and methods for the treatment of cancer, particularly melanoma, myeloma, small cell lung cancer, thymic lymphoma, T-cell lymphoma, B-cell lymphoma, osteosarcoma, and acute T-cell leukemia, are disclosed. Illustrative compositions include one or more anti-ganglioside antibodies and polynucleotides that encode such anti-ganglioside antibodies. These antibodies may be for example, hamster ... 02/01/07 - 20070026002 - Inhibitors of angiopoietin-like 4 protein, combinations, and their use Modulators of angiopoietin-like 4 protein are provided along with methods for their use in the treatment of diseases and pathological conditions. Combinations of ANGPTL4 antagonists and other therapeutics, e.g., anti-cancer agents, and methods of their use in the treatment of mammals susceptible to or diagnosed with cancer, or with relapse ... 02/01/07 - 20070026001 - Apo-2 ligand-anti-her-2 antibody synergism Methods of using synergistically effective amounts of Apo-2 ligand and anti-Her-2 antibodies to enhance cell death via apoptosis are provided. ... 02/01/07 - 20070026000 - Apo-2l receptor agonist and cpt-11 synergism Methods of using synergistically effective amounts of Apo-2L receptor agonists and CPT-11 to induce apoptosis and suppress growth of cancer cells are provided. ... 02/01/07 - 20070025999 - Treatment with anti-vegf antibodies This invention concerns in general treatment of diseases and pathological conditions with anti-VEGF antibodies. More specifically, the invention concerns the treatment of human patients susceptible to or diagnosed with cancer using an anti-VEGF antibody, preferably in combination with one or more additional anti-tumor therapeutic agents. ... 02/01/07 - 20070025998 - Methods for enhancing the efficacy of cancer therapy The invention concerns the identification of tumor antigens the expression of which is selectively upregulated by retinoid treatment. The invention further concerns improved methods of cancer treatment and, in particular, methods enhancing the efficacy of the treatment of cancers characterized by aberrant Wnt signaling by administration of retinoic acid or ... 02/01/07 - 20070025997 - Use of biomolecular targets in the treatment and visualization of brain tumors The present invention relates to the use of proteins that are differentially expressed in primary brain tumor tissues, as compared to normal brain tissues, as biomolecular targets for brain tumor treatment therapies. Specifically, the present invention relates to the use of therapeutic and imaging agents, which specifically bind to one ... 02/01/07 - 20070025996 - Oculospanin as a tumor specific antigen and methods and compositions utilizing same The present invention relates to a method of detecting cancer by use of an oncogene, a method of screening for an active compound useful to treat and/or prevent cancer, and a pharmaceutical composition for treatment and/or prevention of cancer. More specifically, the present invention provides a method of detecting cancer ... 02/01/07 - 20070025995 - Taxoid derivative covalently linked to tumor-specific antibody and a method for preparing the same To provide a taxoid derivative that has improved solubility in water and acts specifically with respect to tumors, thereby mitigating side effects. The present invention provides an anticancer agent comprises covalent bond compound of an antibody that reacts specifically with respect to cancer cells with a taxoid derivative and a ... 01/25/07 - 20070020278 - Diagnosing and treating cancer Methods for treating or diagnosing cancers of the female reproductive tract and childhood cancers are disclosed. The methods described herein use binding agents, e.g., antibodies, specific for the extracellular domain of human prostate specific membrane antigen (PSMA). ... 01/25/07 - 20070020277 - Human oncogene induced secreted protein i The present invention relates to a novel protein, the Human Oncogene Induced Secreted Protein I (“HOIPS I”) protein. In particular, isolated nucleic acid molecules are provided encoding the human HOIPS I protein. HOIPS I polypeptides are also provided as are vectors, host cells and recombinant methods for producing the same. ... 01/25/07 - 20070020276 - Methods for the treatment of carcinoma The invention concerns compositions and methods for the diagnosis and treatment of neoplastic cell growth and proliferation in mammals, including humans. The invention is based upon the identification of genes that are amplified in the genome of tumor cells, such as renal cell carcinoma. Such gene amplification is expected to ... 01/25/07 - 20070020275 - Nucleic acid sequences of hyperplasia and tumours of the thyroid The invention relates to a nucleic acid which codes for a polypeptide. Said polypeptide comprises a KRAB domain and/or at least one zinc finger motif, whereby the KRAB domain contains the amino acid sequence of SEQ ID NO: 1 and the zinc finger motif is of the type contained in ... 01/25/07 - 20070020274 - Method of preventing or reducing the likelihood of pregnancy The present invention relates to compositions and methods for reducing the likelihood that a woman will become pregnant or that an unwanted pregnancy may be terminated by administering an inhibitor of H-hCG or β-H-hCG to said a woman at risk to become pregnant. Methods of enhancing the likelihood that a ... 01/25/07 - 20070020273 - Recombinant monoclonal antibodies and corresponding antigens for colon and pancreatic cancers The present invention provides for purified or highly pure recombinant monoclonal antibodies that bind to human colorectal and pancreatic carcinoma-associated antigens (CPAA), along with nucleic acid sequences encoding the antibody chains, and the amino acid sequences corresponding to said nucleic acids and uses for said sequences. ... 01/25/07 - 20070020272 - Indirectly linked photosensitizer immunoconjugates, processes for the production thereof and methods of use thereof The present invention relates to indirectly linked photosensitizer immunoconjugate (PIC) compositions, methods of preparation and the use of the same in photodynamic therapeutic and diagnostic applications. PICs comprising a photosensitizer indirectly linked to an antibody via a PEGylated polyglutamate chain are described. ... 01/25/07 - 20070020271 - Endothelial cell specific antibodies and uses thereof Methods and composition provided herein relate to the inhibition of proliferation, migration, and tubule formation of cells and are thus useful in treating angiogenesis associated diseases, including cancer, polycystic kidney disease, diabetic retinopathy, rheumatoid arthritis, and psoriasis. Disclosed are methods of inhibiting endothelial cell proliferation, migration, and tubule formation by ... 01/18/07 - 20070014802 - Modified antibody fragments The present invention relates to a new class of antibody fragments including antibody Fab and Fab′ fragments in which the heavy chain is not covalently bonded to the light chain and two or more effector molecules are attached to the fragment, of which at least one of said molecules is ... 01/18/07 - 20070014801 - Methods of diagnosis of prostate cancer, compositions and methods of screening for modulators of prostate cancer Described herein are genes whose expression are up-regulated or down-regulated in prostate cancer. Also described are such genes whose expression is further up-regulated or down-regulated in drug-resistant prostate cancer cells. Related methods and compositions that can be used for diagnosis and treatment of prostate cancer are disclosed. Also described herein ... 01/11/07 - 20070009536 - Novel madcam antibodies The invention provides new, improved anti-MAdCAM antibodies. Uses of these antibodies in medicine are also included, in particular for the treatment of inflammatory conditions such as inflammatory bowel disease. ... 01/11/07 - 20070009535 - Treatment of cancer patients exhibiting activation of the p-glycoprotein efflux pump mechanism The present invention relates to a method of determining P-glycoprotein expression and/or function for a patient with solid tumors, leukemias, and other malignancies. The invention also relates to using a P-glycoprotein expression and/or function diagnostic in conjunction with methods for treating solid tumors, leukemias, and other malignancies with a chemotherapeutic ... 01/11/07 - 20070009534 - Treatment of cancer patients exhibiting activation of the p-glycoprotein efflux pump mechanism The present invention relates to a method of determining P-glycoprotein expression and/or function for a patient with solid tumors, leukemias, and other malignancies. The invention also relates to using a P-glycoprotein expression and/or function diagnostic in conjunction with methods for treating solid tumors, leukemias, and other malignancies with a chemotherapeutic ... 01/11/07 - 20070009533 - Treatment of cancer patients exhibiting activation of the p-glycoprotein efflux pump mechanism The present invention relates to a method of determining P-glycoprotein expression and/or function for a patient with solid tumors, leukemias, and other malignancies. The invention also relates to using a P-glycoprotein expression and/or function diagnostic in conjunction with methods for treating solid tumors, leukemias, and other malignancies with a chemotherapeutic ... 01/11/07 - 20070009532 - Treatment of patients with cancer using a calicheamicin-antibody conjugate in combination with zosuquidar The present invention relates to a method of treating patients with solid tumors, leukemias, and other malignancies using a combination of zosuquidar and a calicheamicin-antibody conjugate, such as Mylotarg. The invention is also directed to pharmaceutical formulations comprising zosuquidar and calicheamicin-antibody conjugates. The formulations are particularly effective in treating relapsed ... 01/11/07 - 20070009531 - Treatment of patients with cancer using a calicheamicin-antibody conjugate in combination with zosuquidar The present invention relates to a method of treating patients with solid tumors, leukemias, and other malignancies using a combination of zosuquidar and a calicheamicin-antibody conjugate, such as Mylotarg. The invention is also directed to pharmaceutical formulations comprising zosuquidar and calicheamicin-antibody conjugates. The formulations are particularly effective in treating relapsed ... 01/11/07 - 20070009530 - Methods and compositions for inhibiting tumorigenesis The present invention relates to compounds, small interfering RNAs and compositions and methods of inhibiting tumorigenesis and methods of inhibiting tumor cell growth and proliferation using agents that inhibit the hedgehog and Gli signaling pathway, including agents that inhibit GLI synthesis and/or function. The present invention also relates to particular ... 01/04/07 - 20070003559 - Methods of determining pharmacokinetics of targeted therapies Methods for determining pharmacokinetics of targeted therapies. ... 01/04/07 - 20070003558 - Methods for the treatment of multiple myeloma Methods for treating multiple myeloma with inhibitors of CXCR4 are described. The decreased expression of CXCR4 on multiple myeloma cells according to the invention results in decreased homing of the cells to the bone marrow and a reduction in the development of the disease. Also disclosed are pharmaceutical compositions incorporating ... 01/04/07 - 20070003557 - Method for treating cancer using premedication The present invention relates to a method for treating cancer which comprises; administering to a patient in need thereof a therapeutically effective amount of at least two compounds selected from antihistamic agent, antiallergic agent and steroid, and then administering to the patient in need thereof a therapeutically effective amount of ... 01/04/07 - 20070003556 - Modified antibodies against cd22 and utilization thereof CD22 diabodies, in which heavy-chain and light-chain variable regions are linked by a 5-mer linker, were produced based on known sequence information for two types of anti-CD22 antibodies. The two diabodies produced were analyzed for their activity of binding to lymphoma cells and inducing lymphoma cell death (apoptosis). As a ... 01/04/07 - 20070003555 - Heat shock protein binding fragments of cd91, and uses thereof The present invention relates to compositions and methods for the use of natural and recombinant p95 forms and fragments as heat shock protein binding proteins. The invention is based, in part, on the Applicant's discovery that a p95 can be recombinantly expressed. The present invention also relates to CD91 polypeptide ... 12/28/06 - 20060292159 - Methods for the inhibition of neovascularization and cancer metastasis Methods for diagnosing a neoplasia of epithelial tissues are provided. The methods comprise quantifiably detecting T-cadherin expression on tissue samples and comparing the detected T-cadherin levels with reference values for the level of expression of T-cadherin in healthy or disease states. Methods for diagnosing the stage of a neoplasia are ... 12/28/06 - 20060292158 - Method for the treatment of cancer using a novel pharmaceutical composition containing at least one dolastatin 10 derivative or a pharmaceutically acceptable salt of compound (I), in combination with capecitabine, trastuzumab, pertuzumab, cisplatin or irinotecan, or a pharmaceutically acceptable salt thereof, for simultaneous, sequential or separated administration in the treatment of cancer. ... 12/28/06 - 20060292157 - Mda-7 protein variants having antiproliferative activity The invention relates to the mda-7 gene, its encoded protein and fragments of the protein. Several of these fragments of the MDA-7 protein exhibit antiproliferative activity and/or inhibited the activity of intact MDA-7. Accordingly, the invention provides, among other things, for methods and compositions that may be used in the ... 12/28/06 - 20060292156 - Genetically modified human natural killer cell lines The invention provides a natural killer cell, NK-92, modified to express an Fc receptor on the surface of the cell, such as CD 16 (FcγRIII-A), or other Fcγ or Fc receptors. The modified NK-92 cell can be further modified to concurrently express an associated accessory signaling protein, such as FcεRI-γ,TCR-ζ, ... 12/28/06 - 20060292155 - Diagnostics and therapeutics for diseases associated with mosaic serine protease (msp) The invention provides a human MSP which is associated with the cardiovascular diseases, endocrinological diseases, metabolic diseases, cancer, inflammation, gastroenterological diseases, hematological diseases, respiratory diseases, neurological diseases, urological diseases and reproduction disorders. The invention also provides assays for the identification of compounds useful in the treatment or prevention of cardiovascular ... 12/28/06 - 20060292154 - A34 and a33-like 3dna, proteins, antibodies thereto and methods of treatment using same Polynucleotide molecules and polypeptide molecules A34 and A33-like 3 are described, as well as antibodies to polypeptide molecules A34 and A33like 3. Also described are methods of detecting cancers expressing these polypeptides, and methods and kits for diagnosing said cancers, and methods of inhibiting effects of a cancer in a ... 12/21/06 - 20060286113 - Anticarcinoma antibodies and uses thereof A novel single domain antibody AFAI and fragments thereof which has specific affinity for binding to carcinoma, and especially lung carcinoma. This antibody, and portions thereof, can be used, inter alia in the diagnosis and treatment of carcinoma. ... 12/21/06 - 20060286112 - Human monoclonal antibodies that bind to very late antigen-1 for the treatment of inflammation and other disorders The present invention relates to antibodies directed to very late antigen-1 (“VLA-1”) and uses of such antibodies. For example human monoclonal antibodies directed to VLA-1 are described. Isolated polynucleotide sequences encoding, and amino acid sequences comprising, heavy and light chain immunoglobulin molecules, particularly sequences corresponding to contiguous heavy and light ... 12/21/06 - 20060286111 - Tumor necrosis factor related ligand Tumor Necrosis Factor Related Ligand (TRELL) polypeptides, a novel member of the tumor necrosis factor family (TNF) and compositions comprising them are disclosed. ... 12/14/06 - 20060280749 - Therapeutic agents comprising pro-apoptotic proteins The present invention relates to targeted killing of a cell utilizing a chimeric polypeptide comprising a cell-specific targeting moiety and a signal transduction pathway factor. In a preferred embodiment, the signal transduction pathway factor is an apoptosis-inducing factor, such as granzyme B, granzyme A, or Bax. ... 12/14/06 - 20060280748 - Plasma or serum fraction for treatment or prevention of abnormal cell proliferation The present invention relates to a plasma or serum fraction derived from a mammal exposed to an inoculant, which fraction has been depleted of one or more high molecular weight proteins present in the unprocessed plasma or serum, as well as to a method to treat and/or prevent abnormal cell ... 12/14/06 - 20060280747 - Anti-vegf antibodies Anti-VEGF antibodies and variants thereof, including those having high affinity for binding to VEGF, are disclosed. Also provided are methods of using phage display technology with naïve libraries to generate and select the anti-VEGF antibodies with desired binding and other biological activities. Further contemplated are uses of the antibodies in ... 12/14/06 - 20060280746 - Alpha, beta-unsaturated sulfoxides for treating proliferative disorders are useful as antiproliferative agents including, for example, anticancer agents, and as radioprotective and chemoprotective agents. ... 12/07/06 - 20060275308 - Combination of gallium compounds with nonchemotherapeutic anticancer agents in the treatment of neoplasia The present invention relates to a combination of a pharmaceutical composition comprising a gallium compound, especially gallium nitrate, and one or more nonchemotherapeutic anticancer agents (NCAA) including antibodies, antisense molecules, anti-telomerase agents, aptamers, biologic response modifiers, bisphosphonates, cytotoxic fusion proteins, immunomodulatory agents, immunostimulatory agents, molecular decoys, molecular inhibitors, proteasome inhibitors, ... 12/07/06 - 20060275307 - Antibodies to treat cancer Compositions and methods for the treatment of cancer, particularly melanoma, myeloma, small cell lung cancer, thymic lymphoma, T-cell lymphoma, B-cell lymphoma, osteosarcoma, and acute T-cell leukemia, are disclosed. Illustrative compositions include one or more anti-ganglioside antibodies and polynucleotides that encode such anti-ganglioside antibodies. These antibodies may be for example, hamster ... 12/07/06 - 20060275306 - Protein formulation A stable lyophilized protein formulation is described which can be reconstituted with a suitable diluent to generate a high protein concentration reconstituted formulation which is suitable for subcutaneous administration. For example, anti-IgE and anti-HER2 antibody formulations have been prepared by lyophilizing these antibodies in the presence of a lyoprotectant. The ... 12/07/06 - 20060275305 - Herceptin adjuvant therapy The present application describes adjuvant therapy of nonmetastatic breast cancer using HERCEPTIN®. ... 12/07/06 - 20060275304 - Novel tumor antigen useful in diagnosis and therapy of prostate and colon cancer Compositions for the diagnosis and therapy of prostate and colon cancer, derived from or based on a novel prostate-specific, androgen-regulated, cell surface serine protease termed 20P1F12/TMPRSS2 are described. A full length cDNA comprising the entire coding sequence of the 20P1F12/TMPRSS2 gene (also designated 20P1F12-GTC1 herein) is provided (FIG. 1). Among ... 12/07/06 - 20060275303 - Modulating angiogenesis using ll-37/hcap-18 A pharmaceutical composition containing a peptide or pharmaceutically acceptable salt thereof containing the amino acid sequence [LL-37, 37 aa] (LL-37); for preventing or treating wounds, tumors, or disease caused by or resulting in a reduced level of angiogenesis or of arteriogenesis is disclosed. ... 12/07/06 - 20060275302 - Novel cancer-associated gene The present invention provides: a novel DNA, a carcinoma-associated gene comprising the DNA, a recombinant protein encoded by the DNA, an antibody binding to the protein, an anti-carcinoma agent comprising the antibody, a low-molecular-weight compound binding to the protein, and a screening system. An example of such a novel DNA ... 12/07/06 - 20060275301 - Cell death-inducing agent To identify antigens of the 2D7 antibody, the present inventors cloned the 2D7 antigen. The results suggested that the 2D7 antigen is an HLA class I molecule. Based on this finding, the present inventors examined whether the 2D7 antibody has cell death-inducing activity. Nuclei fragmentation was observed when the 2D7 ... 11/30/06 - 20060269559 - Novel human histone deacetylases The present invention relates to newly discovered human histone deacetylases (HDACs), also referred to as histone deacetylase-like polypeptides. The polynucleotide sequences and encoded polypeptides of the novel HDACs are encompassed by the invention, as well as vectors comprising these polynucleotides and host cells comprising these vectors. The invention also relates ... 11/30/06 - 20060269558 - Nr-cam gene, nucleic acids and nucleic acid products for therapeutic and diagnostic uses for tumors The present invention relates to the identification of a novel role of Nr-CAM in cell transformation and aberrant cellular proliferation. In particular, the present invention relates to the altered gene expression of Nr-CAM in a number of primary tumors and cell lines derived from tumors, in addition to, the altered ... 11/30/06 - 20060269557 - Humanized anti-prostate stem cell antigen monoclonal antibody Prostate stem cell antigen (PSCA) is expressed in the majority of prostate cancer patients, making it an ideal target for cancer immunotherapy. Murine monoclonal antibody 1G8 binds to PSCA with nanomolar affinity, but its efficacy as a therapeutic agent is limited by the generation of a HAMA response. The present ... 11/30/06 - 20060269556 - Mast cell activation using siglec 6 antibodies The present invention provides a method of modulating mast cell function using Siglec 6 antibodies or fragments thereof. The present invention also provides methods of treating or preventing diseases or disorders associated with mast cell function. ... 11/30/06 - 20060269555 - Antibodies that immunospecifically bind to trail receptors The present invention relates to antibodies and related molecules that immunospecifically bind to TRAIL receptor, TR7. Such antibodies have uses, for example, in the prevention and treatment of cancers and other proliferative disorders. The invention also relates to nucleic acid molecules encoding anti-TR7 antibodies, vectors and host cells containing these ... 11/30/06 - 20060269554 - Dr5 antibodies and uses thereof The invention concerns anti-DR5 antibodies with improved properties, compositions comprising such antibodies, methods and means for making such antibodies, and their therapeutic use, in particular in the treatment of cancer. ... 11/30/06 - 20060269553 - Protein complex using an immunoglobulin fragment and method for the preparation thereof Disclosed are a protein conjugate with improved in vivo duration and stability and the use thereof. The protein conjugate includes a physiologically active polypeptide, a non-peptide polymer and an immunoglobulin Fc fragment. Since the three components are covalently linked, the protein conjugate has extended in vivo duration and enhanced stability ... 11/23/06 - 20060263374 - Antibodies to treat cancer Compositions and methods for the treatment of cancer, particularly melanoma, myeloma, small cell lung cancer, thymic lymphoma, T-cell lymphoma, B-cell lymphoma, osteosarcoma, and acute T-cell leukemia, are disclosed. Illustrative compositions include one or more anti-ganglioside antibodies and polynucleotides that encode such anti-ganglioside antibodies. These antibodies may be for example, hamster ... 11/23/06 - 20060263373 - Utilization of an aminopeptidase inhibitor The invention concerns the utilization of at least one aminopeptidase inhibitor for the production of a medicament used in the treatment of tumor diseases and/or immune diseases, whereby the at least one aminopeptidase inhibitor causes blocking of polarization of invasive human or animal tumor and/or immune cells by modifying at ... 11/23/06 - 20060263372 - Cancerous disease modifying antibodies The present invention relates to a method for producing patient cancerous disease modifying antibodies using a novel paradigm of screening. By segregating the anti-cancer antibodies using cancer cell cytotoxicity as an end point, the process makes possible the production of anti-cancer antibodies for therapeutic and diagnostic purposes. The antibodies can ... 11/23/06 - 20060263371 - Prognostic indicator A prognostic indicator for metastasis comprises an antibody directed against osteopontin. ... 11/23/06 - 20060263370 - Prognostic indicator A prognostic indicator for metastasis comprises an antibody directed against osteopontin. ... 11/23/06 - 20060263369 - Antibodies, polypeptides and uses thereof A method of inhibiting angiogenesis in an individual in need thereof comprising administering an antibody that selectively binds to the extracellular region of human magic roundabout (MR) to the individual. An antibody that has the amino acid sequences i) to iii), the amino acid sequences iv) to vi), or the ... 11/23/06 - 20060263368 - Targeted chimeric molecules for cancer therapy The present invention concerns chimeric cancer therapeutic molecules comprising a targeting moiety and an anti-cell proliferation moiety. The anti-cell proliferation moiety may comprise a cytotoxic agent or an apoptosis-inducing factor, in specific embodiments. In particular embodiments, the anti-cell proliferation mechanism of the chimeric molecules comprises apoptotic pathways. In additional embodiments, ... 11/23/06 - 20060263367 - Bispecific antibody devoid of fc region and method of treatment using same Bispecific antibody derivatives are disclosed which are comprised of a first region which binds to a first antigen and a second region which binds to a second antigen different from the first antigen. The first and second regions of the bispecific antibody are each stabilized by an additional internal disulfide ... 11/23/06 - 20060263366 - Neoplasm specific antibodies and uses thereof The present invention features polypeptides, such as antibodies, and their use in the treatment and diagnosis of neoplasms. ... 11/16/06 - 20060257410 - Reagents that bind ccx-ckr2 Antibodies that bind to CCX-CKR2 and methods of their use are provided. ... 11/16/06 - 20060257409 - Breast specific genes and proteins Human breast specific gene polypeptides and DNA (RNA) encoding such polypeptides and a procedure for producing such polypeptides by recombinant techniques is disclosed. Also disclosed are methods for utilizing such polynucleotides or polypeptides as a diagnostic marker for breast cancer and as an agent to determine if breast cancer has ... 11/09/06 - 20060251662 - Compositions and methods for the treatment of tumor of hematopoietic origin The present invention is directed to compositions of matter useful for the treatment of hematopoietic tumor in mammals and to methods of using those compositions of matter for the same. ... 11/09/06 - 20060251661 - Tumor lesion regression and conversion in situ into autologous tumor vaccines by compositions that result in anti-gal antibody binding The present invention discloses that an intratumoral injection of: i) glycolipids with α-gal epitope; ii) gene vectors comprising an α1,3galactosyltransferase gene; or iii) a mixture of α1,3galactosyltransferase, neuraminidase, and uridine diphosphate galactose results in tumor regression and/or destruction. Binding of the natural anti-Gal antibody to de novo expressed tumoral α-gal ... 11/02/06 - 20060246078 - Method for screening transcriptional coregulatory proteins of transcription factors, and androgen receptor transcriptional coregulatory proteins as targets for androgen receptor-dependent diseases The present invention also provides a method for screening and isolating transcriptional coregulatory proteins of transcription factors. Using this method, a new class of proteins, androgen receptor transcriptional coregulatory proteins, that interact with the androgen receptor N-terminus to regulate transcriptional activation, which are targets for identifying and isolating inhibitors that ... 11/02/06 - 20060246077 - Use of antibodies against the muc18 antigen The present invention relates generally to the generation and characterization of anti-MUC18 monoclonal antibodies. The invention further relates to the use of such anti-MUC18 antibodies in the diagnosis and treatment of disorders associated with increased activity of MUC18, in particular, tumors, such as melanomas. ... 10/26/06 - 20060240027 - Individualized anti-cancer antibodies The present invention relates to a method for producing patient specific anti-cancer antibodies using a novel paradigm of screening. By segregating the anti-cancer antibodies using cancer cell cytotoxicity as an end point, the process makes possible the production of anti-cancer antibodies customized for the individual patient that can be used ... 10/26/06 - 20060240026 - Preventing and/or remedy hematopoietic tumor In the present invention, a useful molecular target for a specific immunotherapy of hematologic malignancies was found, and a means capable of preventing and/or treating hematologic malignancies was provided. Specifically, provided were the followings: an agent for preventing and/or treating hematologic malignancies comprising as an active ingredient at least one ... 10/26/06 - 20060240025 - Rtvp-glipr-like compositions and methods for the detection, treatment and prevention of prostate cancer The invention is directed to purified and isolated novel RGL polypeptides, the nucleic acids encoding such polypeptides, processes for production of recombinant forms of such polypeptides, antibodies generated against these polypeptides, fragmented peptides derived from these polypeptides, and the uses of the above. ... 10/26/06 - 20060240024 - T cell regulation Regulatory T cells (Treg) limit autoimmunity but can also attenuate the magnitude of anti-pathogen and anti-tumor immunity. Understanding the mechanism of Treg function and therapeutic manipulation of Treg in vivo requires identification of Treg selective receptors. A comparative analysis of gene expression arrays from antigen specific CD4+ T cells differentiating ... 10/26/06 - 20060240023 - Apoptosis-associated protein and use thereof The present invention provides a partial peptide comprising the functional domain of a protein comprising an amino acid sequence which is the same or substantially the same as an amino acid sequence represented by SEQ ID NO:2 or SEQ ID NO: 4; a screening method and a kit therefor for ... 10/26/06 - 20060240022 - Factor involved in metastasis and uses thereof The present invention is related to a nucleic acid coding for a factor involved in a biological process, whereby the process is a PI 3-kinase pathway regulated process, preferably a process selected from the group comprising glucose metabolism, amino acid and glucose deprivation processes, diabetes, wound healing, stress response, apoptosis, ... < |