FREE patent keyword monitoring and additional FREE benefits. /images/triangleright (1K) REGISTER now for FREE triangleleft (1K)
Fresh Patents
Monitor Patents Patent Organizer How to File a Provisional Patent Browse Inventors Browse Industry Browse Agents Browse Locations


Drug, Bio-affecting And Body Treating Compositions > Lymphokine

Lymphokine

Lymphokine patent applications listed are from June 2005 to current and include Date, Patent Application Number, Patent Title, Patent Abstract summary and are linked to the corresponding patent application page.

08/16/07 - 20070190023 - Methods and compositions for modulating the mobilization of stem cells
Methods and compositions for modulating the mobilization of stem cells, particularly for promoting or increasing the mobilization of hematopoietic stem cells from the bone marrow to the peripheral blood are disclosed. In particular, the invention relates to the use of adrenergic agonists that act in concert with a mobilization compound ...

08/16/07 - 20070190022 - Combination methods of treating cancer
The present invention relates to a method of treating cancer in a subject in need thereof, by administering to a subject in need thereof a first amount of a histone deacetylase (HDAC) inhibitor or a pharmaceutically acceptable salt or hydrate thereof, in a first treatment procedure, and a second amount ...

08/09/07 - 20070184020 - Combination of radio waves with pharmacologically active substances
The invention relates to a combination of radio waves with pharmacologically active substances chosen from the group: a) monoclonal antibodies and/or b) tyrosine-kinase inhibitors and/or c) angiogenesis inhibitors and/or d) farnesyl-transferase inhibitors and/or e) topoisomerase-I or -II inhibitors and/or f) cytokines and/or g) antisense oligonucleotides. optionally together with one or ...

08/09/07 - 20070184019 - Pharmaceutical composition comprising an active principal and sulphobetaine
The present invention relates to the pharmaceutical composition comprising a non-detergent sulphobetaine (NDSB). ...

07/26/07 - 20070172450 - Modulation of immune response and methods based thereon
The present invention relates to methods for the prevention and/or treatment of cardiovascular and allergic diseases and disorders, methods for inhibiting the growth of, or reducing the volume of, a solid tumor, as well as methods for preventing progression to AIDS in an HIV-infected human, by administering a peptide derived ...

07/26/07 - 20070172449 - Tnf-alpha variant formulations for the treatment of tnf-alpha related disorders
Combination therapies comprising novel TNF-α proteins for the treatment of TNF-α related disorders are provided herein. ...

07/26/07 - 20070172448 - method for detecting the specificity of activated lymphocyte
A method for detecting the specificity of activated lymphocytes is provided. The present method can be used to detect the specificity of activated lymphocytes in recipients or patients after organ transplantation or being infected by pathogenic microorganism or vaccination. The establishment of the present invention can not only timely diagnose ...

07/26/07 - 20070172447 - Agent for preventing and/or treating tissue disruption-accompanied diseases
The present invention relates to an agent for preventing and/or treating diseases accompanied by tissue disruption, which comprises a polypeptide having granulocyte colony-stimulating factor activity as an active ingredient, and a medicament for mobilizing a multipotent stem cell from a tissue into peripheral blood, which comprises a polypeptide having granulocyte ...

07/26/07 - 20070172446 - Synthetic chemokine receptor ligands and methods of use thereof
IIPASQFCPRIEIIATLKNGVQTCLNPDSKQARLIIKKVSKEMSKRSP ...

07/19/07 - 20070166281 - Chloroquine coupled antibodies and other proteins with methods for their synthesis
This invention discloses compositions of chloroquine-coupled active agents such as therapeutic antibodies or insulin, including methods for their preparation. The prior art has shown that chloroquines given as free drug in high enough concentration, enhances the release of various agents from cellular endosomes into the cytoplasm. The purpose of these ...

07/19/07 - 20070166280 - Chemokines as adjuvants of immune response
Dendritic cells play a critical role in antigen-specific immune responses. Materials and methods are provided for treating disease states, including cancer, infectious diseases, autoimmune diseases, transplantation, and allergy by facilitating or inhibiting the migration or activation of a specific subset of antigen-presenting dendritic cells known as plasmacytoid dendritic cells (pDC). ...

07/19/07 - 20070166279 - Method for modulating hla class ii tumor cell surface expression with a cytokine mixture
A method for altering the composition of tumor infiltrating mononuclear cells, increasing CD4+/CD8+ ratio, increasing tumor stroma/epithelial ratio and modulating HLA (Human Leukocyte Antigen) class II expression on a tumor cell surface with a serum-free and mitogen-free mixture having specific cytokine ratios from the group of IL-1β, TNF-α, IFN-γ, GM-CSF, ...

07/19/07 - 20070166278 - Novel g-csf conjugates
The present application relates to novel PEG-G-CSF conjugates in which a PEG molecule is linked to the cyteine residue in position 17 of native G-CSF primary sequence or to the cysteine residue of the corresponding position of a G-CSF analogue. The present application also describes a process for the manufacture ...

07/12/07 - 20070160575 - Anth1 chimeric antagonist
A recombinant chimeric antagonist formed by a 60 amino acid fragment of the N-terminal region of human interleukin 2 (IL-2) fused to the N-terminal of the extracellular region of the alpha subunit of the gamma IFN (IFN γ) receptor. In vitro this protein has a T cell growth stimulating activity, ...

07/12/07 - 20070160574 - Design of cxc chemokine analogs for the treatment of human diseases
The present invention generally relates to the design, preparation, derivation, and use of mimetics of CXC chemokines (CXCL1-CXCL17) in the prevention, treatment, and ameliorization of a wide variety of diseases and disorders. Generally speaking, this invention is directed to the design, synthesis, and use of chemokine analogs which bind to ...

07/12/07 - 20070160573 - Peptide conjugated anti-cancer prodrugs
The present invention relates to pharmaceutical compositions that include a targeting peptide, a protease specific cleavable peptide, and a chemotherapeutic drug that when conjugated are substantially inactive, but upon degradation of the cleavable sequence by a proteolytic enzyme abundant in or within the target cancer cell, the chemotherapeutic drug is ...

07/12/07 - 20070160572 - Colloidal metal compositions and methods
The present invention comprises compositions and methods for delivery systems of agents, including therapeutic compounds, pharmaceutical agents, drugs, detection agents, nucleic acid sequences and biological factors. In general, these vector compositions comprise a colloidal metal, derivatized PEG (polyethylene glycol) and an agent. The invention also comprises methods and compositions for ...

07/12/07 - 20070160571 - Composition and method for inducing protective vaccine response
A method for inducing a protective immune response is disclosed, the method utilizing a composition comprising a CXCR3-binding chemokine such as CXCL10 (IP-10) administered in conjunction with a protein, peptide, polynucleotide, or other target antigen. ...

07/12/07 - 20070160570 - Chimeric polypeptides containing chemokine domains
This invention provides a chimeric DNA molecule comprising a sequence encoding a chemokine polypeptide covalently attached to a heterologous polypeptide, the encoded chimeric polypeptide, and uses thereof. ...

07/05/07 - 20070154450 - Blocking leukocyte emigration and inflammation by interfering with cd99/hec2
The present invention provides methods and compositions for modulating transendothelial migration (TEM) of leukocytes. In particular, inhibition of TEM can provide a potent therapeutic approach to treating inflammatory conditions. The invention specifically relates to the discovery that CD99 mediates TEM, because blocking CD99 on either endothelial cells or monocytes bloks ...

07/05/07 - 20070154449 - Tight junction modulating peptides for enhanced mucosal delivery of therapeutic compounds
Compositions and methods are provided that include a biologically active agent and a permeabilizing agent effective to enhance mucosal delivery of the biologically active agent in a mammalian subject, in which the permeabilizing peptide is a tight junction modulating peptide (TJMP), a TJMP analogue, a conjugate of a TJMP, a ...

07/05/07 - 20070154448 - Methods and compositions using substance p to promote wound healing
Healing of wounds in mammalian tissue may be enhanced by the application of certain neuropeptides, optionally in combination with known growth promoting hormones. Exemplary neuropeptides include tachykinins, such as Substance P, Substance K, and the like, as well as calcitonin gene-related peptides. The compositions may further include a polymeric delivery ...

06/28/07 - 20070148131 - Methods and compositions for needleless delivery of binding partners
The present invention relates, in part, to methods and compositions for needleless delivery of macromolecules to a subject. In one aspect, the methods and compositions involve administering to the subject a delivery construct comprising a carrier construct non-covalently bound to a binding partner, wherein the carrier construct comprises a receptor-binding ...

06/28/07 - 20070148130 - Native trre: protein implicated in tnf receptor shedding for treating arthritis and inflammation
This disclosure provides a new family of proteins implicated in causing the release of TNF receptors and other cytokine receptors from the surface of cells involved in inflammation. Receptor releasing activity was isolated and purified from a monocyte cell line, and sequenced to deduce the gene and protein structure of ...

06/28/07 - 20070148129 - Therapeutic agents and uses therefor
The present invention relates generally to therapeutic agents and methods which enhance or otherwise maintain a state of immune tolerance in a subject. The present invention further provides agents and methods for preventing or at least delaying onset of an autoimmune disease such as but not limited to autoimmune diabetes. ...

06/21/07 - 20070141025 - Compositions and methods for cancer immunotherapy
Provided is a cancer therapeutic agent comprising a cancer targeting molecule linked to a liver-expressed chemokine (LEC). In one embodiment, the cancer targeting molecule is an antibody that targets cancer cells or tumors in vivo. The cancer targeting molecule is associated non-covalently or covalently with LEC. The cancer therapeutic agents ...

06/21/07 - 20070141024 - Mammalian cytokine; reagents and methods
Provided are cytokines and methods of modulating activity of the immune system using cytokine agonists or antagonists. Also provided are methods of treatment and diagnosis of immune and proliferative disorders. ...

06/21/07 - 20070141023 - Assays and methods using biomarkers
Methods and assays examining expression of one or more biomarkers in a mammalian tissue or cell sample are provided. According to the disclosed methods and assays, detection of the expression of one or more such biomarkers is predictive or indicative that the tissue or cell sample will be sensitive to ...

06/14/07 - 20070134198 - Composition and use of rar antagonists for promoting chondrogenesis
The invention provides compositions comprising a RAR antagonist for promoting chondrogenesis and to methods employing such compositions for treating cartilage and associated bone abnormalities resulting from injury or disease and for ex vivo tissue engineering. ...

06/14/07 - 20070134197 - Conjugates of hydroxyalkyl starch and a protein, prepared by reductive amination
Conjugates of hydroxyalkyl starch and a protein are provided. The conjugates are formed by a reductive amination reaction between at least one aldehyde group or keto group or hemiacetal group of the hydroxyalkyl starch or of a derivative of the hydroxyalkyl starch, and at least one amino group of the ...

06/07/07 - 20070128159 - Chemokines as adjuvants of immune response
Dendritc cells play a critical role in antigen-specific immune responses. Materials and methods are provided for treating disease states, including cancer and autoimmune disease, by facilitating or inhibiting the migration or activation of antigen-presenting dendritic cells. In particular, chemokines are used to initiate, amplify or modulate an immune response. In ...

06/07/07 - 20070128158 - Cytokine protein family
The present invention relates to polynucleotide and polypeptide molecules for zcyto20, zcyto21, zcyto22, zycto24, and zcyto25 proteins which are most closely related to interferon-α at the amino acid sequence level. The receptor for this protein family is a class II cytokine receptor. The present invention includes methods of reducing viral ...

06/07/07 - 20070128157 - Tumour suppressor protein
We describe a polypeptide which binds and modulates the activity of a tumour suppressor polypeptide, for example p53; a nucleic acid molecule encoding said protein and screening methods which modulate the binding activity of said polypeptide for its target polypeptide(s). ...

05/31/07 - 20070122381 - Method for regulating neuron development and maintenance
The present invention relates to a method for regulating neuron development/maintenance and/or regeneration in a nervous system of a mammal and to pharmaceutical compositions comprising leukaemia inhibitory factor useful for same. ...

05/31/07 - 20070122380 - Chimeric cytokine of il-7 and beta-chain of hgf and methods of use
The present invention relates to a single-chain or chimeric polypeptide comprising a cytokine and a growth factor linked by at least one amino acid residue, and wherein the chimeric polypeptide enhances the proliferation and/or differentiation of hematopoietic precursor cells. In particular the invention relates to, a chimeric polypeptide comprising the ...

05/31/07 - 20070122379 - Combined tumor suppressor gene therapy and chemotherapy in the treatment of neoplasms
In one embodiment, this invention provides methods of treating mammalian cancer or hyperproliferative cells, said method comprising contacting said cells with a tumor suppressor protein or tumor suppressor nucleic acid and also contacting said cell with at least one adjunctive anti-cancer agent. The invention also provides for a pharmacological composition ...

05/31/07 - 20070122378 - Methods and compositions for the treatment of persistent infections
The present invention provides methods and compositions for the treatment, prevention, or reduction of persistent infections, such as chronic infections, latent infections, and slow infections and cancer. The methods and compositions of the invention are also useful for the alleviation of one or more symptoms associated with such infections and ...

05/31/07 - 20070122377 - Compositions and methods of treatment
A method of inducing tolerance to a therapeutic cell in a patient who is to be administered subsequently a therapeutic amount of the said therapeutic cell or a precursor thereof, the method comprising administering to the patient (a) a tolerising cell sharing the same antigenic characteristics as the therapeutic cell, ...

05/24/07 - 20070116669 - Interferon-inducible protein-10 (ip-10 or cxcl10) chemokine analogs for the treatment of human diseases
This invention is directed to peptide analogs of interferon-inducible protein-10 (IP-10 or CXCL10) chemokine that bind to the CXCR3 receptor or any other receptor in which IP-10 analogs can bind to as a ligand, such that the analogs can be designed to serve as agonists or antagonists of IP-10 chemokine. ...

05/24/07 - 20070116668 - Lymphotoxin-beta, lymphotoxin-beta complexes, pharmaceutical preparations and therapeutic uses thereof
This invention relates to lymphotoxin-β, a lymphocyte membrane type protein. This protein is found on the surface of a number of cells, including phorbol ester (PMA) stimulated T cell hybridoma II-23.D7 cells. This invention also relates to complexes formed between lymphotoxin-β and other peptides such as lymphotoxin-α and to complexes ...

05/17/07 - 20070110712 - Method of modulating fertility in animals
The present invention relates generally to a method for controlling fertility and/or modulating the maintenance of pregnancy in animals. The present invention further provides an animal model useful for screening for therapeutic agents to treat infertility, to prevent or reduce spontaneous abortion and/or as contraceptive agents in animals. ...

05/17/07 - 20070110711 - Agent for enhancing the production of cytokines and/or chemokines
The present invention has an object to provide a means to effectively enhance the production of cytokines and/or chemokines in mammals. The object is solved by providing an agent for enhancing the production of cytokines and/or chemokines, which comprises, as an effective ingredient, a polypeptide having any one of the ...

05/17/07 - 20070110710 - Treatment with immunoregulatory t cells
Methods and compositions are provided for the treatment of an autoimmune disease. The methods include administering immunoregulatory T cells (Tregs) to patients. The therapeutic Tregs can express the CD25, CD4, and/or ICOS antigens. The therapeutic T cells can be CD25+ ICOS+, CD4+ICOS+, and/or CD25+ CD4+ ICOS+, and they can be ...

05/10/07 - 20070104680 - Antibodies to natural killer stimulatory factor
This application relates to antibodies reactive with a novel homogenous human cytokine, Natural Killer Stimulator Factor (NKSF), having the ability to induce the production of gamia interferon in vitro in human peripheral blood lymphocytes, and a pharmaceutical preparation containing such antibodies. ...

05/10/07 - 20070104679 - Induction of differentiation of stem cells, and control of differentiation potency of stem cells
This invention provides a method to induce the differentiation of animal cells wherein said cells are brought into contact with cytokine only in a suitable growth phase of animal cells, and also provides a system to control the differentiation potency of animal cells wherein two or more cytokines are combined ...

05/03/07 - 20070098683 - Cytokine zalpha11 ligand antibodies
Antibodies that bind to polypeptides and peptides comprising the sequence of zalpha11 Ligand as shown in SEQ ID NO: 2 are described. The antibodies may bind the full length sequence of 162 amino acid residues or a fragment thereof, including a mature polypeptide of 131 amino acid residues and smaller ...

05/03/07 - 20070098682 - Cytokine zalpha11 ligand antibodies
Antibodies that bind to polypeptides and peptides comprising the sequence of zalpha11 Ligand as shown in SEQ ID NO: 2 are described. The antibodies may bind the full length sequence of 162 amino acid residues or a fragment thereof, including a mature polypeptide of 131 amino acid residues and smaller ...

05/03/07 - 20070098681 - Apo-2 ligand/trail variants and uses thereof
The disclosure provides Apo-2 ligand variant polypeptides. Methods of making and chemically modifying Apo-2 ligand variant polypeptides are also provided. In addition, formulations of Apo-2 ligand variant polypeptides are provided. In addition, therapeutic methods for using Apo-2 ligand variant polypeptides are provided. ...

05/03/07 - 20070098680 - Agent for treating diabetes mellitus
The object of the present invention is to provide a method for treating diabetes which is simple, safe and effective when compared to conventional diabetes treatment. The administration of one or more stem cell-recruiting factors allows a simple and safe repair of disrupted β-cells in pancreatic Langerhans' islets. Thus, the ...

04/26/07 - 20070092486 - Glycolated and glycosylated poultry derived therapeutic proteins
Compositions containing a glycosylated therapeutic amino acid sequence obtained from a transgenic avian wherein the therapeutic amino acid sequence is a glycoprotein and includes a covalently bonded glycol polymer. ...

04/26/07 - 20070092485 - Cytokine zalpha11 ligand
Antibodies that bind to polypeptides and peptides comprising the sequence of zalpha11 Ligand as shown in SEQ ID NO: 2 are described. The antibodies may bind the full length sequence of 162 amino acid residues or a fragment thereof, including a mature polypeptide of 131 amino acid residues and smaller ...

04/26/07 - 20070092484 - Mcp-1 splice variants and methods of using same
Novel MCP-1 splice variant polypeptides and polynucleotides encoding same are provided. Also provided are pharmaceutical compositions comprising the splice variant polypeptides and polynucleotides, vectors and host cells comprising same. The compositions of the present invention are useful to treat various MCP-1 related disorders as well as for diagnosing, determining predisposition ...

04/19/07 - 20070086979 - Methods and compositions for use in treatment of patients with autoantibody positive disease
The present invention relates to methods and compositions for use in treatment of patients with autoantibody positive disease. In a specific embodiment, the present invention relates to a method of treating a patient that has an ANA titer of 1:80 or greater and/or greater than or equal to 30 IU/ml ...

04/12/07 - 20070081973 - Cytokine polypeptides
This invention relates to IMX129840 cytokines, including new mammalian cytokine polypeptides; to methods of making such polypeptides; to methods of using them to treat conditions and diseases involving proliferation and/or differentiation of cells from pluripotent stem cell precursors; and to methods of identifying compounds that alter IMX129840 cytokine polypeptide activities. ...

04/12/07 - 20070081972 - Polymer-based delivery system for immunotherapy of cancer
The present invention relates to the treatment of cancer using a polymer-based delivery system to provide a plurality of tumor cell antigens to a immunocompetent subject in conjunction with an immunodulatory substance. ...

04/12/07 - 20070081971 - Stable pharmaceutical compostion comprising granulocyte-colony stimulating factor
The present invention provides a new stable pharmaceutical composition of granulocyte-colony stimulating factor (G-CSF). ...

04/12/07 - 20070081970 - G-csf-containing substance for fibroblast recruitment and g-csf-contianing therapeutic agent for wound healing
The object of the present invention is to achieve simple recruitment of fibroblasts into wounded tissues and engraftment of the fibroblasts in the wounded tissues, thereby healing the wounds without requiring fibroblast transplantation. Upon G-CSF administration, fibroblasts migrate into myocardial infarct lesions and prevent a reduction in cardiac function, thus ...

04/05/07 - 20070077224 - Regulation of t cell-mediated immunity by tryptophan
A mechanism of macrophage-induced T cell suppression is the selective elimination of tryptophan and/or increase in one or more tryptophan metabolites within the local macrophage microenvironment. Studies demonstrate that expression of IDO can serve as a marker of suppression of T cell activation, and may play a significant role in ...

03/29/07 - 20070071718 - Treatment with anti-vegf antibodies
This invention concerns in general treatment of diseases and pathological conditions with anti-VEGF antibodies. More specifically, the invention concerns the treatment of human patients susceptible to or diagnosed with cancer using an anti-VEGF antibody, preferably in combination with one or more additional anti-tumor therapeutic agents. ...

03/29/07 - 20070071717 - Treatment of b cells with il-21 and b cell activators induces granzyme b production
The present invention involves the combined use of IL-21 and TLR agonists such as CpG oligonucleotides in the treatment of B cell cancers and B cell-related immune pathologies such as autoimmune diseases. In addition, it is demonstrated that human B cells produce and secrete varying amounts of Granzyme B in ...

03/29/07 - 20070071716 - Compositions and methods for healthy pregnancy
Compositions, kits and methods for the prevention of, for example, spontaneous abortion, preeclampsia, preterm labor or implantation failure during assisted reproduction are provided. The compositions, kits and methods provide an effective amount of granulocyte colony stimulating factor to prevent, for example, spontaneous abortion, preeclampsia, preterm labor or implantation failure of ...

03/15/07 - 20070059282 - Immunocytokine sequences and uses thereof
The invention provides a family of antibodies that specifically bind the human cell surface glycosphingolipid GD2. The antibodies comprise modified variable regions, more specially, modified framework regions, which reduce their immunogenicity when administered to a human. The antibodies may be coupled to a therapeutic agent and used in the treatment ...

03/15/07 - 20070059281 - Composite bone graft substitute cement and articles produced therefrom
The invention provides a particulate composition adapted for forming a bone graft substitute cement upon mixing with an aqueous solution, including i) a calcium sulfate hemihydrate powder having a bimodal particle distribution and a median particle size of about 5 to about 20 microns, wherein the calcium sulfate hemihydrate is ...

03/15/07 - 20070059280 - Inhibitors of colony stimulating factors
A hematopoetic factor called “colony stimulating factor” (CSF) is capable of synergizing the attracting capabilities of chemokines and of inducing the accumulation and/or activation in vitro and in vivo of key components of inflammatory responses. Various types of agents that inhibit or otherwise hinder the production, release or activity of ...

03/15/07 - 20070059279 - Pharmaceutical composition for preventing or treating malignant glioma
An object of the present invention is to provide a novel malignant glioma antitumor agent and malignant glioma antitumor agent for animals, and in order to achieve this object, in the present invention a polypeptide indicated by the following (a) or (b), or a mixture thereof, is contained in a ...

03/08/07 - 20070053871 - Pharmaceutical formulations
A method of stabilizing an aqueous protein or antibody formulation is disclosed herein. Additionally, stable pharmaceutical formulations are contemplated which comprise a biologically active protein, a destabilizing concentration of preservative and a stabilizing concentration of osmolyte. ...

03/08/07 - 20070053870 - Polysaccharide-functionalized nanoparticle, drug delivery system for controlled release comprising the same and preparation method thereof
The present invention provides a polysaccharide-functionalized nanoparticle, a drug delivery system for controlled release comprising the nanoparticle and a preparation method thereof. In particular, the nanoparticle of the present invention comprises a core of a biodegradable polymer, an outer hydrogel layer of a biocompatible polymer emulsifier and a polysaccharide physically ...

03/01/07 - 20070048260 - Cytokine zalpha11 ligand fusion proteins
Antibodies that bind to polypeptides and peptides comprising the sequence of zalpha11 Ligand as shown in SEQ ID NO: 2 are described. The antibodies may bind the full length sequence of 162 amino acid residues or a fragment thereof, including a mature polypeptide of 131 amino acid residues and smaller ...

03/01/07 - 20070048259 - Cytokine zalpha11 ligand
Antibodies that bind to polypeptides and peptides comprising the sequence of zalpha11 Ligand as shown in SEQ ID NO: 2 are described. The antibodies may bind the full length sequence of 162 amino acid residues or a fragment thereof, including a mature polypeptide of 131 amino acid residues and smaller ...

03/01/07 - 20070048258 - Use of human zven proteins and polynucleotides
The present invention provides methods of using Zven1 and Zven2 polypeptides to increase chemokine production. The present invention also provides methods for treating intestinal motility disorders and improving gastrointestinal function with Zven1 and Zven2 polypeptides. ...

03/01/07 - 20070048257 - Soluble zcytor14, anti-zcytor14 antibodies and binding partners and methods of using in inflammation
The present invention relates to blocking, inhibiting, reducing, antagonizing or neutralizing the activity of IL-17F, IL-17A, or both IL-17A and IL-17F polypeptide molecules. IL-17A and IL-17F are cytokines that are involved in inflammatory processes and human disease. ZcytoR14 is a common receptor for IL-17A and IL-17F. The present invention includes ...

03/01/07 - 20070048256 - Chemokine beta-15
The present invention concerns a member of the human chemokine CC protein family. In particular, isolated nucleic acid molecules are provided encoding the chemokine β-15 protein. Chemokine β-15 polypeptides are also provided. The invention further concerns diagnostic methods for detecting thymus disorders and therapeutic methods for modulating bone marrow cell ...

03/01/07 - 20070048255 - Method for treatment of demyelinating central nervous system disease
A method for treating demyelinating central nervous system diseases in a subject that comprises administering to the subject a composition comprising a therapeutically active amount of colony stimulating factor or CSF-like ligand. In a preferred embodiment of the present invention, the CSF is a GM-CSF. In a most preferred embodiment ...

03/01/07 - 20070048254 - Generation of dendritic cells
A method is provided for expanding the population of mature dendritic cells in an individual subject. Proper timing of sequential delivery of Flt3-L and GM-CSF provides improved expansion of mature dendritic cell populations over methods currently employed in the art. The expansion of mature dendritic cells can be used to ...

03/01/07 - 20070048253 - Natively glycosylated mammalian biological molecules produced by electromagnetically stimulating living mammalian cells
A composition is disclosed with the composition comprising a mixture of natively glycosylated mammalian biological molecules produced by electromagnetically stimulating living mammalian cells. ...

02/22/07 - 20070041939 - Modified cytokines for use in cancer therapy
Cytokine derivatives capable of homing the tumoral vessels and the antigen presenting cells and the use thereof as antitumoral agents. ...

02/22/07 - 20070041938 - Stable aqueous solutions of granulocyte macrophage colony-stimulating factor
The invention provides formulations of GM-CSF that comprise chelating agents. The chelating agents stabilize the GM-CSF against N-terminal degradation and allow for rapid absorption of GM-CSF upon administration. ...

02/22/07 - 20070041937 - G-csf derivative for inducing immunological tolerance
The invention relates to a method, composition and use thereof for inducing immunological tolerance, in particular transplantation tolerance in a recipient and self-tolerance in a patient. Tolerance is preferably induced by administering a G-CSF derivative, or biologically active fragment, homolog or variant thereof, in particular peg-G-CSF, to a transplantation donor. ...

02/15/07 - 20070036752 - Il-2 fusion proteins with modulated selectivity
The invention provides cytokine fusion proteins with an increased therapeutic index, and methods to increase the therapeutic index of such fusion proteins. The fusion proteins of the invention are able to bind to more than one type of cytokine receptor expressed on cells and also bind to more than one ...

02/15/07 - 20070036751 - Methods for treatment of tumors and metastases using a combination of anti-angiogenic and immuno therapies
The invention provides methods for treating tumors and tumor metastases in a mammal comprising administering, to a mammal in need of treatment, a therapeutic amount of an antagonist sufficient to inhibit angiogenesis in combination with a therapeutic amount of anti-tumor immunotherapeutic agent, such as a anti-tumor antigen antibody/cytokine fusion protein ...

02/15/07 - 20070036750 - Mcp1 fusions
The present invention provides polypeptides including MCP1 fused, optionally, by a linker, to an immunoglobulin. Methods for using the polypeptides to treat medical disorders are also covered. ...

02/15/07 - 20070036749 - Method of determining cytokine dosage for myelosuppressive state
The invention provides kits and methods for evaluating the myelosuppressive state of a patient. These methods and kits provide a useful adjunct for cytotoxic and myelosuppressive therapies. By establishing threshold levels of certain cytokines as a surrogate for myelosuppression, treatment protocols can be optimized to reduce myelotoxicity, while maximizing effective ...

02/15/07 - 20070036748 - Combination therapies for cancer
The present invention relates to methods of inducing expression of a polynucleotide encoding a therapeutic polypeptide, e.g., TNF-α, in a cell comprising contacting the cell with a construct comprising an Egr-1 promoter operably linked to a polynucleotide encoding the polypeptide, and at least one chemotherapeutic agent, wherein the chemotherapeutic agent ...

02/15/07 - 20070036747 - Pharmaceutical combination useful for stem cell mobilization
Combined pharmaceutical preparation containing G-CSF and P1GF as the active substances, are useful in the mobilization of blood stem cells in a patient or subject in need thereof. ...

02/08/07 - 20070031373 - Reversal of adult onset disorders with granulocyte-colony stimulating factors
A method for treating adult onset neurodegenerative diseases and diabetes by administering an effective dose of Granulocyte-Colony Stimulating Factors. ...

02/08/07 - 20070031372 - Vaccine immunotherapy for immune suppressed patients
A method of immunotherapy to treat cancer or a synergistic anti-cancer treatment by administering an effective amount of a natural cytokine mixture (NCM), an effective amount of cyclophosphamide (CY), or an effective amount of indomethacin (INDO), wherein the NCM, CY, or INDO are administered singly or in communications thereof. An ...

02/01/07 - 20070025959 - Adjuvant combination formulations
The use of an aminoalkyl glucosamine phosphate compound, or a derivative or analog thereof, in combination with a cytokine or lymphokine such as granulocyte macrophage colony stimulating factor or interleukin-12, is useful as an adjuvant combination in an antigenic composition to enhance the immune response in a vertebrate host to ...

02/01/07 - 20070025958 - Vaccine immunotherapy
The present invention provides compositions and methods of immunotherapy to treat cancer or other antigen-producing diseases or lesions. According to one embodiment of the invention, a composition is provided for eliciting an immune response to at least one antigen in a patient having an antigen-producing disease or lesion, the composition ...

02/01/07 - 20070025957 - Vascular targeting of ocular neovascularization
Methods of treating or preventing eye disease in a subject, involving administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising a polypeptide having a vascular endothelial targeting amino acid sequence and a cytotoxic amino acid sequence are disclosed. For example, the vascular endothelial targeting amino acid ...

01/25/07 - 20070020232 - Compositions and methods for cancer immunotherapy
The invention relates to immunotherapeutic compounds and to methods for stimulating an immune response in a subject individual at risk for developing cancer, diagnosed with a cancer, in treatment for cancer, or in post-therapy recovery from cancer or the compounds of the invention can be administered as a prophylactic to ...

01/25/07 - 20070020231 - Remedy for kidney diseases
The present invention relates to therapeutic agents for renal diseases containing a colony-stimulating factor (CSF) as an active ingredient and renal tissue repairing/regenerating agents containing a colony-stimulating factor (CSF) as an active ingredient. The colony-stimulating factor (CSF) is preferably granulocyte colony-stimulating factor (G-CSF). ...

01/25/07 - 20070020230 - Use of chemokines, and pharmaceutical preparations containing the same
The present invention relates to the use of chemokines and/or nucleic acids encoding a chemokine for recruiting mesenchymal precursor and/or stem cells in vivo and in vitro. The present invention also relates to pharmaceutical preparations which comprise these substances and which are preferably intended for recruiting mesenchymal precursor and/or stem ...

01/18/07 - 20070014763 - Pegylated g-csf polypeptides and methods of producing same
A method for increasing the stability and uniformity of a PEGylated G-CSF polypeptide having at least one PEG moiety attached to the epsilon amino group of a lysine residue or the N-terminal amino group and at least one PEG moiety attached to a hydroxyl group, comprising subjecting the polypeptide to ...

01/18/07 - 20070014762 - Pegylated g-csf polypeptides and methods of producing same
A method for increasing the stability and uniformity of a PEGylated G-CSF polypeptide having at least one PEG moiety attached to the epsilon amino group of a lysine residue or the N-terminal amino group and at least one PEG moiety attached to a hydroxyl group, comprising subjecting the polypeptide to ...

01/18/07 - 20070014761 - Heterodimeric four helix bundle cytokines
Heterodimeric proteins comprising two helical bundle cytokines are disclosed. One of the polypeptides comprises zsig81 and a second polypeptide which comprises either p19 (aka IL-12A) or p35 (aka L-12A). The proteins may be produced as fusion proteins or expressed as a single chain. The heterdimeric protein comprising zsig81 and p19 ...

01/18/07 - 20070014760 - Enhanced recovery following ocular surgery
An ocular method comprising localized ocular administration of a pharmaceutically acceptable formulation and effective concentration of at least one neuro-stimulatory agent, which may include a macrolide, for a duration sufficient to at least partially restore corneal sensation, or at least one macrolide to reduce scarring after ocular surgery. The neuro-stimulatory ...

01/18/07 - 20070014759 - Glycopegylated granulocyte colony stimulating factor
The present invention provides conjugates between Granulocyte Colony Stimulating Factor and PEG moieties. The conjugates are linked via an intact glycosyl linking group that is interposed between and covalently attached to the peptide and the modifying group. The conjugates are formed from both glycosylated and unglycosylated peptides by the action ...

01/11/07 - 20070009478 - Pegylated g-csf polypeptides and methods of producing same
A method for increasing the stability and uniformity of a PEGylated G-CSF polypeptide having at least one PEG moiety attached to the epsilon amino group of a lysine residue or the N-terminal amino group and at least one PEG moiety attached to a hydroxyl group, comprising subjecting the polypeptide to ...

01/11/07 - 20070009477 - Methods for rational pegylation of proteins
The present invention relates to the use of simulation technology to rationally optimize the locations and sizes of attached polymeric moieties for modification of therapeutic proteins and the proteins generated from this method. ...

01/04/07 - 20070003514 - Mono-and bi-functional antibody conjugates as effective adjuvants of protein vaccination
The present invention provides methods of use of various antibody-immunostimulant fusion proteins as adjuvants of antigenic protein vaccinations to elicit humoral and/or cellular immune responses in vaccinated subjects. Compositions which include these fusion proteins and innate and/or exogenous antigenic proteins are also provided. ...

12/28/06 - 20060292114 - Neurturin receptor
NTNRα, NTNRα extracellular domain (ECD), NTNRα variants, chimeric NTNRα (e.g., NTNRα immunoadhesion), and antibodies which bind thereto (including agonist and neutralizing antibodies) are disclosed. Various uses for these molecules are described, including methods to modulate cell activity and survival by response to NTNRα-ligands, for example NTN, by providing NTNRα to ...

12/28/06 - 20060292113 - Prophylactic and therapeutic treatment of the ductal epithelium of a mammary gland for cancer
The present invention provides prophylactic and therapeutic methods of treating the ductal epithelium of an exocrine gland, in particular a mammary gland, for disease, in particular cancer. The methods comprise contacting the ductal epithelium of the exocrine gland with an epithelium destroying agent, preferably by ductal cannulation, so as to ...

12/21/06 - 20060286069 - G-csf conjugates
Polypeptide conjugates with G-CSF activity comprising a polypeptide having at least one introduced lysine residue and at least one removed lysine residue compared to the sequence of human G-CSF, and which are conjugated to 2-6 polyethylene glycol moieties. The conjugates have a low in vitro bioactivity, a long in vivo ...

12/21/06 - 20060286068 - G-csf conjugates
Polypeptide conjugates with G-CSF activity comprising a polypeptide having at least one introduced lysine residue and at least one removed lysine residue compared to the sequence of human G-CSF, and which are conjugated to 2-6 polyethylene glycol moieties. The conjugates have a low in vitro bioactivity, a long in vivo ...

12/21/06 - 20060286067 - Methods for making and using regulatory t cells
The invention is generally related to methods of making regulatory T cells and treating autoimmune diseases, including both antibody-mediated and cell-mediated disorders. ...

12/21/06 - 20060286066 - Pegylated immunoglobulin variable region polypeptides
The present invention encompasses a naturally occurring, or synthetic polymer-linked polypeptide comprising one or more antibody domains. ...

12/14/06 - 20060280722 - Treatment of follicular lymphomas using inhibitors of the lt pathway
Therapeutic uses of inhibitors of the Lymphotoxin Pathway to treat tumors, specifically to treat follicular lymphomas. ...

12/07/06 - 20060275258 - Interferon-alpha induced gene
The present invention relates to identification of a gene upregulated by interferon-α administration corresponding to the cDNA sequence set forth in SEQ. ID. No. 1. Determination of expression products of this gene is proposed as having utility in predicting responsiveness to treatment with interferon-α and other interferons which act at ...

12/07/06 - 20060275257 - G-csf conjugates
The invention relates to polypeptide conjugates comprising a polypeptide exhibiting G-CSF activity and having an amino acid sequence that differs from the amino acid sequence of human G-CSF in at least one specified introduced and/or removed amino acid residue comprising an attachment group for a non-polypeptide moiety, and having at ...

12/07/06 - 20060275256 - Inhibition of pathogenic agents including alpha6beta1 integrin receptor of alpha6beta4 integrin receptor at a surface
Disclosed are treatment agents and methods of treatment utilizing the agents directed toward diseases in which the disease causing pathogen includes α6β1 integrin receptors and/or α6β4 integrin receptors on the surface of the pathogen. In one embodiment, the disease can be breast cancer. The therapeutic agents disclosed include a polypeptide ...

12/07/06 - 20060275255 - Modulating apoptosis
The use and screening of modulators of apoptosis is disclosed. The modulators may be, for example, modulator of NF-κB activity. The modulators may be used, for example, in the treatment of NF-κB-mediated diseases, conditions, and injuries. ...

12/07/06 - 20060275254 - Pharmaceutical composition comprising an immunoglobulin fc region as a carrier
Disclosed is a novel use of an immunoglobulin Fe fragment, and more particularly, a pharmaceutical composition comprising an immunoglobulin Fe fragment as a carrier. The pharmaceutical composition comprising an immunoglobulin Fe fragment as a carrier remarkably extends the serum half-life of a drug while maintaining the in vivo activity of ...

11/23/06 - 20060263332 - Therapies for brain tissue damage
Methods of treating brain tissue damage and increasing expression of a trophic factor in a cell. ...

11/23/06 - 20060263331 - Therapeutic use of tumor necrosis factor-alpha mutein
Improved methods for treating neoplastic diseases such as cancer are provided by using muteins of human tumor necrosis factor-alpha (TNF-α). Compared to wild-type human TNF-α these therapeutic TNF muteins have higher specific anti-tumor activity, but with much reduced systemic toxicity and milder side effects such chills and fever. In addition, ...

11/16/06 - 20060257360 - Protein based tnf-alpha variants for the treatment of tnf-alpha related disorders
The invention relates to novel proteins with TNF-alpha antagonist activity and nucleic acids encoding these proteins. The invention further relates to the use of the novel proteins in the treatment of TNF-alpha related disorders. ...

11/16/06 - 20060257359 - Modifying macrophage phenotype for treatment of disease
The present invention provides compositions and methods for modulating one or more phenotypes of a macrophage-related cell, e.g., a macrophage. The invention further provides methods of treating disease by modulating macrophage phenotype. Representative phenotypes include pro-inflammatory, anti-inflammatory, immunogenic, tolerogenic, tissue-destructive, tissue restorative, cytotoxic, migratory, bone-resorbing, pro-angiogenic, anti-angiogenic, suppressor, antigen presentation, ...

11/16/06 - 20060257358 - Suspension of calcium phosphate particulates for local delivery of therapeutic agents
Disclosed herein are methods for preparing and using porous, crystalline biomimetic bioactive compositions of calcium phosphate with at least one therapeutic agent. The bioactive composition has strong adsorption properties for therapeutic agents which adsorb to the calcium phosphate with a high affinity. The bioactive composition also provides a sustained release ...

11/16/06 - 20060257357 - Method for modulating hla class ii tumor cell surface expression with a cytokine mixture
A method for altering the composition of tumor infiltrating mononuclear cells, increasing CD4+/CD8+ ratio, increasing tumor stroma/epithelial ratio and modulating HLA (Human Leukocyte Antigen) class II expression on a tumor cell surface with a serum-free and mitogen-free mixture having specific cytokine ratios from the group of IL-1β, TNF-α, IFN-γ, GM-CSF, ...

11/16/06 - 20060257356 - Epstein-barr virus-specific immunization
The invention provides materials and methods for using EBV EBNA2 peptide epitopes to treat and/or prevent post-transplant lymphoproliferative disorders (PTLD). The invention also provides compositions and articles of manufacture containing EBNA2 peptide epitopes that can be used to treat and/or prevent PTLD. ...

11/09/06 - 20060251616 - Migration of hematopoietic stem cells and progenitor cells to the liver
The invention relates to transplantation of hematopoietic stem cells (HSC) and/or progenitor cells (HPC) into the liver. More specifically the invention relates to the use of chemokines, preferably SDF-1, for enhancing homing of HSC/HPC to the liver. ...

11/09/06 - 20060251615 - Therapeutic agent for preventing and/or treating sepsis
A novel therapeutic agent for preventing and/or treating sepsis is provided. It has an excellent effects on sepsis caused by more than one factor selected from the group consisting of infectious disease, burn, surgery, cancer, AIDS, radiation therapy, chemotherapy and long term TPN. ...

11/02/06 - 20060246031 - Use of cxcl6 chemokine in the prevention or repair cartilage defects
The present invention disclosed the expression of CXCL6 by cells which are able to form stable cartilage. The invention describes the use of these cells and of CXCL6 to promote cartilage (and underlying bone) formation e.g. in the repair of cartilage or osteochondral defects. The invention further describes the use ...

10/26/06 - 20060239965 - Extracellular matrix binding chimeric proteins and methods of use thereof
The present invention provides chimeric polypeptides comprising a first polypeptide that binds to a component of extracellular matrix and a second polypeptide that provides for a therapeutic effect. The present invention further provides compositions, including pharmaceutical compositions, comprising a subject chimeric polypeptide. A subject chimeric polypeptide is useful in a ...

10/26/06 - 20060239964 - Retinal degeneration
Methods of treating a retinal degenerative disorder. ...

10/26/06 - 20060239963 - Quil a fraction with low toxicity and use thereof
Fraction A of Quil A can be used together with at least one other adjuvant for the preparation of an adjuvant composition, where the included adjuvant components act synergistically to enhance level of immune response and and have synergistic immunomodulating activity on the co-administered antigens or immunogens. Other adjuvants can ...

10/26/06 - 20060239962 - Rapid one-step generation of antigen loaded dendritic cell vaccine from precursors
A one-step method for producing antigen loaded antigen-presenting cells from monocytes ex vivo has been found which comprises contacting the monocytes with a composition comprising an activator such as TNF alpha preferably in combination with at least one growth factor such as GM-CSF and at least one soluble or particulate ...

10/19/06 - 20060233747 - Polymer-modified synthetic proteins
The present invention relates to methods and compositions for modifying peptides, polypeptides and proteins with polymers, especially glyco-mimetic polymers, so as to improve their biological activity or pharmacokinetic properties. The invention further provides methods and uses for such polymer-modified peptides, polypeptides and proteins. The invention is particularly suitable for use ...

10/19/06 - 20060233746 - N-terminally chemically modified protein compositions and methods
Provided herein are methods and compositions relating to the attachment of water soluble polymers to proteins. Provided are novel methods for N-terminally modifying proteins or analogs thereof, and resultant compositions, including novel N-terminally chemically modified G-CSF compositions and related methods of preparation. Also provided is chemically modified consensus interferon. ...

10/19/06 - 20060233745 - Enclosures housing cell-coated supports for treating tumors
The present invention relates to devices, systems and methods for treating tumors. In particular, the present invention relates to enclosures housing cell-coated supports for promoting regression of tumors, such as cancerous tumors, papillomas, and warts. In preferred embodiments, the present invention provides methods of promoting tumor regression employing enclosures secreting ...

10/19/06 - 20060233744 - In vivo incorporation of unnatural amino acids
The invention provides methods and compositions for in vivo incorporation of unnatural amino acids. Also provided are compositions including proteins with unnatural amino acids. ...

10/19/06 - 20060233743 - Compositions and methods of therapy
A method of inducing tolerance to an antigen in a patient, the method comprising administering to the patient an agent which raises the effective cAMP concentration in a monocyte cell and GMCSF or a derivative thereof. Preferably, the agent which raises the effective cAMP concentration in a monocyte cell is ...

10/19/06 - 20060233742 - Peptides for the treatment of cancer associated with human papilloma virus (hpv) and other epithelial tumours
This invention is related to the Molecular Pharmacology field and especially to the development of peptides useful for treating epithelial tumors and mainly those associated to oncogenic types of HPVs. The main objective of this invention is to identify peptides whose structure permits to block the Casein Kinase II (CKII) ...

10/12/06 - 20060228330 - Dominant negative proteins and methods thereof
The invention relates to novel proteins with TNFSF antagonist activity and nucleic acids encoding these proteins. The invention further relates to the use of the novel proteins in the treatment of TNFSF-related disorders. ...

10/12/06 - 20060228329 - Homogeneous preparations of il-31
Homogeneous preparations of human and murine IL-31 have been produced by mutating one or more of the cysteine residues in the polynucleotide sequences encoding the mature proteins. The cysteine mutant proteins can be shown to either bind to their cognate receptor or exhibit biological activity. ...

10/12/06 - 20060228328 - Immunogenic acute phase protein-antigenic molecule complexes and fusion proteins
The present invention relates to complexes and fusion proteins comprising an acute phase protein and an antigenic molecule, for use in the treatment or prevention of a disease. The invention specifically provides for complexes comprising an acute phase protein noncovalently bound to, or alternatively crosslinked to, an antigenic molecule. The ...

10/12/06 - 20060228327 - Cc-chemokine mutants against liver diseases
CC-Chemokine mutants having reduced Glycosaminoglycans (GAG)-binding properties are effective against liver fibrotic inflammatory and/or autoimmune diseases. Particularly preferred are the mutants of CCL5/RANTES having reduced GAG-binding properties. ...

10/12/06 - 20060228326 - Active specific immunotherapy of cancer metastasis
The present invention provides for the treatment of a subject with occult brain metastasis. The treatment relies on administering to the subject a composition comprising an immunomodulatory polypeptide and a baculovirus-insect cell preparation. This composition has a unique ability to generate an anti-tumor immune response that is able to cross ...

10/05/06 - 20060222626 - Modified tumor necrosis factor
Modifying TNF with polyethyleneglycol (PEG) having an approximate weight average molecular weight in the range of about 10,000 to about 40,000, preferably in the range of about 20,000 to 30,000, significantly increases the circulating half-life of the TNF while not increasing its toxicity. As a result, lower doses of the ...

10/05/06 - 20060222625 - Therapeutic uses of allogeneic myeloid progenitor cells
Myeloid function is enhanced by transplantation or infusion of allogeneic myeloid progenitor cells, including CMP, GMP, MEP and MKP cell subsets. Myeloid progenitors ameliorate sequelae of anemia and thrombocytopenia, and can prevent or treat gastrointestinal mucositis associated with chemotherapy, radiotherapy, and the like. The transplantation or infusion may be performed ...

10/05/06 - 20060222624 - Detoxified tnf and method of preparing
The present invention provides for an immunogenic analogue of a human TNFα protein, wherein said analogue comprises an immunogenized monomeric TNFα polypeptide or TNFα di- or timer, and wherein the analogue further comprises a toxicity reducing or abolishing mutation selected from the group consisting of Y87S, D143N or A145R, the ...

09/28/06 - 20060216270 - Dna 19355 polypeptide, a tumor necrosis factor homolog
A tumor necrosis factor homolog, identified as DNA19355, is provided. DNA19355 polypeptide has apoptotic activity in mammalian cancer cells and may be involved in proinflammatory responses. Nucleic acid molecules encoding DNA19355, chimeric molecules and antibodies to DNA19355 are also provided. ...

09/28/06 - 20060216269 - Dendritic cell tumor injection (dcti) therapy
The invention relates to a method of treating tumor cells within a patient wherein immature dendritic cells developed from the patient's monocyte cells and an adjuvant are introduced into the patient directly into the patient's tumor cells. The immature dendritic cells and adjuvant combine with the antigens in the tumor ...

09/21/06 - 20060210532 - Means and methods for the recruitment and identification of stem cells
Described are methods of modulating stem/progenitor cell recruitment involving molecules that agonize the formation of plasmin stimulating the recruitment of stem/progenitor cells, including hematopoietic and endothelial precursor cells. Conversely, antagonists of plasmin can inhibit recruitment of the stem cells. In addition, the identification of the uPA receptor (uPAR) as a ...

09/21/06 - 20060210531 - Agent eleveting dendritic cell precursor level in blood
Although the fields of therapeutic applications of dendritic cells are now expanding, dendritic cell precursors exist only in a small amount in the peripheral blood and, therefore, it is still difficult to obtain them in a therapeutically useful amount even though they are proliferated in vitro. Therefore, it is a ...

09/07/06 - 20060198820 - Methods and compositions for treating secondary tissue damage and other inflammatory conditions and disorders
Methods for treatment of diseases, including human immunideficiency virus infection, are provided. The disease are treated by administering conjugates containing as a ligand a chemokine receptor targeting agents, such as a chemokine, and a targeted agent, such as a toxin. ...

09/07/06 - 20060198819 - Use of galactose oxidase for selective chemical conjugation of protractor molecules to proteins of therapeutic interest
This invention relates to novel compounds, methods for selective chemical conjugation of protractor molecules and the use thereof for diagnostic and/or therapeutic purposes. ...

08/31/06 - 20060193827 - Methods using tcf -ii
The present invention provides an agent for preventing and/or treating cachexia comprising TCF-II as an effective ingredient. An agent for preventing and treating cachexia caused by cancer, acquired immunodeficient syndrome (AIDS), cardiac diseases, infectious disease, shock, burn, endotoxinemia, organ inflammation, surgery, diabetes, collagen diseases, radiotherapy, chemotherapy is provided by the ...

08/31/06 - 20060193826 - Methods to mobilize progenitor/stem cells
wherein each R is independently H or straight, branched or cyclic alkyl (1-6C), n is 1 or 2, and X is an aromatic ring, including heteroaromatic rings, or is a mercaptan; “linker” represents a bond, alkylene (1-6C) or may comprise aryl, fused aryl, oxygen atoms contained in an alkylene chain, ...

08/31/06 - 20060193825 - Pharmaceutical formulations for sustained drug delivery
The present invention provides pharmaceutical formulations comprising a solid ionic complex of a polypeptide having an isoelectric point lower than physiological pH and an anionic carrier molecule. The formulations of the invention are suitable as depot formulations for the sustained release of therapeutic polypeptides. ...

08/31/06 - 20060193824 - Methods for the treatment of infectious and inflammatory airway diseases
Methods for the treatment of inflammatory and infectious airway diseases are disclosed. ...

08/24/06 - 20060188473 - Compositions and methods for repressing b cell autoantibody secretion and for treating autoimmune disorders
The invention provides isolated regulatory immune cells as well as cell cultures and conditioned media derived therefrom. Also provided are methods of repressing B cell autoantibody production and/or secretion and methods of treating autoimmune disorders using regulatory immune cells or precursors thereto. Further provided are methods of diagnosing in a ...

08/24/06 - 20060188472 - Has-active ingredient conjugates
The invention relates to compounds comprising a conjugate of hydroxyalkyl starch (HAS) and an active agent, whereby the hydroxyalkyl starch is either directly covalently bonded to the active agent, or by means of a linker. The invention further relates to methods for the production of a covalent HAS-active agent conjugate, ...

08/24/06 - 20060188471 - Methods of treating epithelial lesions
The invention features methods of preventing or treating epithelial cell lesions in a mammal by administering a composition containing a therapeutically effective amount of a trefoil domain-containing polypeptide, or a trefoil peptide fragment, and a mucoadhesive excipient. The invention further features methods of preventing or treating an eye disorder, e.g., ...

08/17/06 - 20060182712 - Ccr ligands for stem cell homing
Chemokines ligands to at least one of CCR1, CCR2, CCR3, or CCR5 can be used to home stem cells for therapeutic applications. ...

08/10/06 - 20060177419 - Stimulating neutrophil function to treat inflammatory bowel disease
Immune stimulatory amounts of hematopoietic colony stimulating factors are administered to patients with inflammatory bowel disease. The factors include G-CSF and GM-CSF. These factors induce and maintain remission of the disease and its manifestations, whether within the intestine or without. ...

08/10/06 - 20060177418 - Methods for accelerating wound healing by administration of adipokines
Methods for inducing or accelerating a healing process of a damaged skin or skin wounds are described. The methods include administering to the skin cells colonizing the damaged skin or skin wound a therapeutically effective amount of an adipokine, an adipocyte or preadipocyte modulator, adipocytes, preadipocytes, or stem cells, or ...

08/10/06 - 20060177417 - Pharmaceutical formulations for sustained drug delivery
The present invention provides pharmaceutical formulations comprising a solid ionic complex of a polypeptide having an isoelectric point lower than physiological pH and an anionic carrier molecule. The formulations of the invention are suitable as depot formulations for the sustained release of therapeutic polypeptides. ...

08/03/06 - 20060171919 - Targeted polypeptides
The present invention regards targeted BLyS polypeptides capable of binding to BLyS receptors and that deliver a cytotoxic agent, such as a cytotoxic peptide, for example. In particular aspects, the cytotoxic agent comprises at least part of rGelonin. These compositions are useful for treating, preventing, and/or monitoring therapy for a ...

08/03/06 - 20060171918 - Apoptosis inducing molecule i
The invention relates to Apoptosis Inducing Molecule-1 (AIM-I) polypeptides useful in biological, diagnostic, clinical or therapeutic arts. ...

08/03/06 - 20060171917 - Vaccine formulations for intradermal delivery comprising adjuvants and antigenic agents
The present invention relates to compositions for intradermal delivery of an antigenic or immunogenic agent in combination with one or more adjuvants. The immunogenic compositions of the invention comprise an antigenic or immunogenic agent and at least one adjuvant, which enhances the immune response to the antigenic or immunogenic agent, ...

07/27/06 - 20060165651 - Isolated nucleic acid molecules encoding cancer associated antigens, the antigens per se, and uses thereof
The invention relates to newly identified cancer associated antigens. It has been discovered that each of these molecules provokes antibodies when expressed by a subject. The ramifications of this observation are also a part of this invention. ...

07/27/06 - 20060165650 - Rantes-derived peptides with anti-hiv activity
RANTES-derived peptides and the use thereof in the treatment of diseases in which RANTES receptor is involved, such as viral infections, particularly HIV infections, and inflammatory, allergic, degenerative, neoplastic or metastatic diseases. ...

07/27/06 - 20060165649 - Methods of using and compositions comprising selective cytokine inhibitory drugs for the treatment and management of myeloproliferative diseases
Methods of treating, preventing and/or managing a myeloproliferative disease are disclosed. Specific methods encompass the administration of a selective cytokine inhibitory drug, or a pharmaceutically acceptable salt, solvate, hydrate, stereoisomer, clathrate, or prodrug thereof, alone or in combination with a second active agent, and/or the transplantation of blood or cells. ...

07/20/06 - 20060159654 - Protein belonging to the tnf superfamily involved in signal transduction, nucleic acids encoding same, and methods of use thereof
A method of modulating immune response in an animal is disclosed. Such a method interacting the immature dendritic cells from the animal with an antigen ex vivo so that the immature dendritic cells present the antigen on their surfaces, inducing maturation of the immature dendritic cells ex vivo, and contacting ...

07/20/06 - 20060159653 - Stabilized preparation containing protein
Protein formulations containing a poloxamer as a surfactant, and methods for maintaining the biological activity in protein formulations without adding an antioxidant and for inhibiting the formation of foreign insoluble matters by adding a poloxamer as a surfactant. ...

07/20/06 - 20060159652 - Gd2 ligands
The invention provides ligands of ganglioside GD2, including peptide ligands such as GGITNYNSALM; YCGGITNYNSACY; YCITNYNSCY; YCGGITNYNCY; YCTNYGVHCY; YCTNYGVCY; GGIANYNTS; YCGGIANYNCY; YCGGIANYNTSCY; and, YCIANYNTCY. GD2 ligands of the invention may for example be used to treat or diagnose diseases such as cancers in which cells express GD2, including neuroblastomas. ...

07/13/06 - 20060153802 - Mammalian chemokine reagents
A novel CC chemokine which is from a mammal, reagents related thereto including purified proteins, specific antibodies, and nucleic acids encoding said chemokine. A chemokine receptor is also provided. Methods of using said reagents and diagnostic kits are also provided. ...

07/13/06 - 20060153801 - Mixtures of drug-oligomer conjugates comprising polyalkylene glycol, uses thereof, and methods of making same
A non-polydispersed mixture of conjugates in which each conjugate in the mixture comprises a drug coupled to an oligomer that includes a polyalkylene glycol moiety is disclosed. The mixture may exhibit higher in vivo activity than a polydispersed mixture of similar conjugates. The mixture may be more effective at surviving ...

07/13/06 - 20060153800 - Dna immunization with recombinase/transposase
The present invention relates to improved methods to immunize/vaccinate or stimulate the immune system of animals, including humans, using vectors containing expression cassettes that encode for the DNA of one or more protein/peptide antigens and/or adjuvants, in particular, cytokines like GMCSF, Flt3L, interleukins, and the like, which can be encoded ...

07/13/06 - 20060153799 - Use of scf and g-csf in the treatment of cerebral ischemia and neurological disorders
The present invention relates to the use of stem cell factor (SCF) polypeptide, alone and in combination with granulocyte colony stimulating factor (G-CSF) polypeptide, in the prevention or treatment of injury to the brain after cerebral ischemia or neurological disorder. More particularly, the invention provides methods of improving neurological function ...

07/13/06 - 20060153798 - Methods and compositions for needleless delivery of macromolecules
Methods and compositions for needleless delivery of macromolecules to the bloodstream of a subject are provided herein. In one aspect, the invention provides a delivery construct, comprising a receptor binding domain, a transcytosis domain, a macromolecule to be delivered to a subject, and a cleavable linker. In certain aspects, the ...

07/13/06 - 20060153797 - Tissue material and matrix
The present invention relates generally to a tissue preparation including tissue cells and extracts thereof useful for promoting or facilitating the growth, development and differentiation of cells and tissues. More particularly, the present invention provides muscle-derived material comprising intact or extracted extracellular matrix and/or cells as well as cytokines, growth ...

07/06/06 - 20060147416 - Method of using and compositions comprising selective cytokine inhibitory drugs for the treatment and management of myelodysplastic syndromes
Methods of treating, preventing and/or managing a myelodysplastic syndrome are disclosed. Specific methods encompass the administration of a selective cytokine inhibitory drug, or a pharmaceutically acceptable salt, solvate, hydrate, stereoisomer, clathrate, or prodrug thereof, alone or in combination with a second active ingredient, and/or blood or cells for transplantation therapy. ...

06/29/06 - 20060140905 - Chemokine beta-7 variants
The present invention relates to deletion and substitution mutant polypeptides of human chemokine β-7 (Ckβ-7), as well as nucleic acid molecules encoding such polypeptides and processes for producing such polypeptides using recombinant techniques. In one aspect, the invention also relates to uses of the full-length and mature forms of Ckβ-7, ...

06/22/06 - 20060134063 - Agents for proliferating pancreatic beta-cells of the islets of langerhans, agents for suppressing apoptosis of said cells, and screening of candidate compounds for these agents
The present invention provides agents for proliferating pancreatic β-cells of Langerhans' islets, agents for suppressing apoptosis of the cells, and methods of screening for candidate compounds for these agents. The combined use of an inflammatory mediator IL-6 and glucocorticoid remarkably induces the expression of Reg gene in β cells and ...

06/15/06 - 20060127356 - Isolated proteins mage-4 and mage-41
The invention relates to nucleic acid molecules which code for the tumor rejection antigen precursor MAGE-3. Also disclosed are vectors, cell lines, and so forth, which utilize the nucleic acid molecule, and optionally, molecules coding for human leukocyte antigen HLA-A1. Uses of these materials in therapeutic and diagnostic contexts are ...

06/08/06 - 20060120996 - Vaccine immunotherapy for immune suppressed patients
A method of immunotherapy to treat cancer or a synergistic anti-cancer treatment by administering an effective amount of a natural cytokine mixture (NCM), an effective amount of cyclophosphamide (CY), or an effective amount of indomethacin (INDO), wherein the NCM, CY, or INDO are administered singly or in combinations thereof. An ...

06/08/06 - 20060120995 - Neoadjuvant genetic compositions and methods
The present invention relates to a method and composition for the use of a neoadjuvant to be used in with existing therapies to break host immune tolerance to tumor cells or other types of diseased cells. More precisely the present invention is directed to a vaccine which delivers a polypeptide ...

06/01/06 - 20060115451 - Modified cytokines for use in cancer therapy
Cytokine derivatives capable of homing the tumoral vessels and the antigen presenting cells and the use thereof as antitumoral agents. ...

05/18/06 - 20060104942 - Remedies for ischemic disease
An effective remedy for ischemic disease, which contains human granulocyte colony-stimulating factor (human G-CSF) and hepatocyte growth factor (HGF) as active ingredients, is disclosed. By administering this remedy, an effective therapy particularly for obstructive arteriosclerosis is provided which can eliminate drawbacks with conventional therapies such as kinesitherapy, pharmacotherapy, revascularization and ...

05/11/06 - 20060099172 - Method of cancer screening; method of cancer treatment; method of diabetes treatment; method of multiple sclerosis treatment; method of prophylaxis and treatment of avian influenza
A method of treating avian influenza comprising transdermally administering imiquimod cream and DHEA cream while simultaneously administering valacyclovir tablets. ...

05/11/06 - 20060099171 - Mouse glucocorticoid-induced tnf receptor ligand is costimulatory for t cells
The present invention provides mGITRL proteins, nucleotide molecules encoding same, mGITRL messenger RNA molecules, methods of expressing a recombinant gene in an immune cell and of stimulating CD4+CD25− T cells, comprising same or comprising agonist anti-GITR antibodies ...

05/11/06 - 20060099170 - Compositions for inducing increased levels of beta-chemokines and methods of use therefor
The present invention relates to compositions and methods for inducing increased levels and availability of β-chemokines by administering to a subject at least one G1 phase arresting compound, wherein the increased levels and availability of β-chemokines block chemokine/viral receptors thereby preventing or treating viral infections. ...

05/04/06 - 20060093575 - Oxaliplatin anti-resistance agent
The invention concerns a method for detecting in vitro resistance of cancer cells to an oxaliplatin treatment characterized in that it consists in measuring mitochondrial apoptosis of cancer cells being treated or capable of being treated or to be treated with oxaliplatin. ...

05/04/06 - 20060093574 - Methods for epitope-specific and cytokine/anticytokine combination immunotherapies for modulation of pathogenic immune responses in immune mediated diseases
The current invention provides for methods of immunotherapy using a combination of epitope-specific and cytokine or anticytokine immunotherapy. The method provides for modulation of pathogenic immune responses and includes the identification of molecules comprising specific epitopes involved in a particular disease state of interest, administration of the epitope-specific molecule in ...

04/27/06 - 20060088501 - Duffy antigen receptor for chemokines and use thereof
The invention relates to Duffy antigen receptor for chemokines and uses thereof. In one embodiment, the invention provides a method for screening for drug candidates that inhibit angiogenesis. The method comprises contacting a molecule with a Duffy antigen receptor for chemokines and determining whether the molecule binds to the Duffy ...

04/20/06 - 20060083712 - Methods and compositions for the repair and/or regeneration of damaged myocardium
Methods, compositions, and kits for repairing damaged myocardium and/or myocardial cells including the administration of stem cells, such as adult stem cells, optionally with cytokines are disclosed and claimed. ...

04/13/06 - 20060078538 - Thermal surgical procedures and compositions
Methods, compositions, and systems useful to enhance a thermal surgical procedure are described. Compositions include at least one compound effective to induce an inflammatory response in biological material identified to undergo a thermal surgical procedure. Methods and systems include providing compositions of the invention to biological materials and treating biological ...

04/13/06 - 20060078537 - Mono-and dual chemokine/cytokine constructs
The present invention relates to a chemokine construct comprising a scFV anti-CD4 and a RANTES chemokine or a functional fragment thereof, whereby said chemokine construct has the structural domain form of (a) RANTES-linker-(VH) anti-CD4-linker-(VL) anti-CD4; or (b) (VL) anti-CD4-linker-(VH) anti-CD4-linker-RANTES, or (c) (VH) anti-CD4-linker-(VL) anti-CD4-linker-RANTES, whereby in the alternatives (b) ...

04/06/06 - 20060073115 - Chimeric antagonist anth1
A recombinant chimeric antagonist formed by a 60 amino acid fragment of the N-terminal region of human interleukin 2 (IL-2) fused to the N-terminal of the extracellular region of the alpha subunit of the gamma IFN (IFN γ) receptor. In vitro this protein has a T cell growth stimulating activity, ...

04/06/06 - 20060073114 - Compounds and methods to inhibit or augment an inflammatory response
Isolated and purified chemokine peptides, variants, and derivatives thereof, as well as chemokine peptide analogs, are provided. ...

03/30/06 - 20060067911 - Metered medication dose
The invention discloses a metered medication dose of a dry powder protein medicament, particularly a peptide medicament, intended for inhalation by use of an adapted dry powder inhaler. An active peptide agent is presented in a pure, natural, crystalline, micronized, dry powder form. A dose comprises at least one such ...

03/23/06 - 20060062759 - Method of cancer screening; method of cancer treatment; and method of diabetes treatment
A method of cancer screening comprising the steps of administering the Blood CA 27,29 testing procedure; if the result is positive administering a mammogram; if the result is positive administering an needle biopsy; if the result is positive administering a PET scan; if the result is positive administering a blood ...

03/23/06 - 20060062758 - Tight junction modulator peptide pn159 for enhanced mucosal delivery of therapeutic compounds
Compositions and methods are provided that include a biologically active agent and a permeabilizing agent effective to enhance mucosal delivery of the biologically active agent in a mammalian subject, in which the permeabilizing peptide is PN159, PN159 analogues, conjugates of PN159, conjugates of PN159 analogues, or complexes thereof. The permeabilizing ...

03/23/06 - 20060062757 - Method of cancer screening; method of cancer treatment; and method of diabetes treatment
A method of cancer screening comprising the steps of administering the Blood CA 27,29 testing procedure; if the result is positive administering a mammogram; if the result is positive administering an needle biopsy; if the result is positive administering a PET scan; if the result is positive administering a blood ...

03/23/06 - 20060062756 - Method of cancer screening; method of cancer treatment; method of diabetes treatment; method of multiple sclerosis treatment; method of interstitial cystitis treatment; method of acquired immune deficiency syndrome treatment; and method of herpes treatmen
A method of cancer screening comprising the steps of administering the Blood CA 27,29 test; administering a mammogram; administering an needle biopsy; administering a PET scan; and administering a blood tumor cell count. If all of the foregoing steps are positive, the cancer is treated by applying imiquimod transdermally, preferably ...

03/23/06 - 20060062755 - Method of cancer screening; method of cancer treatment; and method of diabetes treatment
A method of cancer screening comprising the steps of administering the Blood CA 27,29 testing procedure; if the result is positive administering a mammogram; if the result is positive administering an needle biopsy; if the result is positive administering a PET scan; if the result is positive administering a blood ...

03/09/06 - 20060051319 - Neuroprotective effect of solubilized udca in focal ischemic model
The present disclosure provides compositions and methods for treating, ameliorating, or relieving at least one symptom associated with loss of blood flow to the brain including, without limitation, ischemic stroke. Compositions of the disclosure may comprise a bile acid compound and a carbohydrate, wherein both materials remain in solution for ...

03/09/06 - 20060051318 - Medical composition for treating ischemic cardiac failure
The object of the present invention is to provide a pharmaceutical composition for treating non-ischemic heart failure caused by exacerbation of cardiomyopathy. The long-term administration of a colony-stimulating factor ameliorates progressive myocardial fibrosis, left ventricular remodeling and heart failure. ...

03/02/06 - 20060045867 - Regeneration method for treating heart diseases and vascular system diseases using medicament
A regeneration method using a medicament against heart diseases and vascular system diseases, which comprises administering a polypeptide having granulocyte colony-stimulating factor activity under bone marrow suppressed conditions. ...

02/16/06 - 20060034799 - Tissue protective cytokines for the protection, restoration, and enhancement fo responsive cells, tissues and organs
Methods and compositions are provided for treating a mammal having inflammation by protecting or enhancing a responsive cell, tissue, organ or body part exhibiting or associated with the inflammation, by systemic or local administration of a composition comprising a tissue protective cytokine. The invention also encompasses combination treatments comprising administering ...

02/02/06 - 20060024267 - Tnfr/opg-like molecules and uses thereof
The present invention provides novel TNFr/OPG-like polypeptides and nucleic acid molecules encoding the same. The invention also provides vectors, host cells, antibodies, and methods for producing TNFr/OPG-like polypeptides. Also provided for are methods for the diagnosis and treatment of diseases with TNFr/OPG-like polypeptides. ...

01/19/06 - 20060013800 - Stable immunogenic product comprising antigenic heterocomplexes
A stable immunogenic product for the induction of antibodies against one or more antigenic proteins in a subject, characterized in that it comprises proteinaceous immunogenic heterocomplexes which are formed by associations between (i) antigenic protein molecules and (ii) proteinaceous carrier molecules and in that less than 40% of the antigenic ...

12/22/05 - 20050281780 - Prophylactic and therapeutic treatment of the ductal epithelium of a mammary gland for cancer
The present invention provides prophylactic and therapeutic methods of treating the ductal epithelium of an exocrine gland, in particular a mammary gland, for disease, in particular cancer. The methods comprise contacting the ductal epithelium of the exocrine gland with an epithelium-destroying gent, preferably by ductal cannulation, so as to realize ...

12/22/05 - 20050281779 - Enhancing immune responses to genetic immunization by using a chemokine
The immune response to a DNA immunogen in a mammal can be enhanced by administration of a chemokine or a polynucleotide encoding the chemokine. This method can be used, for example, to immunize or vaccinate a mammal against an infectious disease or a tumor. ...

12/15/05 - 20050276784 - Ligand for the c-kit receptor and methods of use thereof
A pharmaceutical composition which comprises the c-kit ligand (KL) purified by applicants or produced by applicants' recombinant methods in combination with other hematopoietic factors and a pharmaceutically acceptable