Drug, bio-affecting and body treating compositions inventions

20090270308 - Controlled release implantable dispensing device and method: A dispensing device having a polymer which is combined with a therapeutic agent in the form of a microparticle or nanoparticle which is “hyper-compressed” to form a controlled release dispensing device and methods of locally administering a therapeutic agent using said microparticles.... Agent: Hedman & Costigan P.C.

20090270309 - Use of lactoferrin fragments and hydrolysates: The present invention relates to use of at least one lactoferrin fragment or a lactoferrin hydrolysate or a mixture thereof for stimulating skeletal growth, inhibiting bone resorption, stimulating chondrocyte proliferation, stimulating osteoblast proliferation, inhibiting osteoclast development or treating or preventing a skeletal, joint or cartilage disorder.... Agent: Fish & Richardson PC

20090270310 - Process for the preparation of a nutrient formulation: The present invention relates to a process for increasing the efficacy and/or bioavailability of a nutrient formulation or composition for the treatment and/or prevention of inflammatory processes associated with airway diseases such as asthma. In particular, the invention relates to a method of treating an airway disease in a subject... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20090270311 - Treatment of insulin resistance by modulating somatostatin using somatostatin receptor antagonists: The present invention provides the use of somatostatin antagonists for treating and preventing HISS-dependent insulin resistance and hemorrhage induced insulin resistance. The present further provides pharmaceutical compositions comprising a somatostatin antagonist and a pharmaceutically acceptable liver targeting compound.... Agent: Merchant & Gould PC

20090270326 - Cell death inhibitor: The present invention relates to an antioxidant response element (ARE) activator comprising a macrophage migration inhibitory factor (MIF) or a modified form thereof, an ARE activator comprising a combination of MIF or a modified form thereof and a substance capable of binding to MIF, and so on. These ARE activators... Agent: Edwards Angell Palmer & Dodge LLP

20090270324 - Complement depletion using recombinant human c-3 derivatives: The invention provides isolated polypeptides having complement-modulating activity. Specifically, the invention resides in the provision of isolated polypeptides having complement depleting properties, i.e. that effect an efficient consumption of complement in human serum. The current invention thus provides human C3 derivatives that are capable of forming C3 convertases exerting an... Agent: Morrison & Foerster LLP

20090270322 - G protein coupled receptor antagonists and methods of activating and inhibiting g protein coupled receptors using the same: The invention relates generally to G protein coupled receptors and in particular to agonists and antagonists of G protein receptors and methods of using the same.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20090270325 - Growth factor: We describe a chimeric protein comprising a growth hormone polypeptide linked to a polypeptide comprising the extracellular binding domain of growth hormone receptor; its use in enhancing the growth and metabolism of non-human animals and homodimers comprising said chimeric protein.... Agent: Morgan, Lewis & Bockius LLP (sf)

20090270316 - Her-2 binding antagonists: There is disclosed a pharmaceutical composition for treating solid tumors that overexpress HER-2, comprising an agent selected from the group consisting of (a) an isolated polypeptide having from about 50 to 79 amino acids taken from the sequence of SEQ ID NO:1, wherein the polypeptide binds to the extracellular domain... Agent: Davis Wright Tremaine, LLP/seattle

20090270318 - High-affinity antagonists of elr-cxc chemokines: The present invention provides novel polypeptide sequences, methods for production thereof and uses thereof for novel ELR-CXC chemokine receptor agonists and antagonists.... Agent: Ade & Company Inc.

20090270312 - Hiv-i gp41 fusion peptides for immunomodulaltion: The present invention provides pharmaceutical compositions and methods for prevention or treatment of autoimmune diseases and other T cell mediated inflammatory diseases and conditions, which comprise as an active ingredient an effective quantity of a peptide derived from HIV gp41 fusion peptide domain or fragments, analogs, homologs and derivatives thereof.... Agent: Fennemore Craig

20090270327 - Lepidopteran-active bacillus thuringiensis delta-endotoxin compositions and methods of use: Disclosed are Bacillus thuringiensis strains comprising novel crystal proteins which exhibit insecticidal activity against lepidopteran insects. Also disclosed are novel B. thuringiensis genes and their encoded crystal proteins, as well as methods of making and using transgenic cells comprising the novel nucleic acid sequences of the invention.... Agent: Howrey LLP

20090270315 - Method of inhibiting angiogenesis by using ephrin b2: The compositions of the present invention include an effective amount of an ephrinB2, while the methods of the present invention include a step of administering an effective amount of an ephrinB2. The compositions and methods of the present invention is useful in treatment of a disease or disorder related to... Agent: Osha Liang L.L.P.

20090270313 - Method of treatment for ischemic heart disease: The present invention provides a method of treatment for ischemic heart disease administering a scar formation accelerator containing at least one selected from SFRP2, SFRP4, Midkine, Pleiotrophin and Thymosin beta-10 as an effective ingredient to promote scar formation less fibrosis and retaining elasticity, and thereby improving cardiac function.... Agent: Edwards Angell Palmer & Dodge LLP

20090270323 - Methods for treatment of insulin-like growth factor-1 (igf-1) deficiency: The present invention provides methods and compositions for increasing the growth rates, alleviating the symptoms, or improving the metabolism of human patients having insulin-like growth factor-I deficiency (IGFD). The invention relates to methods comprising administering insulin-like growth factor-I to a patient having a height which, at the time of treatment... Agent: Bozicevic, Field & Francis LLP

20090270329 - Methods of administering porcine b-domainless fviii: The present invention provides a method of administering porcine B-domainless factor VIII (OBI-1) to a patient having factor VIII deficiency to provide more rapid and effective protection against bleeding episodes, compared to formerly available methods, or to provide more effective protection to such patients during non-bleeding periods. This invention is... Agent: Greenlee Winner And Sullivan P C

20090270328 - Methods of increasing cerebral blood flow: Methods of increasing blood flow in a mammalian brain blood vessel characterized by, or otherwise experiencing, decreased blood flow due to an ischemic or other hypoxic event, vasoconstriction or vasospasm following hemorrhagic stroke; due to chronic high blood pressure; and/or due to idiopathic causes are provided. The method for increasing... Agent: King & Spalding LLP

20090270331 - Multi-domain amphipathic helical peptides and methods of their use: Disclosed herein are peptides or peptide analogs with multiple amphipathic α-helical domains that promote lipid efflux from cells via an ABCA1-dependent pathway. Also provided herein are methods of using multi-domain amphipathic α-helical peptides or peptide analogs to treat or inhibit dyslipidemic disorders. Methods for identifying non-cytotoxic peptides that promote ABCA1-dependent... Agent: Klarquist Sparkman, LLP

20090270321 - Over-expression of mps-1 gene or its gene product(s) results in reduction in size of a variety of malignancies: Elevation of MPS-1 in HNSCC samples and its structure/function as a ribosomal ZFP have led us to conclude that MPS-1 might be a subject of interest for malignant tumor therapy. Our data reveal that enhanced expression of MPS-1 protein can strongly suppress tumor cell proliferation. MPS-1 and significantly inhibits tumor... Agent: Brendan C. Stack, Jr., Md

20090270317 - Pharmaceutical compositions comprising bioelastomer fusion proteins: Bioelastomers are disclosed for use in methods of binding compounds including immunoassay methods, in biosensors and methods or regenerating biosensors, and in methods for targeting the delivery of a compound to a particular location within an animal subjects. In general, the bioelastomer is conjugated to a binding compound, which is... Agent: Cooley Godward Kronish LLP Attn: Patent Group

20090270319 - Pharmaceutical use of protein molecules immunologically correlated to diptheria toxin: Protein molecules immunologically correlated to diphtheria toxin are proposed for the treatment of atherosclerosis and further correlated pathologies.... Agent: Alston & Bird LLP

20090270314 - Polypeptide having anti-angiogenic activity: The present inventors found out four kinds of fragments (42 kD, 36 kD, 32 kD, 27 kD) by forcibly expressing vasohibin in a vascular endothelial cell. The present inventors analyzed those fragments and, as a result, found out low molecular weight vasohibin which has an anti-angiogenic activity. The low molecular... Agent: Birch Stewart Kolasch & Birch

20090270330 - Purified arabinogalactan-protein (agp) composition useful in the treatment psoriasis and other disorders: A purified Arabinogalactan-Protein (AGP) composition isolated through a selective method from the leaves and/or stems of Argemone mexicana plant is described. Also described is a purified Arabinogalactan-Protein (AGP) composition isolated from the leaves and/or stems of Argemone mexicana plant, which has one or more of the following effects: immunosuppression, lymphoproliferation... Agent: Ladas & Parry LLP

20090270320 - Use of galectin-7 to promote the re-epithelialization of wounds: Methods for the therapeutic treatment of epithelial wounds in mammals comprising administering to a mammal afflicted with an epithelial wound a therapeutically effective amount of a galectin-3 protein and/or a galectin-7 protein are provided. Pharmaceutical compositions comprising a pharmaceutically suitable carrier or diluent and as an active agent a galectin-3... Agent: Lawson & Weitzen, LLP

20090270332 - Genetic polymorphisms associated with venous thrombosis, methods of detection and uses thereof: The present invention is based on the discovery of genetic polymorphisms that are associated with venous thrombosis. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods... Agent: Celera Corporation

20090270333 - Methods of using motilin homologs: The present invention is directed to polynucleotides, polypeptides and peptide fragments thereof, and uses thereof for a novel cDNA sequence which has homology to motilin. Tissue distribution of the mRNA for the novel polypeptide is specific to the stomach, small intestine and pancreas. The present invention further includes agonists, antagonists,... Agent: Amgen Inc. Law Department

20090270334 - Neuronal differentiation inhibitor peptide and use thereof: Disclosed is a neuronal differentiation inhibitor which comprises at least one peptide capable of inhibiting or controlling the neuronal differentiation of at least one cell capable of being differentiated into a neuronal cell. The peptide is an artificially synthesized peptide which comprises a BC-box derived amino acid sequence comprising at... Agent: Turocy & Watson, LLP

20090270335 - Collyrium for dry eye: A composition for treating dry eye includes eledoisin formulated in an ester form and a phospholipid formulated in a micellar form.... Agent: Patrick R. Scanlon Preti Flaherty Beliveau & Pachios LLP

20090270337 - Composition comprising carbohydrates and peptides which comprise tryptophan: An edible composition comprising peptides rich in tryptophan, which edible composition further comprises a rapidly available glucose composition and a slowly available glucose composition.... Agent: Unilever Patent Group

20090270336 - Piperazine derivatives: This invention relates to novel compounds that are piperazine derivatives, and pharmaceutically acceptable salts thereof. More specifically, the invention relates to novel piperazine compounds that are derivatives of the chemokine CCR5 receptor antagonist, vicriviroc. This invention also provides pyrogen-free compositions comprising one or more compounds of the invention and a... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20090270338 - Diaryl-cyclylalkyl derivatives as calcium channel blockers: Methods and compounds effective in ameliorating conditions characterized by unwanted calcium channel activity, particularly unwanted N-type and/or T-type calcium channel activity are disclosed. Specifically, a series of compounds of substituted or unsubstituted N-cyclylalkyl-diphenylpropanamide derivatives as shown in formula (1).... Agent: Morrison & Foerster LLP

20090270339 - Unit dose form of glufosfamide: A lyophilized unit dose form containing about 2 g of glufosfamide is useful in treatment of cancer and other hyper-proliferative diseases.... Agent: Townsend And Townsend And Crew, LLP

20090270479 - Genetic and epigenetic alterations in the diagnosis and treatment of cancer: Methylation of DNA in regions involved in transcriptional regulation can induce the binding of ICBP90 and the subsequent formation of multiprotein complexes which alter gene transcription. DNA methylation in tumor suppressor genes, or in other genes which are involved in mitigating tumorigenesis, can induce binding of ICBP90 to those genes.... Agent: William J Mcnichol Jr Reed Smith

20090270480 - Markers and methods for assessing and treating psoriasis and related disorders: A method for prognostic or diagnostic assessment of a skin-related disorder, such as psoriasis, in a subject correlates the presence, absence, and/or magnitude of a gene in a sample with a reference standard to determine the presence and/or severity of the disorder, and/or the response to treatment for the disorder.... Agent: Philip S. Johnson Johnson & Johnson

20090270481 - Modified sirna molecules and uses thereof: The present invention provides chemically modified siRNA molecules and methods of using such siRNA molecules to silence target gene expression. Advantageously, the modified siRNA of the present invention is less immunostimulatory than its corresponding unmodified siRNA sequence and retains RNAi activity against the target sequence. The present invention also provides... Agent: Townsend And Townsend And Crew, LLP

20090270482 - Analysis of methylated nucleic acid: The present invention provides a method for analysis methylation patterns in DNA and identifying aberrantly methylated genes in disease tissue. The invention also provides a method of identifying novel targets for therapeutic intervention and disease markers. Novel cancer targets are provided.... Agent: Novartis Corporate Intellectual Property

20090270485 - Cell specific replication-competent viral vectors comprising a self processing peptide cleavage site: Cell specific replication-competent viral vectors comprising a self processing peptide cleavage sequence are provided. The targeted replication-competent viral vectors include two or more co-transcribed genes under transcriptional control of the same heterologous transcriptional regulatory element (TRE), wherein at least a second gene is under translational control of a self processing... Agent: Ropes & Gray LLP

20090270487 - Compositions and methods for inhibiting the synthesis or expression of mmp-1: The present invention relates to the specific inhibition of matrix metalloproteinase 1 (MMP-1) using agents which inhibit the synthesis or expression of MMP-1. Such agents are useful for suppressing invasion or metastasis of a tumor cell and in the treatment, prevention and management of cancer.... Agent: Licata & Tyrrell P.C.

20090270486 - Human rnase iii and compositions and uses thereof: The present invention provides polynucleotides encoding human RNase III and polypeptides encoded thereby. Methods of using said polynucleotides and polypeptides are also provided.... Agent: Isis Pharmaceuticals Inc

20090270489 - Long-acting polypeptides and methods of producing same: A polypeptide and polynucleotides encoding same comprising at least two carboxy-terminal peptides (CTP) of chorionic gonadotrophin attached to a peptide-of-interest are disclosed. Pharmaceutical compositions comprising the polypeptide and polynucleotides of the invention and methods of using same are also disclosed.... Agent: Pearl Cohen Zedek Latzer, LLP

20090270490 - Methods involving aldose reductase inhibition: Embodiments of the invention include methods and compositions involving aldose reductase inhibitors for the treatment of inflammation, including inflammatory bowel disease, macular degeneration, or posterior capsule opacification.... Agent: Fulbright & Jaworski L.L.P.

20090270491 - Modulation of tudor-sn expression: Compounds, compositions and methods are provided for modulating the expression of Tudor-SN. The compositions comprise oligonucleotides, targeted to nucleic acid encoding Tudor-SN. Methods of using these compounds for modulation of Tudor-SN expression and for diagnosis and treatment of diseases and conditions associated with expression of Tudor-SN are provided.... Agent: Knobbe, Martens, Olson & Bear, LLP

20090270483 - Pancreatic cancer genes: The present invention provides the art with the DNA coding sequences of polynucleotides that are up-or-down-regulated in cancer and dysplasia. These polynucleotides and encoded proteins or polypeptides can be used in the diagnosis or identification of cancer and dysplasia. Inhibitors of the up-regulated polynucleotides and proteins can decrease the abnormality... Agent: Novartis Vaccines And Diagnostics, Inc. Corporate Intellectual Property-r338

20090270488 - Process for the selection of hiv-1 subtype c isolates, selected hiv-1 subtype isolates, their genes and modifications and derivatives thereof: Embodiments of the invention provide processes for the selection of HIV-1 subtype (clade) C isolates, selected HIV-1 subtype C isolates, their genes and modifications and derivatives thereof for use in prophylactic and therapeutic vaccines to produce proteins and polypeptides for the purpose of eliciting protection against HIV infection or disease.... Agent: Kilpatrick Stockton LLP

20090270484 - Wwox vectors and uses in treatment of cancer: The present invention provides novel methods and compositions for the diagnosis, prognosis and treatment of cancer in a subject, by administering to the subject a polynucleotide encoding a functional WWOX gene product.... Agent: Macmillan Sobanski & Todd, LLC

20090270340 - Methods of administering antitumor agent comprising deoxycytidine derivative: Antitumor treatment regimens comprising: administering, to a patient diagnosed with cancer, an antitumor agent comprising 4-amino-1-(2-cyano-2-deoxy-β-D-arabinofuranosyl)-2(1H)-pyrimidinone, or a salt thereof, by way of continuous intravenous infusion, in an amount of 2.0 to 4.0 mg per m2 total body surface area of the patient, of 4-amino-1-(2-cyano-2-deoxy-β-D-arabinofuranosyl)-2(1H)-pyrimidinone equivalent, per day, for a... Agent: Greenblum & Bernstein, P.L.C

20090270341 - Product comprising a transduction inhibitor of heterotrimeric g protein signals combined with another anti-cancer agent for therapeutic use in the treatment of cancer: A composition for treating cancer comprising an anti-tumorally effective amount of a product comprising at least one transduction inhibitor of heterotrimeric G protein signals and at least one other anti-cancer agent selected from the group consisting of prenyltransferase inhibitors, taxol and its analogues, gemcitabine and camptothecin and its analogues, administered... Agent: Hunton & Williams LLP Intellectual Property Department

20090270342 - Immunoregulatory agent: An object of the present invention is to provide an immunoregulatory agent, which can be continuously ingested on daily diet and has no fear of causing side effects, and a method for regulating immunity. The present invention solves the above object by providing an immunoregulatory agent comprising lactosucrose as an... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20090270345 - Polymeric artificial tear system: The present invention relates to artificial tear formulations and ophthalmic formulations suitable for drug delivery. The formulations comprise galactomannans such as guar or hydroxypropyl guar and a borate source such as boric acid. The formulations further comprise a cis-diol such as sorbitol that interferes with the cross-linking of galactomannan and... Agent: Alcon

20090270343 - Polysaccharide extract of lentinus and pharmaceutical, cosmetic or nutraceutical compositions comprising such an extract: The present invention relates to a polysaccharide extract derived from a mushroom of the Lentinus genus and also to the method for preparing such an extract. This polysaccharide-rich extract can be used as a nutraceutical, cosmetic or pharmaceutical preparation.... Agent: Fulbright & Jaworski L.L.P.

20090270344 - Structure and bioactivity of the polysaccharides and oligomers in medicinal plant dendrobium huoshanense: Compositions and methods are disclosed relating to use of fractions, polysaccharides, and oligosaccharides of Dendrobium huoshanense. The fractions, polysaccharides, and oligosaccharides are able to effect an increase in beneficial cytokines and chemokines.... Agent: Luce, Forward, Hamilton & Scripps LLP

20090270347 - Methods of producing microparticles: Methods of producing microparticles, and especially chitin microparticles (CMP), are disclosed that involve reducing the size of (larger) particles using a (high shear) microfluidising instrument.... Agent: Frommer Lawrence & Haug

20090270346 - Protective gel based on chitosan and oxidized polysaccharide: Bodily tissue and structures may be protected using a fluid layer containing a mixture of chitosan and oxidized polysaccharide. The mixture forms a protective gel layer via in situ crosslinking. Compared to crosslinking using a low molecular weight aldehyde such as glutaraldehyde or genipin, oxidized polysaccharides appear to provide faster... Agent: Iplm Group, P.A.

20090270349 - Physical mode of action pesticide: A physical mode of action pesticide for application on plants and in soils, and methods of manufacture and application, comprising an active ingredient in the form of a polymer in a concentration of less than 0.1% wt., a surfactant, a co-solvent and a diluent in a hydrocolloid suspension. The suspension... Agent: Hedman & Costigan P.C.

20090270348 - Sulfoalkyl ether cyclodextrin compositions: SAE-CD compositions are provided, along with methods of making and using the same. The SAE-CD composition comprises a sulfoalkyl ether cyclodextrin and less than 100 ppm of a phosphate, wherein the SAE-CD composition has an absorption of less than 0.5 A.U. due to a drug-degrading agent, as determined by UV/vis... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20090270350 - Pyridinone pyrazole urea and pyrimidinone pyrazole urea derivatives: This invention is directed generally to substituted pyridinone and pyrimidinone compounds that generally inhibit p38 kinase, TNF, and/or cyclooxygeπase activity. Such substituted pyridinone and pyrimidinone compounds include compounds generally corresponding in structure to the following formula: wherein Z, n, R1, R2a, R2b, R2c, R2d, R2e, R3a, R3b, R3c, R3d, R4,... Agent: Pfizer Inc.

20090270351 - Phosphorus derivatives as histone deacetylase inhibitors: The present invention relates to a novel class of phosphorus derivatives. The phosphorus compounds can be used to treat cancer. The phosphorus compounds can also inhibit histone deacetylase and are suitable for use in selectively inducing terminal differentiation, and arresting cell growth and/or apoptosis of neoplastic cells, thereby inhibiting proliferation... Agent: Merck And Co., Inc

20090270352 - Tenofovir disoproxil hemi-fumaric acid co-crystal: The present invention provides a novel crystalline form of Tenofovir disoproxil fumarate (Tenofovir DF), designated Co-crystal TDFA 2:1, methods for the preparation thereof and its use in pharmaceutical applications, in particular in anti-HIV medicaments. The crystalline form TDFA 2:1 can be used in combination with other anti-HIV medicaments such as... Agent: Hoffmann & Baron, LLP

20090270353 - Compounds for the treatment of proliferative disorders: e

20090270354 - Method of removing ticks from the skin and reducing the risk of bites: Compositions and method of using the same for the removal of ticks embedded in the skin or tissue of a human or animal host and for preventing ticks from attaching themselves to and biting humans or other animals.... Agent: Edward S. Wright

20090270355 - Compounds: m

20090270356 - Compositions and treatments of heart failure in non-human mammal animals: The invention relates to new compositions comprising an aldosterone antagonist according to a particular posology for the treatment of heart failure in non-human mammal animals.... Agent: Law Offices Of Albert Wai-kit Chan, PLLC

20090270357 - Method and use of nanoparticles to bind biocides in paints: This invention relates to the use of a combination of selected substances in paint to prevent the settlement and growth of different biofouling organisms with a reduced negative effect on the ecosystems compared to present methods.... Agent: Lynn E Barber

20090270358 - Pharmaceutical formulation of clavulanic acid: The present invention generally relates to stable pharmaceutical compositions, and methods of making and administering such compositions. In one aspect, the invention features stabilized pharmaceutical compositions that include pharmaceutically active ingredients such as potassium clavulanate or Clavitesse™, preferably in an immediate-release solid dosage form or an extended-release solid dosage form.... Agent: Venable LLP

20090270360 - Dicarboxamide derivatives: e

20090270359 - Substituted pyrazole derivatives: wherein R1 is a hydrogen atom, a group via a carbon atom, a group via a nitrogen atom, a group via an oxygen atom, or a group via a sulfur atom; R2 is a phenyl group having cyano (the phenyl group may further have substituent(s) other than cyano); R3 is... Agent: Edwards Angell Palmer & Dodge LLP

20090270361 - Substituted pyrazole derivatives and use thereof: e

20090270363 - 2-aryl- and 2-heteroarylthiazolyl compounds, methods for their preparation and use thereof: The present invention discloses fused bicyclic 2-aryl- or 2-heteroarylthiazolyl compounds and their pharmaceutically acceptable salts and esters thereof, which are useful for inhibiting the growth of cancerous cells, inhibiting human breast carcinoma tumor growth in particular and to treat diseases or disorders associated with securin, including elevated securin levels.... Agent: Wyeth Patent Law Group

20090270362 - Bicyclic mglur5 positive allosteric modulators and methods of making and using same: In one aspect, the invention relates to bicyclic MGluR5 positive allosteric modulators, for example 6-(phenylethynyl)-3,4-dihydroisoquinolin-1(2H)-one, derivatives thereof, and related compounds, which are useful as positive allosteric modulators of the metabotropic glutamate receptor subtype 5 (mGluR5); synthetic methods for making the compounds; pharmaceutical compositions comprising the compounds; and methods of treating... Agent: Ballard Spahr Andrews & Ingersoll, LLP

20090270364 - Substituted pyrimidine derivatives:

20090270365 - Benzamide derivative or salt thereof: A benzamide derivative or a salt thereof wherein a benzene ring is attached to a D ring (a monocyclic or bicyclic hydrocarbon ring or a monocyclic or bicyclic heteroaromatic ring) through an amide bond, the benzene ring is directly bonded to an E ring (a monocyclic or bicyclic hydrocarbon ring... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090270366 - Benzoimidazole compounds: Benzoimidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson

20090270367 - Substituted hydroxyethylamine aspartyl protease inhibitors: The invention relates to novel compounds and also to methods of treating at least one disease, disorder, or condition associated with amyloidosis using such compounds. Amyloidosis refers to a collection of diseases, disorders, and conditions associated with abnormal deposition of A-beta protein.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20090270368 - Angiogenesis inhibition by cephalotaxine alkaloids, derivatives, compositions and uses thereof: The invention relates to compositions and methods useful in treating or preventing angiogenic disease. The invention provides for compositions comprising cephalotaxine alkaloids as antiangiogenic agents for treatment of a host with an angiogenic disease or for prophylactic treatment of a host to inhibit the onset or progression of an angiogenic... Agent: Morgan, Lewis & Bockius, LLP

20090270369 - Bicycloamine derivatives: e

20090270370 - Fused heterocyclic compounds: Certain fused pyrrole- and pyrazole-containing heterocyclic compounds are serotonin modulators useful in the treatment of serotonin-mediated diseases.... Agent: Philip S. Johnson Johnson & Johnson

20090270371 - Quinoline derivatives useful in the treatment of mglur5 receptor-mediated disorders: Compounds of formula (I): and/or enantiomers and/or racemates and/or diastereomers and/or pharmaceutically acceptable salts thereof formed with acids or bases, to the process for their preparation, to the intermediates of the preparation process, to the pharmaceutical formulations containing these compounds and to their use in the prevention and/or treatment of... Agent: Fish & Richardson P.C.

20090270372 - Novel derivatives of benzimidazole and imidazo-pyridine and their use as medicaments: A subject of the present Application is novel derivatives of benzimidazole and imidazopyridine which have a good affinity for certain sub-types of melanocortin receptors, in particular the MC4 receptors. They are particularly useful for treating pathological conditions and diseases in which one or more melanocortin receptors are involved. The invention... Agent: Hunton & Williams LLP Intellectual Property Department

20090270373 - Treatment of down syndrom with benzodiazepine receptor antagonists: Pharmaceutical compositions and methods of treating Down Syndrome, mental retardation or both are provided. The pharmaceutical compositions comprise one or more benzodiazepine receptor antagonists, such as flumazenil.... Agent: Wilson, Sonsini, Goodrich & Rosati

20090270374 - Derivatives and analogs of n-ethylquinolones and n-ethylazaquinolones: Bicyclic nitrogen containing compounds and their use as antibacterials.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20090270375 - Spiro antibiotic derivatives: The invention relates to compounds of formula (I) wherein R1 represents H, alkyl, alkoxy, cyano or halogen; one of U and X represents CH or N and the other represents CH, or, in the case of U, may also represent CRa and, in the case of X, may also represent... Agent: Hunton & Williams LLP Intellectual Property Department

20090270376 - Heterocyclic janus kinase 3 inhibitors: The present invention provides a compound of formula (I) having an excellent JAK3 inhibition activity and being useful as an active ingredient of an agent for treating and/or preventing various immune diseases including autoimmune diseases inflammatory diseases, and allergic diseases. The compound according to the present invention has an inhibition... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090270377 - Combination cancer chemotherapy: Provided is a method for improving treatment of a neoplastic condition by combining a therapeutically effective amount of a polyADP-ribose polymerase inhibitor with a therapeutically effective amount of a compound which triggers the release of nucleolin from the G-quadruplexes in rDNA. As specifically exemplified, the compound which increases nucleolin binding... Agent: Greenlee Winner And Sullivan P C

20090270378 - Novel tetrahydropyridothiophenes: Compounds of a certain formula (I), in which Ra and Rb have the meanings indicated in the description, are novel effective compounds with anti-proliferative and/or apoptosis inducing activity.... Agent: Millen, White, Zelano & Branigan, P.C.

20090270379 - Quinolone derivatives useful as antibacterial agents: The present invention is directed to quinolone derivatives, useful as antimicrobial compounds, pharmaceutical compositions comprising said derivatives and the use of said derivatives and pharmaceutical compositions as antimicrobial agents against pathogenic microorganisms, particularly against resistant microbes... Agent: Philip S. Johnson Johnson & Johnson

20090270380 - 3,4,5-substituted piperidines as renin inhibitors: The application relates to novel substituted piperidines of the general formula (II) in which R1, R2′, R2″, R4′, X, Z, m and n have the meanings defined in the description, to a process for the preparation thereof and to the use of these compounds as medicines, especially as renin inhibitors.... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090270381 - Non-steroidal progesterone receptor modulators: e

20090270383 - Novel oxabispidine compounds and their use in the treatment of cardiac arrhythmias: There is provided compounds of formula (I), wherein R1, R2, R3, R4, R41 to R46, A, B and G have meanings given in the description, which are useful in the prophylaxis and in the treatment of arrhythmias, in particular atrial and ventricular arrhythmias.... Agent: Pepper Hamilton LLP

20090270382 - Soluble epoxide hydrolase inhibitors: Disclosed are amide, thioamide, urea and thiourea compounds and compositions that inhibit soluble epoxide hydrolase (sEH), methods for preparing the compounds and compositions, and methods for treating patients with such compounds and compositions. The compounds, compositions, and methods are useful for treating a variety of sEH mediated diseases, including hypertensive,... Agent: Foley & Lardner LLP

20090270384 - Morpholine dopamine agonists: s

20090270385 - Substituted arylcyclopentenes as therapeutic agents:

20090270387 - Substituted arylcyclopentenes as therapeutic agents:

20090270386 - Therapeutic compounds:

20090270388 - Fused azole-pyrimidine derivatives:

20090270389 - Pyrimidinyl pyridone inhibitors of kinases: are defined as described herein, which inhibit JNK. The compounds disclosed herein are useful to modulate the activity of JNK and treat diseases associated with excessive JNK activity. The compounds are useful to treat autoimmune, inflammatory, metabolic, and neurological diseases as well as cancer. Also disclosed are compositions comprising the... Agent: Roche Palo Alto LLC Patent Law Dept. M/s A2-250

20090270390 - Pyrimidine derivatives: The invention concerns pyrimidine derivatives of Formula (I) wherein each of p, R1, R2, q, R3, r, R4, X1 and Q1 have any of the meanings defined in the description; processes for their preparation, pharmaceutical compositions containing them and their use in a method for producing an anti-proliferative effect in... Agent: Astrazeneca R&d Boston

20090270391 - Thienopyridine derivative, or quinoline derivative, or quinazoline derivative, having c-met autophosphorylation inhibiting potency: wherein R1 represents H or a substitutable unsaturated five- or six-membered heterocyclic ring; R2 represents H; X represents CH or N; Z represents O or S; E is absent or represents halogen, alkyl, or alkoxy; J represents S or O; and T represents phenyl, an unsaturated five- or six-membered heterocyclic... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090270394 - Cyclylamine derivatives as calcium channel blockers: Methods and compounds effective in ameliorating conditions characterized by unwanted calcium channel activity, particularly unwanted N-type and/or T-type calcium channel activity are disclosed. Specifically, a series of compounds of substituted or unsubstituted cyclylamine derivatives as shown in formulas (1).... Agent: Morrison & Foerster LLP

20090270393 - Iminopyridine derivatives and use thereof: t

20090270392 - Substituted gamma lactams as therapeutic agents: Therapeutic compounds, compositions, medicaments, and methods are disclosed herein.... Agent: Allergan, Inc.

20090270395 - Ep4 receptor agonist, compositions and methods thereof: This invention relates to potent selective agonists of the EP4 subtype of prostaglandin E2 receptors, their use or a formulation thereof in the treatment of glaucoma and other conditions, which are related to elevated intraocular pressure in the eye of a patient. This invention further relates to the use of... Agent: Merck And Co., Inc

20090270396 - Therapeutic compounds: i

20090270397 - Methods and compositions for the treatment of cancers, such as melanomas and gliomas: A method of potentiating the efficacy of an antineoplastic agent such as temozolomide, comprises the administration of an antifolate agent as defined herein. Also disclosed are compositions, including pharmaceutical compositions, comprising the antineoplastic agent and an antifolate agent, and the use of such compounds and compositions thereof to treat a... Agent: Klauber & Jackson

20090270398 - Compounds, compositions and methods comprising pyridazine derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP

20090270399 - Novel pyridazine derivatives and medicines containing the same as effective ingredients: wherein R1 represents a (substituted) aryl group, R2 represents a phenyl group substituted at 4-position by a lower alkoxyl, group or a lower alkylthio group, R3 represents a lower alkoxyl group, a halogenated lower alkyl group, a lower cycloalkyl group, a (substituted) aryl group, a (substituted) aryloxy group, a (substituted)... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090270403 - Novel 1,4-diaza-bicyclo[3.2.2]nonyl pyrimidinyl derivative and its medical use: Due to its pharmacological profile the compound of the invention may be useful for the treatment of diseases or disorders as diverse as those related to the cholinergic system of the central nervous system (CNS), the peripheral nervous system (PNS), diseases or disorders related to smooth muscle contraction, endocrine diseases... Agent: Birch Stewart Kolasch & Birch

20090270402 - Novel triazolopyridazines: e

20090270404 - Oxymethylene aryl compounds and uses thereof: Use of oxymethylene aryl GPR119 agonists and DPP IV inhibitors for the treatment of diabetic diseases, including Type II diabetes and other diseases associated with poor glycemic control are provided.... Agent: Metabolex, Inc.

20090270400 - Painkilling association comprising a dihydroimidazopyrazine derivative: The invention relates to a product comprising (1R)-1-[(({2R)-2-amino-3-[(8S)-8-(cyclohexylmethyl) -2-phenyl-5,6-dihydroimidazo [1,2-a]pyrazin-7(8H)-yl]-3-oxopropyl}dithio)methyl]-2-[(8S)-8-(cyclohexylmethyl) -2-phenyl-5,6-dihydrolmidazo[1,2-a]pyrazin-7(8H)-yl]-2-oxoethylamine in association with an analgesic agent selected from morphine, the similar or a morphine derivative, sodium channel inhibitors, non-steroidal antiflammatory agents (AINS), glutamatergic system inhibitors, tricycle antidepressants and gabaergic derivatives for simultaneous therapeutic use which is separated or out... Agent: Hunton & Williams LLP Intellectual Property Department

20090270405 - Quinuclidine compounds as alpha-7 nicotinic acetylcholine receptor ligands: The disclosure provides compounds of formula I, including their salts, as well as compositions and methods of using the compounds. The compounds are ligands for the nicotinic α7 receptor and may be useful for the treatment of various disorders of the central nervous system, especially affective and neurodegenerative disorders.... Agent: Louis J. Wille Bristol-myers Squibb Company

20090270401 - Use of a dihydroimidazopyrazoine derivative for treating or preventing pain: The invention relates to the use of (1R)-1-[({(2R)-2-amino-3-[(8S)-8-(cyclohexylmethyl)-2-phenyl-5,6-dihydroimidazo[1,2-a]pyrazine-7(8H)-yl]-3-oxopropyl}dithio)methyl]-2-[(8S)-8-(cyclohexylmethyl)-2-phenyl-5,6-dihydroimidazo[1,2-a]pyrazine-7(8H)-yl]-2-oxoethylamine or an pharmaceutically acceptable salt thereof for preparing a drug for preventing or treating pain.... Agent: Hunton & Williams LLP Intellectual Property Department

20090270406 - Combination therapy for the treatment of urinary frequency, urinary urgency and urinary incontinence: This invention concerns compositions for the treatment of urinary frequency, urinary urgency and urinary incontinence comprising (R)-N-[4-[2-[[2-hydroxy-2-(pyridin-3-yl)ethyl]amino]ethyl]phenyl]-4-[4-(4-tri-fluoromethylphenyl)thiazol-2-yl]benzenesulfonamide and pharmaceutically acceptable salts thereof. In another aspect, this invention concerns combination therapy for urinary frequency, urinary urgency and urinary incontinence wherein one of the active agents is (R)-N-[4-[2-[[2-hydroxy-2-(pyridin-3-yl)ethyl]amino]ethyl]phenyl]-4-[4-(4-tri-fluoromethylphenyl)thiazol-2-yl]benzenesulfonamide and pharmaceutically acceptable salts... Agent: Merck And Co., Inc

20090270407 - Fungicidal isoxazolidines: Also disclosed are compositions containing the compounds of Formula 1 and methods for controlling plant disease caused by a fungal pathogen comprising applying an effective amount of a compound or a composition of the invention.... Agent: E I Du Pont De Nemours And Company Legal Patent Records Center

20090270408 - Amide derivatives as positive allosteric modulators and methods of use thereof: The invention relates to novel amide derivatives that are PAMs of neuronal nicotinic receptors, compositions comprising the same, processes for preparing such compounds, and methods for using such compounds and compositions.... Agent: Paul D. Yasger Abbott Laboratories

20090270409 - Compounds and compositions as modulators of gpr119 activity: The invention provides compounds, pharmaceutical compositions comprising such compounds and methods of using such compounds to treat or prevent diseases or disorders associated with the activity of GPR119.... Agent: Genomics Institute Of The Novartis Research Foundation

20090270410 - Benzazole analogues and uses thereof: e

20090270411 - Phenanthridine derivatives as bradykinin antagonists: The present invention relates to new phenanthridine derivatives of formula (I), wherein the variables are as defined in the specification, to processes for producing the same, to pharmacological compositions containing the same and to their use in therapy or prevention of painful and inflammatory processes.... Agent: Fish & Richardson P.C.

20090270412 - Pyrido[3,4-b]indoles and methods of use: This disclosure relates to new heterocyclic compounds that may be used to modulate a histamine receptor in an individual. Pyrido[3,4-b]indoles are described, as are pharmaceutical compositions comprising the compounds and methods of using the compounds in a variety of therapeutic applications, including the treatment of a cognitive disorder, psychotic disorder,... Agent: Morrison & Foerster LLP

20090270413 - Di-t-butylphenyl piperazines as calcium channel blockers: Methods and compounds effective in ameliorating conditions characterized by unwanted calcium channel activity, particularly unwanted N-type and/or T-type calcium channel activity are disclosed. Specifically, a series of compounds containing di-t-butyl phenyl piperazine derivatives of the general formula (1).... Agent: Morrison & Foerster LLP

20090270414 - 2,3,4,9- tetrahydro-1h-carbazole derivatives as crth2 receptor antagonists: The invention relates to novel tetrahydro-1H-carbazole derivatives and their use as active ingredients in the preparation of pharmaceutical compositions. The invention also concerns related aspects including processes for the preparation of the compounds, pharmaceutical compositions containing one or more of those compounds and methods of treatment comprising administration of said... Agent: Hunton & Williams LLP Intellectual Property Department

20090270419 - Combinations of class-i specific histone deacetylase inhibitors with proteasome inhibitors: The present invention is concerned with combinations of a proteasome inhibitor and a class-I specific histone deacetylase inhibitor for inhibiting the growth of tumor cells, useful in the treatment of cancer.... Agent: Philip S. Johnson Johnson & Johnson

20090270415 - Compounds that inhibit protease cathepsin s and hcv replication: The present invention is directed to compounds that have the dual property of acting as cathepsin S inhibitors and of inhibiting HCV replication. Such compounds are therefore useful in treating disease states that include hepatitis C, Alzheimer's disease, and autoimmune disorders. The present invention is also directed to pharmaceutical compositions... Agent: Townsend And Townsend And Crew, LLP

20090270416 - N-oxides of diarylurea derivatives and their use as chk1 inhibitors for the treatment of cancer: The invention provides a Chk-1 kinase inhibiting compound of the formula (I) or a salt, solvate or tautomer thereof, wherein: G is CH2, O, NH, NHCO or CONH; A is a group (CH2)n where n is 1 to 4 provided that when G is O or NH, n is at... Agent: Heslin Rothenberg Farley & Mesiti PC

20090270417 - Organic compounds: Novel 3,4-di-, 3,3,4-di-, 3,4,4,-tri- and 3,3,4,4-tetra-substituted pyrrolidine compounds, these compounds for use in the diagnostic and therapeutic treatment of a warm-blooded animal, especially for the treatment of a disease (=disorder) that depends on inappropriate activity of renin; the use of a compound of that class for the preparation of a... Agent: Novartis Institutes For Biomedical Research, Inc.

20090270418 - Pyrazole pyrazine amine compounds as kinase inhibitors, compositions thereof and methods of treatment therewith: Wherein Q and R1-R3 are as defined herein, compositions comprising an effective amount of a Pyrazole Pyrazine Amine Compound and methods for treating or preventing inflammatory conditions, immunological conditions, cancer, neurodegenerative diseases, age-related diseases, cardiovascular diseases and metabolic conditions, or conditions treatable or preventable by inhibition of an IKK, or... Agent: Jones Day

20090270421 - Inhibitors of fatty acid amide hydrolase: Potent inhibitors of fatty acid amide hydrolase (FAAH) are constructed having Ki's below 200 pM and activities 102-103 times more potent than the corresponding trifluoromethyl ketones. The potent inhibitors combine several features, viz.: 1.) an α-keto heterocylic head group; 2.) a hydrocarbon linkage unit employing an optimal C12-C8 chain length;... Agent: Schwegman, Lundberg & Woessner, P.A.

20090270420 - Methods for inhibiting cardiac pai-1: The invention relates to methods of inhibiting cardiac PAI-1 by administering a PAI-1 antagonist.... Agent: Hunton & Williams LLP Intellectual Property Department

20090270423 - Antibacterial small molecules and methods for their synthesis: The present invention relates generally to compounds providing antibacterial therapeutic agents and preparations, and related methods of using and making antibacterial compounds. Antibacterial compounds of the present invention include chalcone, alkylpyrimidine, aminopyrimidine and cyanopyridine compounds and derivatives thereof exhibiting minimum inhibitory concentrations (MIC) similar to or less than conventional antibacterial... Agent: Greenlee Winner And Sullivan P C

20090270422 - Gpr119 receptor agonists in methods of increasing bone mass and of treating osteoporosis and other conditions characterized by low bone mass, and combination therapy relating thereto: The present invention relates to the use of GPR119 receptor agonists for treating or preventing a condition characterized by low bone mass, such as osteoporosis, and for increasing bone mass in an individual. The present invention further relates to the use of a GPR119 receptor agonist in combination with a... Agent: Fish & Richardson P.C.

20090270424 - Antibacterial small molecules and methods for their synthesis: A crystalline N-(4-(4-aminothieno[2,3-d]pyrimidin-5-yl)phenyl)-N′-[2-fluoro-5-(trifluoromethyl)phenyl)urea hydrochloride, ways to make it, compositions comprising it, and methods of treatment using it are disclosed.... Agent: Paul D. Yasger Abbott Laboratories

20090270425 - 3-(dihydro-1h-pyrazolo[4,3-d]pyrimidin-5-yl)-4-propoxybenzenesulfonamide derivatives and methods of use: This invention relates to novel 3-(dihydro-1H-pyrazolo[4,3-d]pyrimidin-5-yl)-4-propoxybenzenesulfonamide compounds, their derivatives, pharmaceutically acceptable salts, solvates, and hydrates thereof. This invention also provides compositions comprising a compound of this invention and the use of such compositions in methods of treating diseases and conditions that are beneficially treated by administering inhibitors of cyclic guanosine... Agent: Edwards Angell Palmer & Dodge LLP

20090270426 - P13 kinase antagonists: The present invention provides novel PI3-Kinase antagonists and methods of use thereof.... Agent: Townsend And Townsend And Crew, LLP

20090270427 - Purine derivatives: e

20090270429 - Antiviral formulation: A topical antiviral composition comprising acyclovir, penciclovir and/or omaciclovir in a glucocorticoid-free pharmaceutical carrier comprising 15 to 25 weight % propylene glycol and 10 to 25 weight % isopropyl C12-C22 alkanoic ester. The compositions have utility in the treatment or prophylaxis of herpesvirus infections. Clinical results demonstrate that treatment commencing... Agent: Birch Stewart Kolasch & Birch

20090270428 - Cyclopropanecarboxylate esters of acyclovir: The present invention provides compounds of Formula (I), pharmaceutical compositions thereof, methods of using the same, processes for preparing the same, and intermediates thereof.... Agent: Eli Lilly & Company

20090270430 - Pyridopyrimidinone inhibitors of pl3kalpha: e

20090270431 - Cyclopentenol nucleoside compounds intermediates for their synthesis and methods of treating viral infections: The present invention relates to compounds according to the structure (I), Where B is formula (Ia), formula (Ib) or formula (Ic); A is H, OR2 or halogen (F, Cl, Br, I, preferably F or Br, more preferably F); A′ is H, OR2 or halogen (F, Cl, Br, I, preferably F... Agent: Coleman Sudol Sapone, P.C.

20090270432 - 7-[2-[4-(6-fluoro-3-methyl-1,2-benzisoxazol-5-yl)-1-piperazinyl]ethyl]-2-(1-propynyl)-7h-pyrazolo-[4,3-e]-[1,2,4]-triazolo-[1,5-c]-pyrimidin-5-amine: e

20090270433 - 2,3-dihydro-iminoisoindole derivatives:

20090270434 - Azacycloalkane derivatives as inhibitors of stearoyl-coenzyme a delta-9 desaturase: Azacycloalkane derivatives of structural formula I are selective inhibitors of stearoyl-coenzyme A delta-9 desaturase (SCD1) relative to other known stearoyl-coenzyme A desaturases. The compounds of the present invention are useful for the prevention and treatment of conditions related to abnormal lipid synthesis and metabolism, including cardiovascular disease, such as atherosclerosis;... Agent: Merck And Co., Inc

20090270436 - Spirochromanon derivatives: The invention relates to a compound of a general formula (I): wherein Ar1 represents a group formed from an aromatic ring selected from a group consisting of benzene, pyrazole, isoxazole, pyridine, indole, 1H-indazole, 1H-furo[2,3-c]pyrazole, 1H-thieno[2,3-c]pyrazole, benzimidazole, 1,2-benzisoxazole, imidazo[1,2-a]pyridine, imidazo[1,5-a]pyridine and 1H-pyrazolo[3,4-b]pyridine, having Ar2, and optionally having one or two or... Agent: Merck And Co., Inc

20090270435 - Spiroketone acetyl-coa carboxylase inhibitors: The invention provides compounds of Formula (1) or a pharmaceutically acceptable salt of said compound, wherein R1, R2, R3, R4, R5, R6, R7, R8 and R9 are as described herein; pharmaceutical compositions thereof; and the use thereof in treating mammals suffering from the condition of being overweight.... Agent: Pfizer Inc. Patent Department

20090270437 - Use of buprenorphine or n-alkylated derivatives thereof for wound healing: This invention relates to opioid compounds such as burenorphine or N-alkylated derivatives thereof for wound healing.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20090270438 - Novel compositions and formulations: There is provided according to the invention a non-pressurised pharmaceutical liquid solution spray composition comprising: (i) buprenorphine; and a solvent comprising ethanol which composition is substantially free of chloride. There is also provided according to the invention a non-pressurised pharmaceutical liquid solution spray formulation comprising: (i) buprenorphine; (ii) a solvent... Agent: Klauber & Jackson

20090270439 - Prophylactic/therapeutic agent for alzheimer's disease: A medicament effective for inhibiting onset of Alzheimer disease via intracellular aggregation mechanism is provided. A medicament for prophylaxis and treatment of Alzheimer disease comprising as an active ingredient apomorphine hydrochloride wherein cell death dependent upon intracellularly accumulated amyloid β proteins and/or p53 is inhibited; and/or wherein a level of... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090270440 - Bioavailability of active substances having an amidine function in medicaments: The invention relates to the use of N,N′-dihydroxyamidine (I), N,N′-dihydroxyamidine ether (II), N,N′-dihydroxyamidine diether (III), N,N′-dihydroxyamidine ester (IV), N,N′-dihydroxyamidine diester (V) or 4-hydroxy-1,2,4-oxadiazoline (VI) of the formulae cited above, wherein R represents hydrogen, an alkyl and/or aryl radical, as a substitute for an amidine function of a medicament for improving... Agent: Darby & Darby P.C.

20090270441 - Macrolides: The invention relates to the stabilization of poly-ene macrolides and to a particular macrolide obtained in crystalline form.... Agent: Novartis Corporate Intellectual Property

20090270442 - Polymorphs of hydrochloride salt of 5-(3-(ethylsulfonyl)phenyl)-3,8-dimethyl-n-(1-methylpiperidin-4-yl)-9h-pyrido[2,3-b]indole-7-carboxamide and methods of use therefor: e

20090270443 - 1-amino imidazo-containing compounds and methods: Imidazo-containing compounds (e.g., imidazonaphthyridines, imidazopyridines) with an amino substituent at the 1-position, pharmaceutical compositions containing the compounds and methods of use of these compounds as immunomodulators, for inducing cytokine biosynthesis in animals and in the treatment of diseases including viral and neoplastic diseases are disclosed.... Agent: Wolf Greenfield & Sacks, P.C.

20090270444 - 1,7-naphthyridines: i

20090270447 - 2-aryl-and 2-heteroarylthiazolyl compounds, methods for their preparation and use thereof: The present invention discloses fused heterobicyclic 2-aryl- and 2-heteroarylthiazolyl compounds and their pharmaceutically acceptable salts and esters thereof, which are useful for inhibiting the growth of cancerous cells, inhibiting human breast carcinoma tumor growth in particular and to treat diseases or disorders associated with securin.... Agent: Wyeth Patent Law Group

20090270446 - Diamine derivatives: The present invention relates to diamine compounds which inhibit activated blood coagulation factor X and exhibit an anticoagulant effect and there uses for treating various diseases based on thromboembolism.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, P.C.

20090270448 - Pharmaceutical formulations comprising clopidogrel: Melt granulate in the form of a solid state dispersion of the drug in a pharmaceutically acceptable carrier, wherein said melt granulate comprises a pharmaceutically active compound, preferably clopidogrel, at least one carrier material, and optionally pharmaceutically acceptable excipients and method of making said melt granulate.... Agent: Birch Stewart Kolasch & Birch

20090270445 - Thiazole compounds and methods of use: The invention relates to methods of using thiazole compounds of Formula I and Formula II and compositions thereof for treating diseases mediated by protein kinase B (PKB) such as cancer and other proliferative disorders where the variables have the definitions provided herein.... Agent: Amgen Inc.

20090270449 - Aminophenyl derivatives as selective androgen receptor modulators: e

20090270450 - Chemical compounds: or pharmaceutically acceptable salts thereof which possess CSF-1R kinase inhibitory activity and are accordingly useful for their anti-cancer activity and thus in methods of treatment of the human or animal body. The invention also relates to processes for the manufacture of said chemical compounds, to pharmaceutical compositions containing them and... Agent: Astrazeneca R&d Boston

20090270451 - Piperdine glycine transporter inhibitors: The present invention is directed to piperidine compounds that inhibit the glycine transporter GlyT1 and which are useful in the treatment of neurological and psychiatric disorders associated with glycinergic or glutamatergic neurotransmission dysfunction and diseases in which the glycine transporter GlyT1 is involved.... Agent: Merck And Co., Inc

20090270452 - Use of soluble epoxide hydrolase inhibitors in the treatment of smooth muscle disorders: Disclosed herein are compounds, compositions, and methods for enhancing smooth muscle function in a subject by administration of soluble epoxide hydrolase inhibitors and for treating subjects with smooth muscle disorders including erectile dysfunction, overactive bladder, uterine contractions and irritable bowel syndrome.... Agent: Foley & Lardner LLP

20090270453 - Anti-manic effective doses of sertindole: The present invention relates to uses of an anti-manic effective dose sertindole in the preparation of a pharmaceutical composition for the treatment of mania, and to methods of treating mania comprising administering said effective dose of sertindole. In separate aspects of the invention, said uses and methods are directed to... Agent: Lundbeck Research Usa, Inc. Attention: Stephen G. Kalinchak, Legal

20090270454 - Sulfonamide containing compounds for treatment of inflammatory disorders: X and Y are independently selected from —CH2— or —CH2—CH2—; Z is selected from S(O)m or Se(O)m and m is 0, 1 or 2; R1 is optionally substituted heteroaryl or heterocyclic; R2 is selected from the group consisting of hydrogen, C1-C6 straight alkyl, and C1-C6 branched alkyl, wherein all may... Agent: King & Spalding

20090270455 - Therapeutic agent for intestinal diseases and visceral pain: The present invention relates to a therapeutic agent for irritable bowel syndrome of diarrhea type, ulcerative colitis, visceral pain or abdominal pain, which contains a compound of the following formula and which has 5-HT7 receptor antagonistic effect or an analogue thereof; and this therapeutic agent has an excellent therapeutic effect... Agent: The Nath Law Group

20090270456 - Novel chemical compounds: This invention relates to newly identified compounds for inhibiting hYAK3 and/or CK2 proteins and methods for treating diseases associated with the imbalance or inappropriate activity of hYAK3 and/or CK2 proteins.... Agent: Glaxosmithkline Corporate Intellectual Property Uw2220

20090270457 - 6,11-bicyclolides: bridged biaryl macrolide derivatives: which exhibit antibacterial properties. The present invention further relates to pharmaceutical compositions comprising the aforementioned compounds for administration to a subject in need of antibiotic treatment. The invention also relates to methods of treating a bacterial infection in a subject by administering a pharmaceutical composition comprising the compounds of the... Agent: Elmore Patent Law Group, PC

20090270459 - Flea control agent containing n-substituted indole derivative: Conventional control agents against fleas parasitic on animals do not have sufficient selective toxicity and are hence not safe for the animals to which the control agents are applied. The control agents are not always satisfactory also in control effect and quick-acting properties. Intensive studies were made on the insecticidal... Agent: Nields, Lemack & Frame, LLC

20090270458 - Method of treating of demyelinating diseases or conditions: N-(Pyridinyl)-1H-indol-1-amines of formula I provide a unique combination of blocking properties for both the potassium and sodium channels. These compounds are useful for the treatment of Demyelinating Diseases and Conditions such as Multiple Sclerosis, Spinal Cord Injury, Traumatic Brain Injury and Stroke. The compounds are also useful for Stroke Rehabilitation,... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20090270462 - 2-sulfanyl-substituted imidazole derivatives and their use as cytokine inhibitors: The invention relates to 2-thio-substituted imidazole derivatives of the Formula I, and to methods of use thereof.... Agent: Edwards Angell Palmer & Dodge LLP

20090270461 - Fungicide n-cycloalkyl-carboxamide, thiocarboxamide and n-substituted-carboximidamide derivatives: The present invention relates to N-cycloalkyl-carboxamide, N-cycloalkyl-thiocarboxamide and N-cycloalkyl-N-substituted carboximidamide derivatives of formula (I) wherein A represents carbo-linked, 5-membered heterocyclyl groups, T represents O, S, NRc, N—ORd, N—NRcRd or N—CN, Z1 represents cycloalkyl groups and Z2 and Z3, W1 to W5 represent various substituents; their process of preparation, their use... Agent: Ostrolenk Faber Gerb & Soffen

20090270460 - Fxr agonists: Compounds of formula wherein variables are as defined herein and their pharmaceutical compositions and methods of use are disclosed as useful for treating dyslipidemia and related diseases.... Agent: Eli Lilly & Company

20090270463 - Amido derivatives-contained pharmaceutical composition: The present invention relates to a pharmaceutical composition containing a solid dispersion comprising an amide derivative or a salt thereof and a water-soluble polymer, wherein the pharmaceutical composition is not prepared by a melting method. The pharmaceutical composition contains the solid dispersion having an improved oral absorption, properties suitable for... Agent: Townsend And Townsend And Crew, LLP

20090270464 - Benzimidazole derivative and use as a ii receptor antagonist: wherein R2, R3, R4, R5, R6, R7 and R8 are each independently a hydrogen atom or a C1-6 alkyl, or a salt thereof. The compound of the present invention is useful as an agent for the prophylaxis or treatment of circulatory diseases such as hypertension and the like and metabolic... Agent: Foley And Lardner LLP Suite 500

20090270466 - Epothilones c, d, e, and f, preparation and compositions: The present invention relates to epothilones C, D, E, and F, their preparation and their use for the production of therapeutic compositions and compositions for plant protection.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20090270465 - Use of epothilone d in treating tau-associated diseases including alzheimer's disease: Methods of treating Tau-associated diseases, preferably tauopathies, are described using epothilone D that exhibit good brain penetration, long half-life, and high selective retention in brain, and provides effective therapies in treating tauopathies including Alzheimer's disease.... Agent: Louis J. Wille Bristol-myers Squibb Company

20090270467 - Aminocyclohexanes as dipeptidyl peptidase-iv inhibitors for the treatment or prevention of diabetes: The present invention is directed to novel substituted aminocyclohexanes of structural formula (I) which are inhibitors of the dipeptidyl peptidase-IV enzyme and which are useful in the treatment or prevention of diseases in which the dipeptidyl peptidase-IV enzyme is involved, such as diabetes and particularly Type 2 diabetes. The invention... Agent: Merck And Co., Inc

20090270468 - Preparation and use of aryl alkyl acid derivatives for the treatment of obesity: This invention relates to certain aryl alkyl acid compounds, compositions, and methods for treating or preventing obesity and related diseases.... Agent: Edwards Angell Palmer & Dodge LLP

20090270469 - Substituted oxazolidinones: The present invention relates to new oxazolidinone modulators of skeletal muscle function and tone, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20090270470 - Compounds i: e

20090270471 - Method for inhibiting mycotoxin production: The present invention provides a method for prominently inhibiting the production in fungi of mycotoxin, which has serious effects on health of humans and other animals, and provides a mycotoxin production inhibitor. Mycotoxin content such as deoxinivalenol (DON) in harvested crops can be reduced without a correlation with the control... Agent: Kenyon & Kenyon LLP

20090270472 - Method to use oxymetazoline to interrupt the development of the common cold syndrome: This invention describes a new manner of treating the common cold. It claims that treatment with Oxymetazoline nasal spray at the time of onset of first cold symptom(s) can interrupt the development of the common cold syndrome and result in cure of the cold.... Agent: Kenneth Gould M.d.

20090270473 - Dual-acting antihypertensive agents: wherein: Q, W, Y, Z, r, and Ar are as defined in the specification, and pharmaceutically acceptable salts thereof. These compounds have AT1 receptor antagonist activity and neprilysin inhibition activity. The invention is also directed to pharmaceutical compositions comprising such compounds; methods of using such compounds; and process and intermediates... Agent: Theravance, Inc.

20090270474 - Therapeutic agent for keratoconjunctival disorder: An object of the present invention is to discover a new use of eprosartan or a salt thereof. Eprosartan or a salt thereof exhibits an excellent improving effect in a corneal disorder model, and therefore is useful as a therapeutic agent for a keratoconjunctival disorder such as dry eyes, corneal... Agent: Frishauf, Holtz, Goodman & Chick, PC

20090270475 - Inhibition of bacterial biofilms with imidazole-phenyl derivatives: Disclosure is provided for imidazole-phenyl derivative compounds that prevent, remove and/or inhibit the formation of biofilms, compositions comprising these compounds, devices comprising these compounds, and methods of using the same.... Agent: Myers Bigel Sibley & Sajovec

20090270476 - Pharmaceutical composition for treatment or prevention of nephritis and manufacturing method thereof: s

20090270477 - Polymorphs of a hydroisoindoline tachykinin receptor antagonist: This application is directed to a novel polymorph of a hydroisoindoline tachykinin receptor antagonist having the following structural formula A.... Agent: Merck And Co., Inc

20090270478 - Ion channel modulating activity ii: Methods, compositions, dosing regimes, and routes of administration for the treatment or prevention of arrhythmias. In these methods, arrythmias (e.g., atrial fibrillation, atrial flutter, early afterdepolarizations and prolongation of QT interval) may be reduced or eliminated by administering ion channel modulating compounds to a subject in need thereof. The ion... Agent: Seed Intellectual Property Law Group PLLC

20090270492 - Bryostatin analogues, synthetic methods and uses: Biologically active compounds related to the bryostatin family of compounds, including methods of utilizing the same.... Agent: King & Spalding LLP

20090270493 - Cyclic 1-(acyloxy)-alkyl prodrugs of gaba analogs, compositions and uses thereof: The present invention provides cyclic 1-(acyloxy)-alkyl prodrugs of GABA analogs, methods of making cyclic 1-(acyloxy)-alkyl prodrugs of GABA analogs and compositions of cyclic 1-(acyloxy)-alkyl prodrugs of GABA analogs. The present invention also provides methods of using cyclic 1-(acyloxy)-alkyl prodrugs of GABA analogs and compositions of cyclic 1-(acyloxy)-alkyl prodrugs of GABA... Agent: Xenoport, Inc.

20090270494 - Salts of dihydroxyanthraquinone carboxylic acids and their therapeutic use: A compound of general formula (I): wherein Xi is H or COR1 and X2 is H or COR2 but X1 and X2 are not both H; R1 and R2 are the same or different and are each C1-4 alkyl substituted with R3, or a four to seven-membered ring which can... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20090270495 - Inhibitors of phosphodiesterase types 1 to 5 based on dioclein, floranol, and analogs thereof: We disclose substances and a process of developing such substances as potent and selective inhibitors of isoforms of phosphodiesterases of types 1 to 5 (PDE1, PDE2, PDE3, PDE4, PDE5) based on two flavonoids: dioclein, floranol and natural or synthetic analogs thereof. They may be associated with cyclodextrins in inclusion complexes... Agent: Nixon & Vanderhye, PC

20090270496 - Antifungal compounds: Antifungal compounds having a benzofuran structure. Antifungals exhibit much less toxicity to human cells than amiodarone. These compounds are useful alone or in combination with other compounds having antifungal activity. Compounds of this invention exhibit synergistic antifungal activity in combination with antifungal amiodarone compounds. The invention provides pharmaceutical compositions useful... Agent: Greenlee Winner And Sullivan P C

20090270497 - Treatment of non-localized inflammation with pan-hdac inhibitors: Described herein are compositions and methods for treating a subject suffering from a non-localized inflammatory condition (or any symptoms associated with such inflammation), including systemic inflammation, and inflammatory conditions affecting the large portions of or the whole body, or sepsis by administering to the subject a pharmaceutical composition comprising a... Agent: Wilson, Sonsini, Goodrich & Rosati

20090270498 - Lipoxin compounds and their use in treating cell proliferative disorders: Compounds having the active site of natural lipoxins, but a longer tissue half-life are disclosed. In particular, 15-epi-lipoxins and their use in ameliorating undesired cell proliferation, which characterizes diseases such as cancer, are also disclosed.... Agent: Fulbright & Jaworski L.L.P. Attn: MnIPDocket

20090270499 - Process for synthesizing atazanavir: This invention relates to a process for synthesizing Atazanvir, including novel intermediates and novel steps to various intermediates along the synthetic pathway.... Agent: Fish & Richardson P.C.

20090270500 - 4-trimethylammonio-butyrates as cpt2 inhibitors: i

20090270501 - Composition and method for increasing the anabolic state of muscle cells: A nutritional supplement comprising at least a therapeutically effective amount of ethyl pyruvate and a therapeutically effective amount of at least one α-hydroxy branched-chain amino acid metabolite is provided by the present invention. The ingredients of the present nutritional supplement substantially simultaneously act to induce a anabolically-favorable state for muscle... Agent: Iovate Health Science Research Inc.

20090270502 - method for lowering risk of cardiovascular diseases: The present invention relates to a method for lowering risk of cardiovascular diseases in human, particularly for lowering low density lipoprotein cholesterol (LDL-C) concentration and oxidative stress level while maintaining sufficient high density lipoprotein cholesterol (HDL-C) concentration in human, and to a dietary formulation and a fat or fat blend... Agent: Birch Stewart Kolasch & Birch

20090270503 - Nutritional supplements: The present disclosure relates to novel nutritional methods and compositions containing essential fatty acids which optimize embryonic, fetal and child neurological development and provides improved nutritional support for women prior to and during lactation. Further the methods and compositions improve gestational length and birth weight. The nutritional methods and compositions... Agent: Kv Pharmaceutical Company

20090270504 - Treatment of huntington's disease with epa: Analysis of the huntington gene provides a method for identifying patients likely to respond to treatment of Huntington's disease with eicosapentaenoic acid, EPA.... Agent: Buchanan, Ingersoll & Rooney PC

20090270505 - 4-dimethylaminobutyric acid derivatives: wherein A1, A2, R1, m and n are as defined in the description and in the claims, as well as pharmaceutically acceptable salts thereof. These compounds inhibit carnitine palmitoyl transferase (CPT) activity, in particular CPT2 activity, and can be used as medicaments in methods for the treatment of diseases modulated... Agent: Hoffmann-la Roche Inc. Patent Law Department

20090270507 - Concentrated liquid thyroid hormone composition: This invention is directed generally to a liquid pharmaceutical composition comprising at least one thyroid hormone (particularly a composition further comprising at least one cyclodextrin compound), a process for making such a composition and a method of using such a composition to treat a condition associated with impaired thyroid hormone... Agent: Intervet/schering-plough Animal Health

20090270506 - Crystalline structure of oxidosqualene synthase: The present invention relates to crystal forms of mammalian OSC and the crystal structure information obtained from them, to methods of preparing such crystal forms, and to their use for the identification and/or design of inhibitors of OSC activity. A further subject matter of the invention are methods for the... Agent: Hoffmann-la Roche Inc. Patent Law Department

20090270508 - Glur2 receptor modulators: The present invention provides for compositions and methods for modulating the GluR2 receptor. It is based, at least in part, on the discovery, by X-ray crystallography, that a known GluR2 agonist binds to the receptor in two different orientations, thereby diminishing its potency. The present invention provides for structural alternatives... Agent: Kevin C. Hooper

20090270509 - Nitric oxide-releasing molecules: This invention relates to compositions comprising carbon-based diazeniumdiolates that release nitric oxide (NO). The carbon-based diazeniumdiolated molecules release NO spontaneously under physiological conditions without subsequent nitrosamine formation. The present invention also relates to methods of preparing the carbon-based diazeniumdiolated molecules, compositions comprising such molecules, methods of using such compositions, and... Agent: Pillsbury Winthrop Shaw Pittman, LLP

20090270510 - Glycine transport inhibitors: The present invention relates to compounds of formula (I), or salts or solvates thereof, their use in the manufacture of medicaments for treating neurological and neuropsychiatric disorders, in particular psychoses, dementia or attention deficit disorder. The invention further comprises processes to make these compounds and pharmaceutical formulations thereof.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20090270512 - Pan-antagonists for the androgen receptor and androgen receptor mutants associated with anti-androgen withdrawal: Disclosed herein are novel antagonists of the androgen receptor and androgen receptor mutations associated with clinical failure of currently prescribed anti-androgens and use of said antagonists in the treatment of conditions associated with inappropriate activation of the androgen receptor.... Agent: Potter Anderson & Corroon LLP Attn: Janet E. Reed, Ph.d.

20090270511 - Prodrugs of inhibitors of cathepsin s: The present invention provides compounds of formula (I) which are prodrugs of inhibitors of cathepsin S and as such are useful in the prevention and treatment of cathepsin S dependent diseases and conditions including, but not limited to, chronic obstructive pulmonary disease (COPD) and pain.... Agent: Merck And Co., Inc

20090270513 - 3,5-dihydroxy-2,4-cyclohexadienones and their derivatives, dietary compositions and fortified food containing them and their uses: The present invention refers especially to 3,5-dihydroxy-2,4-cyclohexadienones of the general formula (I) wherein R1 and R2 are independently from each other C1-6-alkyl, C2-6-alkenyl or x-oxo-Cx-alkyl with x being an integer from 1 to 6, preferably R1 and R2 are independently from each other C2-6-alkenyl or y-oxo-Cy-alkyl with y being an... Agent: Nixon & Vanderhye, PC

20090270515 - Active ingredient containing stabilised solid medicinal forms and method for the production thereof: The invention relates to solid medicinal forms containing at least one active ingredient and at least one pharmaceutically compatible, water soluble drying agent which is selected from the group consisting of trimagnesium dicitrate and/or calcium chloride, the solid medicinal form having a drying loss of at most 6% and a... Agent: Smith Patent Consulting, LLC

20090270514 - Methods for regulating gelation of polysaccharide solutions and uses thereof: The present invention provides a method for preparing chito san solutions to allow regulating the conditions in which the chitosan solution will gel. The present invention also provides methods for using chitosan solutions as compositions and for using chitosan solutions in vitro and in vivo.... Agent: University Of Virginia Patent Foundation

20090270516 - Process for producing optically active theaspirane: A simplified production method of stereoisomer of theaspiran having high optical purity has been desired. An alcohol compound having a specific skeleton is enantioselectively esterified with an enzyme, or an ester compound having a specific skeleton is enantioselectively hydrolyzed with an enzyme. The resultant optically active ester or optically active... Agent: Edwards Angell Palmer & Dodge LLP

20090264337 - Cellular gprs-communication linked glucometer - pedometer: The Cellular GPRS system includes a cellular-based Glucometer (CBG) for blood glucose monitoring, a pedometer for exertion measurement, combined with user-entered dietary or other diabetes-relevant information. Data from all inputs is transmitted over a cellular network, using a GPRS or other wireless link. The data is preferably stored in the... Agent: Eric P. Mirabel

20090264336 - Heteroaryl benzamide derivatives for use as glk activators in the treatment of diabetes: e

20090264338 - Inhibitor of insulin multimer formation: An insulin preparation having an ultra-rapid onset of action is provided by adding a substance that interacts with the insulin dimer formation surface or the hexamer formation surface to an insulin solution. The substance exerts its effect by inhibiting insulin dimer formation and/or hexamer formation.... Agent: Cermak Kenealy Vaidya & Nakajima LLP Acs LLC

20090264340 - Compositions and methods for increasing the oral absorption of antimicrobials: The present invention provides compositions and methods for increasing absorption of antibacterial agents, particularly third generation cephalosporin antibacterial agents, in oral dosage solid and/or suspension forms. Specifically, the composition is comprised of a biopolymer that is preferably swellable and/or mucoadhesive, a antimicrobial agent, and a cationic binding agent contained within... Agent: Fish & Richardson, P.C.

20090264339 - Heterocyclic compounds: This invention relates to heterocyclic compounds of the formulas shown in the specification. It also relates to methods for treating inflammatory diseases or immune diseases, developmental or degenerative diseases, and tissue injuries with one of the heterocyclic compounds.... Agent: Occhiuti Rohlicek & Tsao, LLP

20090264341 - Purified arabinogalactan-protein (agp) composition useful in the treatment psoriasis and other disorders: A purified Arabinogalactan-Protein (AGP) composition isolated through a selective method from the leaves and/or stems of Argemone mexicana plant is described. Also described is a purified Arabinogalactan-Protein (AGP) composition isolated from the leaves and/or stems of Argemone mexicana plant, which has one or more of the following effects: immunosuppression, lymphoproliferation... Agent: Ladas & Parry LLP

20090264342 - Compositions and methods for antibiotic potentiation and drug discovery: The present invention provides methods for identifying target genes whose partial or complete functional inactivation potentiates the activity of an antibiotic agent, e.g., a quinolone antibiotic. The invention further provides methods for identifying agents that modulate expression of target genes or that modulate activity of expression products of target genes.... Agent: Choate, Hall & Stewart LLP

20090264343 - Method of producing fr901228: Depsipeptides and congeners thereof are disclosed having structure (I), wherein m, n, p, q, X, R1, R2 and R3 are as defined herein. These compounds, including FR901228, have activity as, for example, immunosuppressants, as well as for the prevention or treatment of patients suffering or at risk of suffering from... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090264346 - Macrocyclic peptides active against the hepatitis c virus: p

20090264345 - Macrocyclic peptides and methods for making and using them: The invention provides novel macrocyclic peptides and methods for their preparation. The invention also provides pharmaceutical compositions and methods to treat, prevent or ameliorate a cell proliferative disease or conditions. e.g., a cancer. in a subject in need thereof, including but not limited to a colon cancer, such as MSS... Agent: Morrison & Foerster LLP

20090264344 - Retrocyclins: antiviral and antimicrobial peptides: Retrocyclin peptides are small antimicrobial agents with potent activity against bacteria and viruses. The peptides are nonhemolytic, and exhibit minimal in vitro cytotoxicity. A pharmaceutical composition comprising retrocyclin as an active agent is administered therapeutically to a patient suffering from a bacterial and/or viral infection, or to an individual facing... Agent: Bozicevic, Field & Francis LLP

20090264348 - Treatment with cyclosporin a: Disclosed herein is a method comprising administering cyclosporin A topically to an eye of a person for the purpose of treating or preventing loss of vision from keratoconus.... Agent: Allergan, Inc.

20090264347 - Use of blood coagulation factor xiii for treating hemophilia a: A patient having hemophilia A is treated by administering factor XIII generally in conjunction with factor VIII or desmopressin.... Agent: Novo Nordisk, Inc. Intellectual Property Department

20090264367 - 5-cnac as oral delivery agent for parathyroid hormone fragments: Pharmaceutical compositions for the effective oral delivery of a parathyroid hormone, PTH, as well as methods for administration of the compositions are provided. Additionally, methods for stimulating new bone formation and treating and/or preventing osteoporosis are also provided.... Agent: Novartis Corporate Intellectual Property

20090264356 - Adenovirus 36 e4 orf 1 gene and protein and their uses: Expression of the E4 orf 1 gene of Ad-36 alone has been discovered to be responsible for the increased insulin sensitivity observed in Ad-36 infected animals, including increased adipogenesis. Ad-36 E4 orf 1 protein can be used to increase insulin sensitivity and ameliorate diabetes. Additionally, drugs that mimic the action... Agent: Patent Department Taylor, Porter, Brooks & Phillips, L.l.p

20090264351 - Antifungal polypeptides: Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from microbial fermentation broths. Nucleic acid molecules comprising nucleotide sequences that encode the antipathogenic polypeptides of the... Agent: Alston & Bird LLP Pioneer Hi-bred International, Inc.

20090264349 - Cd30 ligand: There is disclosed a polypeptide (CD30-L) and DNA sequences, vectors and transformed host cells useful in providing CD30-L polypeptides. The CD30-L polypeptide binds to the receptor known as CD30, which is expressed on a number of cell types, among which are Hodgkin's Disease tumor cells, large cell anaplastic lymphoma cells,... Agent: Immunex Corporation Law Department

20090264360 - Cloning and expression of gonadotropin-releasing hormone (gnrh) receptors: An isolated and purified GnRH protein receptor protein including an amino acid sequence selected from the group and an isolated and purified DNA which comprises a nucleotide sequence coding for the GnRH protein receptor protein. Also, a vector comprising the DNA of the GnRH protein receptor protein, a transformant carrying... Agent: Devine, Millimet & Branch, P.A.

20090264368 - Compositions for delivering parathyroid hormone and calcitonin: The present invention relates to a composition comprising a delivery agent, parathyroid hormone, and calcitonin. This composition exhibits increased delivery of parathyroid hormone and/or calcitonin and is useful for the treatment of osteoporosis. The composition also permits simultaneous oral delivery of parathyroid hormone and calcitonin. The composition of the present... Agent: Emisphere Technologies, Inc. C/o Darby & Darby P.C.

20090264365 - Conformationally constrained parathyroid hormone (pth) analogs: The present invention relates to conformationally constrained parathyroid hormone (PTH) analogs, and methods of preparing and using the PTH analogs. The invention provides novel PTH polypeptide derivatives containing amino acid substitutions at selected positions in the polypeptides. The invention provides derivatives of PTH(1-34), PTH(1-21), PTH(1-20), PTH(1-19), PTH(1-18), PTH(1-17), PTH(1-16), PTH(1-15),... Agent: Clark & Elbing LLP

20090264359 - Fplr-1 inhibitors for use in diseases involving amyloid-induced inflammatory events (flipr and flipr-like) and immunecomplex-mediated diseases: The present invention relates to a FPLR-1 inhibitor selected from the group consisting of FLIPr having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGG FLIPr-like having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERADKLIKEADEKNEHYKGKTVEDLYVIAKKMGKGNTIAVVKIKDGGK fragments of a) or b) having FPLR-1 inhibitory activity; homologues of a), b) or c) having FPLR-1 inhibitory activity; or derivatives of... Agent: Bozicevic, Field & Francis LLP

20090264364 - Genes implicated in the regulation of angiogenesis, pharmaceutical preparations containing them and their applications: Therapeutic compositions used in the field of angiogenesis include nucleotide sequences of genes, the involvement of the genes in the angiogenesis mechanism having been demonstrated by the Applicant, and including the complementary sequences thereof, the antisense sequences of same, polypeptide sequences coded by the coding parts of the aforementioned genes... Agent: Ip Group Of Dla Piper LLP (us)

20090264361 - Identification of a family of secreted proteins in vascular endothelium: The invention relates to SCUBE molecules and generally to gene expression in vascular endothelial cells. The invention specifically relates to the discovery of a novel gene family containing the genes and proteins referred to herein as SCUBE1, SCUBE2 and SCUBE3 which can be expressed in endothelial cells. SCUBE proteins may... Agent: Millennium Pharmaceuticals, Inc.

20090264362 - Influenza virus inhibiting peptides: The present invention provides a pharmaceutical composition for the treatment or prevention of an influenza infection. The composition comprises an isolated polypeptide including a sequence of at least 8 contiguous amino acid residues of the fusion initiation region (FIR) of an influenza hemagglutinin 2 protein or a peptide analog of... Agent: Olson & Cepuritis, Ltd.

20090264350 - Kallikrein inhibitors and anti-thrombolytic agents and uses thereof: Methods, kits and compositions are described that include a non-naturally occurring kallikrein inhibitor and an anti-thrombolytic agent, e.g., an anti-fibrinolytic agent, for preventing or reducing blood loss and/or ischemia, e.g., ischemia associated with perioperative blood loss and cerebral ischemia, the onset of systemic inflammatory response, and/or reperfusion injury, e.g., reperfusion... Agent: Lando & Anastasi, LLP

20090264363 - Leucine-rich peptide compositions and methods for isolation: Disclosed are compositions comprising isolated peptides having a leucine content of from about 12 to about 40 weight percent. Also disclosed is a method for isolating leucine-rich peptides from protein sources such as bovine whey and methods of use for these peptides to provide beneficial effects in a human and/or... Agent: Donna J. Russell

20090264355 - Methods to treat alzheimer's disease or other disorders mediated by amyloid-beta accumulation in a subject: The invention provides methods of delaying the onset, slowing the progression, preventing, or treating Alzheimers disease in a subject. In particular, the invention provides methods of modulating transport of Aβ across the blood brain barrier of the subject.... Agent: Polsinelli Shughart PC

20090264357 - Novel agent that inhibits angiogenesis and metastasis targeting mtor signaling pathway: The present invention relates to a novel function of Msx1 protein for inhibiting tumor angiogenesis and metastasis by targeting mTOR (mammalian target of rapamycin) signaling pathway, and for treating a cancer in a subject. Particularly, Msx1 suppresses mTOR through a direct interaction with mTOR, resulting in the inhibition of angiogenesis.... Agent: LexyoumeIPGroup, LLC

20090264354 - Penumbra nucleic acid molecules, proteins and uses thereof: The present invention relates to murine and human Penumbra (for proerythroblast nu[new] Membrane) nucleic acid molecules, proteins and the uses thereof. The invention further relates to the use of Penumbra molecules for the detection of 7q31q32-related deletions, including such deletions associated with myeloid malignancies, particularly detection by hybridization using Penumbra-based... Agent: The Mccallum Law Firm, P. C.

20090264353 - Splice switching oligomers for tnf superfamily receptors and their use in treatment of disease: The present invention relates to compositions and methods for preparing splice variants of TNFalpha receptor (TNFR) in vivo or in vitro, and the resulting TNFR protein variants. Such variants may be prepared by controlling the splicing of pre-mRNA molecules and regulating protein expression with splice switching oligonucleotides or splice switching... Agent: Fish & Richardson PC

20090264366 - Transglutaminase mediated conjugation of peptides: Methods for conjugating peptides are provided comprising i) reacting a peptide with a first compound comprising a functional group in the presence of a transglutaminase capable of incorporating said compound into the peptide to form a transaminated peptide, and ii) reacting said transaminated peptide with e.g. a functionalized polymer capable... Agent: Novo Nordisk, Inc. Intellectual Property Department

20090264352 - Use of glp-1 and agonists thereof to prevent cardiac myocyte apoptosis: The present invention relates generally to the novel use of GLP-1, including analogs, and agonists, to prevent cardiac myocyte apoptosis. The present invention relates to methods for using GLP-1 for the treatment of conditions associated with cardiac myocyte apoptosis. The present invention further relates to improving the efficiency of cardiac... Agent: Intellectual Property Department Amylin Pharmaceuticals, Inc.

20090264358 - Vegf receptor fusion proteins, their pharmaceutical compositions and therapeutic applications for the eye diseases: Vascular endothelial growth factor (VEGF) receptor fusion protein comprising Ig domain 2 of Flt-1 and Ig domains 3, or Ig domain 2 of Flt-1 and Ig domain 3 and 4 of KDR, the gene encoding the fusion protein, the pharmaceutical composition containing the fusion protein and the pharmaceutical use of... Agent: Edwards Angell Palmer & Dodge LLP

20090264369 - Methods for reducing cd36 expression: The invention provides a method for reducing CD36 expression in a cell. The method comprises contacting the cell with an effective amount of an aromatic-cationic peptide having at least one net positive charge; a minimum of four amino acids; a maximum of about twenty amino acids; a relationship between the... Agent: Foley & Lardner LLP

20090264370 - Polypeptides homologous to vegf and bmp1: The present invention involves the identification and preparation of vascular endothelial growth factor-E (VEGF-E). VEGF-E is a novel polypeptide related to vascular endothelial growth factor (VEGF) and bone morphogenetic protein 1. VEGF-E has homology to VEGF including conservation of the amino acids required for activity of VEGF. VEGF-E can be... Agent: Genentech, Inc.

20090264371 - Antiproliferative peptides and antibodies for their detection: The present invention relates to developmental peptides and peptidomimetics thereof, which may be used therapeutically to inhibit abnormal cell proliferation of damaged cells, including cancer cells or virally infected cells. In one embodiment, a seven to eleven amino acid developmental peptide and methods of using the same is provided.... Agent: Pepper Hamilton LLP

20090264372 - Utilization of peptides as active ingredients for slimming: A method of using proteins of the SIRT family or of polypeptide or peptide fragments of SIRT proteins as an active ingredient for slimming, alone or in combination with at least one other active agent, in a cosmetic composition or for the preparation of a pharmaceutical and/or dermatological composition. The... Agent: Young & Thompson

20090264373 - Synthetic peptide amides and dimers thereof: Pharmaceutical compositions containing these compounds are useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. Such treatable pain includes visceral pain, neuropathic pain and hyperalgesia. Inflammation associated with conditions such as IBD and IBS, ocular and otic inflammation, other disorders and... Agent: Pillsbury Winthrop Shaw Pittman LLP

20090264375 - Intraocular irrigating solutions and methods for treating corneal edema: One aspect of the present invention relates to methods of treating corneal edema comprising contacting a cornea with an ophthalmic irrigating composition comprising histidine. In certain embodiments, the ophthalmic irrigating compositions contact the corneal endothelium. Another aspect of the present invention relates to ophthalmic irrigating compositions for treating corneal edema... Agent: Alcon

20090264374 - Utilization of anti-neuropathic pain effect of d-allose and d-psicose: [MEANS FOR SOLVING PROBLEMS] Disclosed is a composition for elimination, relief or reduction of neuropathic pain comprising, as an active ingredient, at least one substance selected from the group consisting of D-allose, a derivative of D-allose, D-psicose and a derivative of D-psicose preferably in an amount of 0.01 to 90%... Agent: Westerman, Hattori, Daniels & Adrian, LLP

20090264377 - Anti-neoplastic compositions comprising extracts of black cohosh: A method is provided for treating, preventing or ameliorating neoplasia in a subject. This method includes administering to the subject an amount of actein or an amount of an extract of black cohosh that contains a triterpene glycoside, which amount of the actein or black cohosh is effective to treat,... Agent: Kevin C. Hooper Bryan Cave LLP

20090264376 - Hoodia plant extract with improved flavor: Extracts of Hoodia plant containing steroidal glycosides which have improved flavor, by virtue of reduced levels of discovered negative flavor compounds. Food compositions containing steroidal glycosides with reduced amounts of discovered negative flavor components are also included.... Agent: Unilever Patent Group

20090264378 - Avermectin compounds and treatment of dermatological disorders in humans therewith: Compounds of the avermectin family or derivatives thereof, notably emamectins are formulated into pharmaceutical compositions useful for the treatment of dermatological conditions in humans, in particular rosacea.... Agent: Buchanan, Ingersoll & Rooney PC

20090264379 - Stable aqueous solution of a polyene fungicide: The invention provides an aqueous composition comprising a dissolved polyene fungicide and a solubilizer, wherein at least 100 ppm of polyene fungicide is present as dissolved polyene fungicide. The aqueous compositions of the invention may further comprise a chelating and/or antioxidation agent. The compositions of the invention provide dissolved polyene... Agent: Nixon & Vanderhye, PC

20090264380 - 6,11-bridged biaryl macrolides: which exhibit antibacterial properties. The present invention further relates to pharmaceutical compositions comprising the aforementioned compounds for administration to a subject in need of antibiotic treatment. The invention also relates to methods of treating a bacterial infection in a subject by administering a pharmaceutical composition comprising the compounds of the... Agent: Elmore Patent Law Group, PC

20090264381 - Nucleic acid and corresponding protein entitled 151p3d4 useful in treatment and detection of cancer: A novel gene (designated 151P3D4) and its encoded protein, and variants thereof, are described wherein 151P3D4 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 151P3D4 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 151P3D4 gene... Agent: Agensys C/o Morrison & Foerster LLP

20090264502 - Compositions and their uses directed to hsp27: Disclosed herein are compounds, compositions and methods for modulating the expression of HSP27 in a cell, tissue or animal. Also provided are uses of disclosed compounds and compositions in the manufacture of a medicament for treatment of diseases and disorders.... Agent: Bozicevic, Field & Francis LLP

20090264506 - Delivery of polynucleotide agents to the central nervous system: The present invention provides a method for delivering polynucleotide agents, particularly oligonucleotides, to the CNS of a mammal by way of a neural pathway originating in the nasal cavity or through a neural pathway originating in an extranasal tissue that is innervated by the trigeminal nerve.... Agent: Weaver Austin Villeneuve & Sampson LLP

20090264505 - Methods and compositions for rnai mediated inhibition of gene expression in mammals: Methods and compositions are provided for modulating, e.g., reducing, expression of a target sequence in mammals and mammalian cells. In the subject methods, an effective amount of an RNAi agent, e.g., an interfering ribonucleic acid (such as an siRNA or shRNA) or a transcription template thereof, e.g., a DNA encoding... Agent: King & Spalding LLP

20090264501 - Methods and compositions to inhibit p2x7 receptor expression: Methods and compositions for the downregulation of P2X7 receptor expression or activity are disclosed. Preferred compositions comprise siNA. The methods and compositions are useful in the treatment of diseases characterised by increased 112X7 receptor activity, such as neuronal degeneration, Alzheimer's disease, inflammatory diseases, and some cancers.... Agent: Fish & Richardson PC

20090264504 - Rna interference mediated inhibition of human immunodeficiency virus (hiv) gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating human immunodeficiency virus (HIV) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways of human immunodeficiency virus... Agent: Sirna Therapeutics, Inc.

20090264503 - Short interference ribonucleic acids for treating allergic diseases: Provided herein are compounds, methods and compositions for treating allergic diseases. In particular, an isolated double stranded short interfering ribonucleic acid (siRNA) with a ribonucleotide sequence complementary to at least a portion of a target gene RNA such as an airway inflammation related-gene RNA, thereby resulting in the cleavage of... Agent: Chih Feng Yeh Brian M. Mcinnis

20090264509 - Adenoviral vector-based foot-and-mouth disease vaccine: The invention is directed to an adenoviral vector comprising at least one nucleic acid sequence encoding an aphthovirus antigen and/or a cytokine operably linked to a promoter. The adenoviral vector is replication-deficient and requires at most complementation of both the E1 region and the E4 region of the adenoviral genome... Agent: Leydig Voit & Mayer, Ltd

20090264511 - Compositions and methods for inhibiting expression of factor vii gene: The invention relates to a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of the Factor VII gene.... Agent: Lando & Anastasi, LLP

20090264510 - Double helical oligonucleotides interfering with mrna used as effective anticancer agents: The present invention relates to the application of double-helical oligonucleotides (siRNA) interfering with the mRNA of gene involved in carcinogenesis, particularly the Wnt1, Wnt2 or Her3 genes. Such oligonucleotides may be modified chemically, used in conjunction with viral and non-viral vectors such as lipid complexes. Such oligonucleotides exhibit unusual anti-proliferative... Agent: Paul G. Lunn, Esq.

20090264513 - Expression vector: A conventional shuttle vector constructed by fusing an E. coli-derived plasmid and a transformant-derived plasmid functions in both E. coli and the transformant bacterium, and there exists no expression vector that functions only in a non-E. coli transformant. The present invention provides an plasmid expression vector comprising (1) a plasmid... Agent: Jones Day

20090264508 - Focused libraries, functional profiling, laser selex, and deselex: Focused aptamer libraries are constructed in accordance with a proteome (i.e., complex mixture of native biomolecules). The libraries may be screened to identify one or more candidate aptamers with desired biological activities other than specific binding to a target. Aptamers which are selected or derivatives thereof may be used for... Agent: Nixon & Vanderhye, PC

20090264507 - Method of diagnosing gum disease-wound healing using single nucleotide polymorphism profiles: The present invention provides methods for diagnosing and providing a prognosis for wound healing in a patient by characterizing and analyzing the single nucleotide polymorphism (SNP) of a wound healing associated gene wit3.0. In particular, the invention provides a method of diagnosis and prognosis of oral disease-wound healing, including gingival... Agent: Townsend And Townsend And Crew, LLP

20090264512 - Nucleic acid ligands capable of binding to internalin b or internalin a: The present disclosure relates to the isolation of a novel reagent selected for its binding characteristics to the proteins internalin B or internalin A. InIB is a surface-localized protein of Listeria monocytogenes that binds and activates the receptor tyrosine kinase Met. InIB promotes invasion of a number of cells including... Agent: Knobbe Martens Olson & Bear LLP

20090264515 - Polynucleotide therapy: This invention provides a method of treating or preventing a disease in an animal associated with one or more self-protein(s), -polypeptide(s), or -peptide(s) that is present or involved in a non-physiologic process in the animal comprising administering to the animal a self-vector comprising a polynucleotide encoding the self-protein(s), -polypeptide(s) or... Agent: Townsend And Townsend And Crew, LLP

20090264514 - Sphingomyelin synthase 2 (sms2) deficiency attenuates nfkb activation, a potential anti-atherogenic property: The present invention is directed to a method of screening for NFκB inhibiting agents, the method including the steps of administering a biologically effective amount of a candidate SMS2 inhibitor to at least one cell; and determining whether the candidate SMS2 inhibitor inhibits NFκB.... Agent: Hoffmann & Baron, LLP

20090264382 - Methods for treating hematopoietic neoplasms: This invention relates to methods for treating, preventing and/or managing hematopoietic neoplasm in a subject by administering to the subject combretastatin A-4 phosphate, or a pharmaceutically acceptable salt thereof. The method may further comprise co-administering a chemotherapeutic agent.... Agent: Oxigene, Inc. C/o Law Offices Of Karen E. Flick

20090264383 - Inhibitor of adenylyl cyclase for treating a disorder of the circadian rhythm: The invention relates to use of a composition comprising an inhibitor of adenylyl cyclase in the elongation of circadian rhythm, a method of extending the period of circadian rhythm in a subject, said method comprising administering to said subject an inhibitor of adenylyl cyclase, and to adenylyl cyclase inhibitor for... Agent: Mcandrews Held & Malloy, Ltd

20090264384 - Indole, benzimidazole, and benzolactam boronic acid compounds, analogs thereof and methods of use thereof: Benzimidazole, indole and benzolactam boronic acid compounds, analogs thereof, and pharmaceutical formulations are described, along with methods of use thereof for inhibiting inflammatory cytokines such as tumor necrosis factor alpha (TNF-α) in a subject in need thereof.... Agent: Alston & Bird LLP

20090264385 - Stabilized compositions containing alkaline labile drugs: A stabilized bioadhesive composition containing an alkaline labile drug and a method for its preparation are provided. In one aspect, the composition is a hot-melt extruded (HME) composition comprising a preformed excipient mixture comprising an acidic component and an alkaline thermoplastic matrix-forming material, e.g. polymer. The excipient mixture is formed... Agent: Ratnerprestia

20090264386 - Mesalamine suppository: The present invention relates to a mesalamine rectal suppository designed to provide improved comfort of use. One embodiment of the invention is a mesalamine rectal suppository comprising mesalamine and one or more pharmaceutically acceptable excipients, wherein the drug load of the suppository ranges from 35% to 50%. Another embodiment of... Agent: Darby & Darby P.C.

20090264387 - Estra-1,3,5(10)-triene derivatives for contraception: e

20090264388 - Compounds and methods of treating disorders associated with activation of metachromatic cells: The present invention relates to neurokinin-1 (NK-1) receptor antagonists in combination with an inhibitor of metachromatic cell activation, such as an anti-inflammatory agent, an immunosuppressor, or a kinase inhibitor, and use of such combinations in the treatment of disorders associated with activation of metachromatic cells. Disorders associated with the activation... Agent: Clark & Elbing LLP

20090264389 - Method of preparing dry powder inhalation compositions: The invention provides a method of preparing a dry powder inhalation composition comprising a pharmaceutically acceptable particulate carrier, a first particulate inhalant medicament and a second particulate inhalant medicament. Also provided are dry powder compositions and methods of using them with a dry powder inhalation device.... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20090264390 - Topical personal care compositions and methods of use: Topical personal care compositions comprising an anti-inflammatory agent, a surfactant, a bodifier/humectant, and water and methods of use are disclosed.... Agent: Fox Rothschild LLP Princeton Pike Corporate Center

20090264391 - Fluocinolone implants to protect against undesirable bone and cartilage destruction: Effective treatments for protecting against undesirable macrophage activity are provided. Through the administration of an effective amount of fluocinolone at or near a target site, one can reduce or prevent macrophage activity. In various embodiments, fluocinolone formulations may be provided within biodegradable polymers to prevent transplant rejection for at least... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20090264393 - Nitrooxy derivatives of glucocorticoids: The invention relates to new steroids nitrooxyderivatives, to topical pharmaceutical formulations thereof, and their use for treating skin or mucosal membrane diseases or disorders. These new steroids nitrooxyderivatives have an improved pharmacological activity and enhanced local tolerability.... Agent: Arent Fox LLP

20090264394 - Nitrooxy derivatives of glucocorticoids: The invention relates to new steroids nitrooxyderivatives, to topical pharmaceutical formulations thereof, and their use for treating skin or mucosal membrane diseases or disorders. These new steroids nitrooxyderivatives have an improved pharmacological activity and enhanced local tolerability.... Agent: Arent Fox LLP

20090264392 - Treating eosinophilic esophagitis: This document provides methods and compositions suitable for treating eosinophilic esophogitis. For example, this document provides methods that involve administering a steroid and mucoadherent to a mammal (e.g., a human). Kits comprising compositions containing a steroid in combination with a mucoadherent also are provided.... Agent: Wilson, Sonsini, Goodrich & Rosati

20090264395 - Progesterone for the treatment or prevention of spontaneous preterm birth: A method for treating or preventing spontaneous preterm birth in pregnant women and improving neonatal morbidity and mortality. The method includes administering to a pregnant woman in need thereof an effective amount of progesterone sufficient to prolong gestation by minimizing the shortening or effacing of her cervix. Treatment and prophylaxis... Agent: Winston & Strawn LLP Patent Department

20090264396 - 17alpha, 21-dihydroxypregnene esters as antiandrogenic agents: 17α,21-Dihydroxypregna-4,9-diene-3,20-dione and 17α,21-dihydroxypregna-4-ene-3,20-dione 17 and/or 21 esters of having remarkable antiandrogenic activity, and the processes for the preparation thereof.... Agent: Nixon & Vanderhye, PC

20090264397 - Highly fluorinated oils and surfactants and methods of making and using same: In one aspect, the compounds exhibit maximum symmetric branching. Also disclosed are bilayers, micelles, coatings, and nanoparticles comprising the disclosed compounds. Also disclosed are processes for the preparation of the disclosed compounds and methods of using the disclosed compounds. Also disclosed are highly fluorinated dendrons and methods for making same.... Agent: Ballard Spahr Andrews & Ingersoll, LLP

20090264398 - Method for inducing tumor apoptosis by increasing nitric oxide levels: According to the present invention inhibitors of the nitric oxide dioxygenase or arginase can be used for the manufacture of a medicament for the treatment of cancer. The present invention further provides a method for identifying compounds which can be used for the treatment of cancer, wherein the method allows... Agent: Smith Patent Consulting, LLC

20090264399 - Heterocyclic janus kinase 3 inhibitors: The invention relates to compound of the formula (I) or its salt, wherein —R1, —R2, —R3, —R4, —R5, -M-, —X— and —Y═ are as defined in the description, their use of as, medicament, the process for their preparation and use for the treatment of JAK3 mediated diseases.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090264402 - Novel diphenylazetidinone substituted by piperazine-1-sulfonic acid and having improved pharmacological properties: e

20090264403 - Novel azacyclyl-substituted aryldihydroisoquinolinones, process for their preparation and their use as medicaments: The invention relates to azacyclyl-substituted aryldihydroisoquinolinones and their derivatives, and their physiologically tolerated salts and physiologically functional derivatives, their preparation, medicaments comprising at least one azacyclyl-substituted aryldihydroisoquinolinone of the invention or its derivative, and the use of the azacyclyl-substituted aryidihydroisoquinolinones of the invention and their derivatives as MCH antagonists.... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20090264405 - Cetp inhibitors: Compounds of Formula I, including pharmaceutically acceptable salts of the compounds, are CETP inhibitors, and are useful for raising HDL-cholesterol, reducing LDL-cholesterol, and for treating or preventing atherosclerosis.... Agent: Merck And Co., Inc

20090264404 - Derivatives of 4-piperazin-1-yl-4-benzo[b]thiophene suitable for the treatment of cns disorders: A heterocyclic compound or a salt thereof represented by the formula (1): where R2 represents a hydrogen atom or a lower alkyl group; A represents a lower alkylene group or lower alkenylene group; and R1 represents an aromatic group or a heterocyclic group. The compound of the present invention has... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20090264401 - Substituted pyrimidin-5-carboxamides 281: h

20090264400 - Substituted sulfonamide compounds:

20090264406 - 3-methyl-imidazo[1,2-b]pyridazine derivatives: wherein the substituents are as defined in the specification, the application of a compound of formula (I) in a process for the treatment of the human or animal body, in particular with regard to C-Met tyrosine kinase mediated disease; the use of a compound of formula (I) for manufacturing a... Agent: Novartis Institutes For Biomedical Research, Inc.

20090264407 - Substituted sulfonamide compounds: e

20090264408 - Extended release dosage forms of quetiapine: The present invention relates to an extended release dosage form of quetiapine wherein the dosage form comprises quetiapine and rate-controlling polymer selected from polyethylene oxide, sodium alginate and natural gum and combinations thereof. The dosage form may additionally comprise at least one water-insoluble polymer.... Agent: Ranbaxy Inc. Intellectual Property Dept.

20090264409 - Bicyclic heterocyclic p-38 kinase inhibitors: Provided are bicyclic heterocycle-based p38 kinase, including p38α and p38β kinase, inhibitors. Pharmaceutical compositions containing the compounds are also provided. Methods of use of the compounds and compositions are also provided, including methods of treatment, prevention, or amelioration of one or more symptoms of p38 kinase mediated diseases and disorders,... Agent: Novartis Institutes For Biomedical Research, Inc.

20090264410 - Therapeutic compounds and uses thereof: o

20090264411 - Fused thiophene derivatives as mek inhibitors: A series of 4,5,6,7-tetrahydrothieno[2,3-c]azepin-8-one derivatives, and analogues thereof, which are substituted in the 2-position by a substituted anilino moiety, being selective inhibitors of human MEK (MAPKK) enzymes, are accordingly of benefit in medicine, for example in the treatment of inflammatory, autoimmune, cardiovascular, proliferative (including oncological) and nociceptive conditions.... Agent: Feldmangale, P.A.

20090264412 - Combination therapy using an 11beta-hydroxysteroid dehydrogenase type 1 inhibitor and a glucocorticoid receptor agonist to minimize the side effects associated with glucocorticoid receptor agonist therapy: Combination therapy comprising the administration of an 11β-hydroxysteroid dehydrogenase type 1 inhibitor and a glucocorticoid receptor agonist for treating some forms of cancer, diseases and disorders having inflammation as a component, and to minimize the side effects associated with glucorticoid receptor agonist therapy.... Agent: High Point Pharmaceuticals, Inc.

20090264413 - Compositions and methods for treating female sexual dysfunction: This invention relates to methods, pharmaceutical compositions and kits useful in treating female sexual dysfunction and the use of an estrogen agonist/antagonist for the manufacture of a medicament for the treatment of female sexual dysfunction. The compositions are comprised of an estrogen agonist/antagonist as a first active ingredient and a... Agent: Pfizer Inc. Patent Department

20090264414 - Amide derivatives and pharmaceutical use thereof: The use of substituted amides for modulating the activity of 11β-hydroxysteroid dehydrogenase type 1 (11βHSD1) and the use of these compounds as pharmaceutical compositions, are described. Also a novel class of substituted amides, their use in therapy, pharmaceutical compositions comprising the compounds, as well as their use in the manufacture... Agent: High Point Pharmaceuticals, Inc.

20090264418 - 5-amido-indole-2-carboxamide derivatives: e

20090264416 - N-benzyl,n'-arylcarbonylpiperazine derivatives:

20090264417 - Sulfonyl-substituted bicyclic compounds as modulators of ppar: Compounds as modulators of peroxisome proliferator activated receptors, pharmaceutical compositions comprising the same, and methods of treating disease using the same are disclosed.... Agent: Global Patent Group - Kal Attn: Ms Lavern Hall

20090264415 - Pyrido(3,2-d)pyrimidines and pharmaceutical compositions useful for medical treatment: This invention relates to substituted pyrido(3,2-d)pyrimidine derivatives, their pharmaceutically acceptable salts, N-oxides, solvates, pro-drugs and enantiomers, possessing unexpectedly desirable pharmaceutical properties, in particular which are highly active immunosuppressive agents, and as such are useful in the treatment in transplant rejection and/or in the treatment of certain inflammatory diseases. These derivatives... Agent: Clark & Elbing LLP

20090264419 - Cyclic malonamides as inhibitors of abeta protein production: to their pharmaceutical compositions and to their methods of use. These novel compounds inhibit the processing of amyloid precursor protein and, more specifically, inhibit the production of Aβ-peptide, thereby acting to prevent the formation of neurological deposits of amyloid protein. More particularly, the present invention relates to the treatment of... Agent: Kelley Drye & Warren LLP

20090264420 - Organic compounds: said compound is inhibitor of aldosterone synthase, and/or 11 beta-hydroxylase (CYPL11B1), and/or aromatase, and thus can be employed for the treatment of a disorder or disease mediated by aldosterone synthase, aromatase, or CYPL11B1. Accordingly, the compound of formula I can be used in treatment of hypokalemia, hypertension, congestive heart failure,... Agent: Novartis Institutes For Biomedical Research, Inc.

20090264421 - Methods and compositions for treating cancer: Compositions and methods for treating cancer, including hematologic cancers such as multiple myeloma, are disclosed. In some embodiments, chaetocin, chaetomin, or gliotoxin can be used to treat or ameliorate one or more symptoms or disorders associated with multiple myeloma.... Agent: Fish & Richardson P.C.

20090264422 - Method of treating disease states using substituted pyrazole compounds: Disclosed are protein kinase inhibitors, compositions comprising such inhibitors, and methods of use thereof. More particularly, disclosed are inhibitors of Aurora A (Aurora-2) protein kinase. Also disclosed are methods of treating diseases associated with protein kinases, especially diseases associated with Aurora-2, such as cancer.... Agent: King & Spalding

20090264423 - Serine-threonine protein kinase and parp modulators: The invention relates in part to molecules having certain biological activities that include, but are not limited to, inhibiting cell proliferation, modulating protein kinase activity and modulating polymerase activity. Molecules of the invention can modulate casein kinase (CK) activity and/or poly(ADP-ribose)polymerase (PARP) activity. The invention also relates in part to... Agent: Morrison & Foerster LLP

20090264424 - Vanilloid receptor ligands and their use in treatments: and compositions containing them, for the treatment of acute, inflammatory and neuropathic pain, dental pain, general headache, migraine, cluster headache, mixed-vascular and non-vascular syndromes, tension headache, general inflammation, arthritis, rheumatic diseases, osteoarthritis, inflammatory bowel disorders, inflammatory eye disorders, inflammatory or unstable bladder disorders, psoriasis, skin complaints with inflammatory components, chronic... Agent: Amgen Inc.

20090264427 - 3-cyanoquinolines, methods for preparation and use as insulin-like growth factor inhibitors: Imidazole-substituted 4-anilino-3-cyanoquinolines are described, which selectively inhibit IFGR kinase activity and are useful for treating disorders associated with IGFR kinases.... Agent: Wyeth Patent Law Group

20090264426 - Bicyclic aromatic substituted pyridone derivative: Wherein R1 and R2 independently represent a hydrogen atom, a lower alkyl group or the like; X1, X2 and X3 independently represent a methine group or a nitrogen atom; Y1 and Y3 independently represent a single bond, —O— or the like; Y2 represents a lower alkylene group or the like;... Agent: Merck And Co., Inc

20090264425 - Chemical compounds: e

20090264428 - Renin inhibitors: Described are compounds of the formula (I) which are orally active and bind to aspartic proteases to inhibit their activity. They are useful in the treatment or amelioration of diseases associated with aspartic protease activity. Also described are methods of use of the compounds described herein in ameliorating or treating... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20090264429 - Aryl - hydroxyethylamino - pyrimidines and triazines as modulators of fatty acid amide hydrolase: Certain aryl-hydroxyethylamino-pyrimidine and triazine compounds are described, which are useful as FAAH inhibitors. Such compounds may be used in pharmaceutical compositions and methods for the treatment of disease states, disorders, and conditions mediated by fatty acid amide hydrolase (FAAH) activity, such as anxiety, pain, inflammation, sleep disorders, eating disorders, energy... Agent: Philip S. Johnson Johnson & Johnson

20090264430 - Salt of morpholine compound: (2S)-[4-(Carboxymethyl)thiazol-2-ylthio]-N-{[4-(3,4-dichlorobenzyl)morpholin-2-yl]methyl}acetamide hydrobromide and a crystal thereof, which resist easy weight change caused by vapor sorption as compared to a free form, and are superior as drug substances of pharmaceutical products, and a production intermediate therefor are provided.... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090264431 - Novel cathepsin c inhibitors and their use: S

20090264432 - Piperidine and morpholine renin inhibitors: Described are compounds which are orally active and bind to renin to inhibit its activity. They are useful in the treatment or amelioration of diseases associated with renin activity. Also described are methods of use of these compounds for treating or ameliorating a renin mediated disorder in a subject.... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20090264433 - Compounds, compositions and methods comprising triazine derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP

20090264434 - Pyridazinone glucokinase activators: e

20090264436 - Cb-1 receptor modulator formulations: Described herein are solid, stable pharmaceutical formulations of cannabinoid receptor inverse agonists, such as taranabant, and processes of making such formulations. Additionally, described herein are solid stable pharmaceutical formulations of cannabiniod inverse agonists, such as taranabant, and an additional therapeutic agent, as well as processes for making such pharmaceutical formulations.... Agent: Merck And Co., Inc

20090264435 - Novel aryl- and heteroarylpiperazines: Novel aryl- and heteroarylpiperazines, use of these compounds as pharmaceutical compositions, pharmaceutical compositions comprising the compounds, and a method of treatment employing these compounds and compositions. The compounds show a high and selective binding affinity to the histamine H3 receptor indicating histamine H3 receptor antagonistic, inverse agonistic or agonistic activity.... Agent: Novo Nordisk, Inc. Intellectual Property Department

20090264437 - 4-piperazinyl-pyrimidine compounds suitable for treating disorders that respond to modulation of the dopamine d3 receptor: v

20090264439 - Combination of a) n--4-(3-pyridyl)-2-pyrimidine-amine and b) a histone deacetylase inhibitor for the treatment of leukemia: The invention pertains to a combination of a histone deacetylase inhibitor and N-{5-[4-(4-methyl-piperazino-methyl)-benzoylamido]-2-methylphenyl}-4-(3-pyridyl)-2-pyrimidine or a pharmaceutically acceptable salt thereof for simultaneous, separate or sequential use for the treatment of leukemia and especially N-{5-[4-(4-methyl-piperazino-methyl)-benzoylamido]-2-methylphenyl}-4-(3-pyridyl)-2-pyrimidine-resistant leukemia.... Agent: Dilworth & Barrese, LLP

20090264438 - Polymorphic forms of imatinib mesylate and processes for preparation of novel crystalline forms as well as amorphous and form alpha: Solvates and crystalline forms of imatinib mesylate are described. Further, methods for preparing such solvates and crystalline forms of imatinib mesylate are described.... Agent: Kenyon & Kenyon LLP

20090264440 - Inhibitors of protein tyrosine kinase activity: This invention relates to compounds that inhibit protein tyrosine kinase activity. In particular the invention relates to compounds that inhibit the protein tyrosine kinase activity of growth factor receptors, resulting in the inhibition of receptor signaling, for example, the inhibition of VEGF receptor signaling and HGF receptor signaling. More particularly,... Agent: Keown & Zucchero, LLP

20090264441 - Compounds, compositions and methods comprising oxadiazole derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP

20090264442 - Pyrazole derivatives as sigma receptor inhibitors: e

20090264443 - Treatment of organophosphate exposure with tetrahydroindolone arylpiperazine compounds: A method of treating exposure to organophosphate agents through the use of compounds comprising tetrahydroindolone and arylpiperazine moieties.... Agent: Sheldon Mak Rose & Anderson PC

20090264444 - Organic compounds: The present invention provides heterocyclic derivatives that modulate the activity of stearoyl-CoA desaturase. Methods of using such derivatives to modulate the activity of stearoyl-CoA desaturase and pharmaceutical compositions comprising such derivatives are also encompassed.... Agent: Novartis Institutes For Biomedical Research, Inc.

20090264445 - Pyrrolidinone glucokinase activators: e

20090264446 - Condensed pyridines as kinase inhibitors: New compounds of formula (I), wherein the meanings for the various substituents are as disclosed in the description. These compounds are useful as p38 kinase inhibitors.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20090264447 - Pyrimidine compounds for combating pathogenic fungi and cancer: w

20090264448 - Pyrazolo[1,5-a]pyrimidines, processes, uses and compositions: The invention provides novel pyrazolo[1,5-a]pyrimidines which are useful for treating or preventing anxiety, epilepsy and sleep disorders including insomnia, and for inducing sedation-hypnosis, anesthesia, sleep and muscle relaxation.... Agent: Birch Stewart Kolasch & Birch

20090264449 - Hair care compositions and methods for increasing hair diameter: Disclosed in a hair care composition comprising: (i) a hair diameter increasing agent comprising a xanthine compound, a vitamin B3 compound, and a panthenol compound; and (ii) an carrier comprising water and monohydric alcohols having 1 to 6 carbons; wherein the monohydric alcohol is present in the composition at a... Agent: The Procter & Gamble Company Global Legal Department - Ip

20090264450 - Limk2 inhibitors, compositions comprising them, and methods of their use: Inhibitors of LIM kinase 2 are disclosed, along with pharmaceutical compositions comprising them and methods of their use. Particular compounds are of the formula:... Agent: Lexicon Pharmaceuticals, Inc.

20090264451 - 6-1h-imidazo-quinazoline and quinolines derivatives, new potent analgesics and anti-inflammatory agents: h

20090264452 - 2-(phenylamino)-pyrimidin-5-amides as cannabinoid 2 receptors modulators for the treatment of immune or inflammatory disorders:

20090264453 - Genetic polymorphisms associated with coronary heart disease, methods of detection and uses thereof: The present invention is based on the discovery of genetic polymorphisms that are associated with coronary heart disease, and in particular MI, and response to drug treatment. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for... Agent: Celera Corporation

20090264454 - Combined hydrocodone and analgesic formulation and method: The present invention is directed to co-administration of hydrocodone and a second analgesic agent for the treatment of pain. A pharmaceutical composition suitable for the co-administration contains a therapeutically effective amount of hydrocodone or a pharmaceutically acceptable salt thereof, and a therapeutically effective amount of at least one second analgesic... Agent: Stetina Brunda Garred & Brucker

20090264455 - Androgen receptor modulator compounds and methods: Provided herein are compounds that bind to androgen receptors and/or modulate activity of androgen receptors, and to methods for making and using such compounds. Also provided are compositions including such compounds and methods for making and using such compositions.... Agent: K&l Gates LLP

20090264456 - Compostions and methods for preventing and/or treating disorders asociated with cephalic pain: Compounds, e.g., of formula (I) and (Ia), pharmaceutical compositions comprising the compounds and methods of using the compounds and pharmaceutical compositions for treating pain disorders, e.g., disorders associated with cephalic pain, are provided.... Agent: Lando & Anastasi, LLP

20090264457 - Combination of at least two 5ht6-ligands: The present invention relates to a Combination of at least two 5HT6-Ligands of which one is a partial or agonist while the other is a full antagonist or an inverse agonist, a medicament comprising this comination, the use of the combiantion in the manufacture of a medicament for the treatment... Agent: Cooper & Dunham LLP

20090264458 - 5-ht7 receptor antagonists: The invention relates to compounds having pharmacological activity towards the 5-receptor, and more particularly to some 2,2a,4,5-tetrahydro-1H-3-aza-acenaphthylen substituted sulfonamide compounds, to processes of preparation of such compounds, to pharmaceutical compositions comprising them, and to their use for the treatment and or prophylaxis of a disease in which 5-HT is involved,... Agent: Locke Lord Bissell & Liddell LLP Attn:IPDocketing

20090264459 - Organic compounds: Compounds of formula (I) in free or a pharmaceutically acceptable salt form, wherein X1, L and Q have the meanings as indicated in the specification, are useful for treating obstructive or inflammatory airways diseases. Pharmaceutical compositions that contain the compounds and processes for preparing the compounds are also described.... Agent: Novartis Corporate Intellectual Property

20090264460 - Clopidogrel pharmaceutical formulations: Formulations of clopidogrel or pharmaceutically acceptable salts thereof, processes of preparation of such formulations, and methods of using them.... Agent: Dr. Reddy''s Laboratories, Inc.

20090264461 - Polymorph of (r)-3- (2-hydroxy-2, 2-diphenyl -acetoxy) -1- (isoxazol-s-ylcarbamoyl-methyl)-1-azoni a-bicyclo-[2.2.2] octane bromide: A novel polymorphic crystal form of (R)-3-(2-hydroxy-2,2-diphenyl-acetoxy)-1-(isoxazol-3-ylcarbamoyl-methyl)-1-azonia-bicyclo-[2.2.2]octane bromide, designated crystal form Talpha. Methods for preparing same and the use of the crystal form as the active ingredient of medicaments for the treatment of inflammatory or obstructive airways diseases are also described.... Agent: Novartis Corporate Intellectual Property

20090264462 - Kappa opioid receptor ligands: Kappa opioid receptor antagonists are provided that yield significant improvements in functional binding assays to kappa opioid receptors, and the use of these antagonists in treatment of disease states that are ameliorated by binding of the kappa opioid receptor such as heroin or cocaine addictions.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090264463 - Inhibitors of protein phosphatase-1 and uses thereof: Inhibitors of Protein Phosphatase-1 have been shown to slow replication of HIV-1. Inhibitors of PP 1 and their use for treatment or prevention of HIV-1 infections are disclosed.... Agent: Fitch Even Tabin & Flannery

20090264464 - Antitumor agent for undifferentiated gastric cancer: The therapeutic agent comprises a substance having the activity of inhibiting kinase activity of fibroblast growth factor receptor 2 (“FGFR2”). The therapeutic agent can be used for treating undifferentiated gastric cancer, and can also be used to treat organisms comprising a cell overexpressing FGFR2 or a cell expressing mutant FGFR2,... Agent: Darby & Darby P.C.

20090264465 - Crystalline forms of 4- [2- (4-methylphenylsulfanyl) -phenyl] piperidine with combined serotonin and norepinephrine reuptake inhibition for the treatment of neuropathic pain: Crystalline forms of 4-[2-(4-methylphenylsulfanyl)-phenyl]piperidine and salts thereof are provided e.g. for the treatment of neuropathic pain.... Agent: Darby & Darby P.C.

20090264466 - Certain chemical entities, compositions and methods: Chemical entities that modulate smooth muscle myosin and/or non-muscle myosin, pharmaceutical compositions and methods of treatment of diseases and conditions associated with smooth muscle myosin and/or non-muscle myosin are described.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20090264467 - Agents and crystals for improving excretory potency of urinary bladder: Agents for improving potency of the urinary bladder which comprise an amine compound of non-carbamate-type having an acetylcholinesterase-inhibiting action. Particularly, crystals of a tricyclic, condensed, heterocyclic derivative are provided, which possess an excellent action to inhibit acetylcholinesterase and an action to improve the excretory potency of the urinary bladder. As... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090264468 - Methods for treating a disease in which rho kinase is involved: , wherein the ring X is a benzene ring or a pyridine ring; R1 and R2 are hydrogen or alkyl or together form a cycloalkene ring; R3 is hydrogen, substituted alkyl, unsubstituted alkenyl, carboxyl or an ester or an amide thereof, amino or a cyano; R4 is hydrogen, hydroxyl, substituted... Agent: Frishauf, Holtz, Goodman & Chick, PC

20090264470 - Cb1 antagonists and inverse agonists: The present invention relates to methods of treating obesity, anorexia nervosa, or bulimia nervosa comprising administering a compound of the invention. The present invention further relates to the treatment of metabolic syndrome comprising administering a compound of the invention.... Agent: Ropes & Gray LLP

20090264471 - Compounds, compositions and methods comprising triazole derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP

20090264469 - Novel dicarboxylic acid derivatives: The present patent application concerns new compounds of formula (I): displaying agonistic activity at sphingosine-1-phosphate (S1P) receptors, their process of preparation and their use as immunosuppressive agents.... Agent: Volpe And Koenig, P.C.

20090264472 - Methods and compositions for treating post-operative pain comprising a local anesthetic: The present invention is directed to an implantable drug depot useful for reducing, preventing or treating post-operative pain in a patient in need of such treatment, the implantable drug depot comprising a polymer and a therapeutically effective amount of a local anesthetic or pharmaceutically acceptable salt thereof, wherein the drug... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20090264473 - Novel crystalline forms of antidiabetic compounds: A novel crystalline anhydrate of the free acid and a crystalline anhydrous besylate salt of a selective PPAR gamma partial agonist which has a fused bicyclic aromatic group attached to an oxypropanoic acid moiety are stable and non-hygroscopic. The compounds are suitable for preparing pharmaceutical formulations for the treatment of... Agent: Merck And Co., Inc

20090264474 - Sulfonamides as trpm8 modulators: n

20090264475 - Methods and compositions for altering dietary behavior: The present invention concerns exploiting a characteristically negative behavior, such as habitual behavior or addiction, for example, for a beneficial purpose. In particular aspects, an individual desires eating healthy comestibles that comprises a positively-reinforcing compound, thereby consuming greater quantities of one or more healthy comestibles. In particular aspects, an obese... Agent: Fulbright & Jaworski, LLP

20090264477 - Beta adrenergic receptor agonists for treatment of pain and/or inflammation: Effective treatments of pain and/or inflammation are provided. Through the administration of an effective amount of at least one beta adrenergic agonist at or near a target site, one can reduce, prevent or treat pain and/or inflammation.... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20090264476 - Cb-1 receptor modulator formulations: Described herein are solid, stable pharmaceutical formulations of cannabinoid receptor inverse agonists, such as taranabant, and processes of making such formulations. Additionally, described herein are solid stable pharmaceutical formulations of cannabinoid inverse agonists, such as taranabant, and an additional therapeutic agent, as well as processes for making such pharmaceutical formulations.... Agent: Merck And Co., Inc

20090264478 - Sulfasalazine formulations in a biodegradable polymer carrier: Effective treatments of acute pain and/or inflammation for extended periods of time are provided. Through the administration of an effective amount of sulfasalazine at or near a target site, one can relieve pain caused by diverse sources, including but not limited to spinal disc herniation (i.e. sciatica), spondilothesis, stenosis, discogenic... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20090264479 - Papain family cysteine protease inhibitors for the treatment of parasitic diseases: Several parasites responsible for mammalian diseases are dependent on cysteine protease for various life-cycle functions. Inhibition of these proteases can be useful in the treatment of these parasitic diseases, including toxoplasmosis, malaria, African trypanosomiasis, Chagas disease, leishmaniasis or schistosomiasis.... Agent: Merck And Co., Inc

20090264480 - Trpa1 antagonists: v

20090264482 - Chemical compounds: This invention relates to non-steroidal compounds that are modulators of androgen receptor, and also to the methods for the making and use of such compounds.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B482

20090264481 - Compounds, compositions and methods comprising oxadiazole derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP

20090264483 - Methods of using ppar-gamma agonists and caspase-dependent chemotherapeutic agents for the treatment of cancer: This invention relates to compositions and methods utilizing a caspase-dependent chemotherapeutic drug and a PPARy-agonist, such as VP-16 or Taxol as the chemotherapeutic drug and troglitazone or pioglitazone as the PPARy agonist, for the treatment of cancer, including glioblastoma multiforme. The present invention demonstrates that PPAR agonists work with caspase-dependent... Agent: Davis Wright Tremaine LLP/los Angeles

20090264484 - Methods and medicaments for administration of ibuprofen: A method for administration of ibuprofen to a subject in need of ibuprofen treatment is provided, in which an oral dosage form comprising a therapeutically effective amount of ibuprofen and a therapeutically effective amount of famotidine is administered three times per day.... Agent: Townsend And Townsend And Crew, LLP

20090264486 - Compounds, compositions and methods comprising isoxazole derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP

20090264485 - Pyrazole derivatives, their manufacture and their use as pharmaceutical agents: e

20090264487 - Hemiasterlin analogs: This invention provides analogs of hemiasterlin, methods of synthesis of the analogs and use of the analogs as a cytotoxic anti-mitotic agents.... Agent: Arent Fox LLP

20090264488 - Novel solid forms of bendamustine hydrochloride: Novel solid forms of bendamustine hydrochloride are described, as well as methods of their preparation and use.... Agent: Ross J. Oehler Cephalon, Inc.

20090264490 - Clonidine formulations in a biodegradable polymer carrier: Effective treatments of pain for extended periods of time are provided. Through the administration of an effective amount of clonidine at or near a target site, one can relieve pain caused by diverse sources, including but not limited to spinal disc herniation (i.e. sciatica), spondilothesis, stenosis, discogenic back pain and... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20090264489 - Method for treating acute pain with a formulated drug depot in combination with a liquid formulation: Effective methods for treating pain are provided. Through the injection of liquid formulation comprising an active ingredient followed by the administration of drug depot comprising an active ingredient at or near a target site, one can effectively treat pain. This methodology is particularly effective to treat acute radicular pain.... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20090264491 - Methods and compositions for treating post-operative pain comprising clonidine: The present invention is directed to an implantable drug depot useful for reducing, preventing or treating post-operative pain in a patient in need of such treatment, the implantable drug depot comprising a therapeutically effective amount of clonidine or pharmaceutically acceptable salt thereof and a polymer; wherein the depot is implantable... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20090264492 - Pharmaceutical composition for the treatment of a fungal skin disorder and a method for the preparation thereof: The present invention relates to a pharmaceutical composition for photodynamic treatment of a fungal skin disorder, said pharmaceutical composition comprising a photosensitizer and an enhancer, wherein the photosensitizer is a cationic photosensitizer and the enhancer is chosen from the group of i) an acid, and ii) a metal chelating agent.... Agent: Darby & Darby P.C.

20090264493 - Process for producing aqueous solution of doripenem: e

20090264494 - Use of neuroprotective 3-substituted indolone compositions: The present invention include providing a therapeutically effective amount of a 3-substituted indolin-2-one compositions to protect against neurodegeneration including diseases such as Alzheimer's disease, Parkinson's disease, or Huntington's disease, and conditions such as ischemic stroke... Agent: Chalker Flores, LLP

20090264495 - Oral sustained-release pharmaceutical composition of indapamide, production and use thereof: An oral sustained-release pharmaceutical composition of indapamide and a process for producing the foregoing pharmaceutical composition are provided. The pharmaceutical composition comprises indapamide in an amount between 0.2% and 4% (w/w) of the composition, a hydrophilic polymer in an amount between 10 % and 30% (w/w) of the composition, a... Agent: Patenttm.us

20090264496 - Compounds, compositions and methods for making the same: The present invention provides compounds and/or compositions that modulate PP2A methylation and/or activity and methods for preparing the same, which are useful for modulating the demethylation of PP2A, modulating the methylation of PP2A and/or modulating the activity of PP2A.... Agent: Choate, Hall & Stewart LLP

20090264497 - Stable pharmaceutical formulation comprising a hmg-coa reductase inhibitor: The present invention relates to a stable solid pharmaceutical formulation for the treatment of hypercholesterolemia and hyperlipidemia. More precisely, the present invention relates to the new stable solid pharmaceutical formulation containing as an active ingredient a HMG-CoA reductase inhibitor, such as atorvastatin, pravastatin, fluvastatin and cerivastatin or pharmaceutically acceptable salts... Agent: Darby & Darby P.C.

20090264498 - Cathepsin c inhibitors: e

20090264499 - Cathepsin c inhibitors:

20090264500 - 3-substituted-1,5-diarly-2-alkyl-pyrroles highly selective and orally effective cox-2 inhibitors: This invention relates to 3-substituted-1,5-diaryl-2-alkyl-pyrroles of Formula I, pharmaceutical compositions containing them, and to their use for the pharmacological treatment of pain and COX-2 over-activation associated disorders. Compounds of this invention are new pyrrole derivatives bearing in position-3 of the pyrrole ring, several variously functionalized, not aliphatic, side chains which... Agent: Sughrue Mion, PLLC

20090264516 - Milbemycin compounds and treatment of dermatological disorders in humans therewith: Compounds of the milbemycin family or derivatives thereof are formulated into pharmaceutical compositions useful for the treatment of dermatological conditions in humans, in particular rosacea.... Agent: Buchanan, Ingersoll & Rooney PC

20090264517 - Milbemycin compounds and treatment of dermatological disorders in humans therewith: Compounds of the milbemycin family or derivatives thereof are formulated into pharmaceutical compositions useful for the treatment of dermatological conditions in humans, in particular rosacea.... Agent: Buchanan, Ingersoll & Rooney PC

20090264519 - Insulin sensitivity improving agent: The present invention relates to an insulin sensitivity-improving agent for obese children, which contains a catechin as an active ingredient. There is provided an insulin sensitivity-improving agent for obese children.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090264518 - Liquid koji and quick-brewed miso-like food: The present invention provides a method for producing a salt-free miso-like food having strong umami and rich flavor with strong taste. As a means to solve the problem, a liquid koji is prepared by culturing an aspergillus in a predetermined amount of lactic acid bacterium culture solution or a supernatant... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090264520 - Lipid-containing compositions and methods of use thereof: Lipid compositions comprising nuts, seeds, oils, legumes, fruits, grains, and dairy useful in specified amounts as dietary supplements and diet plans designed around and including the aforementioned for the prophylaxis and treatment of numerous diseases are disclosed. The compositions include omega-6 and omega-3 fatty acids where the ratio of the... Agent: Greenberg Traurig, LLP (sv)IPDocketing

20090264521 - Percutaneous absorption preparation: Percutaneous absorption preparations which make it possible to absorb compounds having a melatonin receptor agonist activity via a convenient administration system, have favorable blood-drug-concentration-time profile and can exert a therapeutic effect on a disease caused by a decrease in secretion of melatonin at night.... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090264522 - Methods of treating central nervous system disorders with a low dose combination of escitalopram and bupropion: The present invention relates to a method of treating a central nervous system disorder, such as a mood disorder (e.g., major depressive disorder) or an anxiety disorder (e.g., general anxiety disorder, social anxiety disorder, post traumatic stress disorder, and panic disorder) with a low dose combination of escitalopram and bupropion.... Agent: Forest Laboratories, Inc. Attn: Charles S. Ryan

20090264523 - Method for prevention of degradation of thermally unstable medicament: The present invention provides a method for preventing the degradation of a thermally unstable medicament in an eye drop containing the medicament thereby to stabilize the eye drop. By adding an organic amine to an eye drop containing a thermally unstable medicament, the degradation of the medicament in the eye... Agent: Frishauf, Holtz, Goodman & Chick, PC

20090264524 - Agent for recovery from cerebral fatigue: e

20090264525 - Fluorosurfactants: The present invention relates to fatty acid esters of polyols or sulfonated fatty acid esters or sulfonated fatty acid amides containing at least one group Y, where Y stands for CF3—(CH2)a—O—, SF5—, CF3—(CH2)a—S—, CF3CF2S—, [CF3—(CH2)a]2N— or [CF3—(CH2)a]NH—, where a stands for an integer selected from the range from 0 to... Agent: Millen, White, Zelano & Branigan, P.C.

20090264527 - Method for stabilizing retinoic acid, retinoic acid containing composition, and method of using a retinoic acid containing composition: A method for stabilizing retinoic acid is provided. The method includes a step of mixing retinoic acid with a hydrophobic polymer/hydrophilic polymer adduct in the presence of an oxygen containing atmosphere to form a retinoic acid containing composition. The hydrophobic polymer/hydrophilic polymer adduct comprises a poly(vinylpyrrolidone/alkylene) polymer and a polymer... Agent: Merchant & Gould PC

20090264526 - Natural ligand of g protein coupled receptor rcc356 and uses thereof: The invention relates to the identification of isovaleric acid as a natural ligand of the RCC356 G-protein coupled receptor (GPCR). The invention encompasses the use of the interaction of RCC356 polypeptides and isovaleric acid as the basis of screening assays for agents that modulate the activity of the RCC356 receptor.... Agent: Edwards Angell Palmer & Dodge LLP

20090264529 - Activators of peroxisome proliferator-activated receptors: Activators of peroxisome proliferator-activated receptors comprising a polyprenyl compound, preferably (2E,4E,6E,10E)-3,7,11,15-tetramethyl-2,4,6,10,14-hexadecapentaenoic acid, as an active ingredient, and medicaments for preventive and/or therapeutic treatment of hyperlipidemia, non-insulin dependent diabetes mellitus or the like comprising a polyprenyl compound as an active ingredient.... Agent: Greenblum & Bernstein, P.L.C

20090264528 - Serine palmitoylcoa transferase (spt) inhibition by myriocin or genetic deficiency decreases cholesterol absorption: A first aspect of the invention provides a method of screening cholesterol absorption inhibitors, including: administering to a mammal a biologically effective amount of a candidate SPT inhibitor; and determining whether an amount at least one cholesterol absorption indicator protein in the intestine has changed after the administering step.... Agent: Hoffmann & Baron, LLP

20090264530 - Combined nsaid and acetaminophen formulation and method: The present invention is directed to co-administration of a non-steroidal anti-inflammatory agent (NSAID) and acetaminophen for the treatment of pain and inflammation with reduced gastrointestinal irritation. A pharmaceutical composition suitable for the co-administration contains a therapeutically effective amount of at least one non-steroidal anti-inflammatory agent, and a therapeutically effective amount... Agent: Stetina Brunda Garred & Brucker

20090264531 - Sulindac formulations in a biodegradable material: Effective treatments of pain and/or inflammation for extended periods of time are provided. Through the administration of an effective amount of sulindac or a pharmaceutically acceptable salt thereof at or near a target site, one can relieve pain and/or inflammation caused by diverse sources, including but not limited to spinal... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20090264532 - Preservatives based on carboxylic anhydrides: Carboxylic anhydrides are highly suitable as additive for industrial materials, cosmetics, pharmaceutics and foodstuffs, in particular beverages, for protecting them against attack and/or destruction by microorganisms.... Agent: Lanxess Corporation

20090264533 - Methods and compositions for modulating rho-mediated gene transcription: The present invention is directed to methods and compositions methods and compositions for determining and inhibiting gene transcription in mammalian cells. The invention relates to novel inhibitors of rho-mediated gene transcription and to compounds that may be used as therapeutic agents.... Agent: Marshall, Gerstein & Borun LLP

20090264534 - Selective androgen receptor modulators: The present invention relates to androgen receptor targeting agents (ARTA) which demonstrate androgenic and anabolic activity, which are nonsteroidal ligands for the androgen receptor. The selective androgen receptor modulators (SARM) are useful for a) male contraception; b) treatment of a variety of hormone-related conditions, for example conditions associated with Androgen... Agent: Pearl Cohen Zedek Latzer, LLP

20090264535 - Liquid drug formulation: The invention relates to a liquid drug formulation for beta-blockers, which is suitable in particular for oral application in animals.... Agent: Bayer Healthcare LLC

20090264536 - Methods and composition for treating a material: A composition and method are described for sanitizing or otherwise treating a material such as a non-living surface, living tissue, soil or atmosphere which may be contaminated by a toxin, chemical warfare agent, insect, prion, microorganism or other infectious agent. Also described are methods of making the composition.... Agent: Ian C. Mcleod Ian C. Mcleod, P.C.

20090264537 - Biodegradable block copolymeric compositions for drug delivery: An improved drug delivery composition and method of use is disclosed. The composition comprises one or more biodegradable block copolymer drug carriers; and a reconstitution enhancing and enabling agent comprising polyethylene glycol (PEG), a PEG derivative or a mixture of PEG and a PEG derivative. The composition can be administered... Agent: Hunton & Williams LLP Intellectual Property Department

20090264538 - Multifunctional polymeric tissue coatings: Compositions for coating biological and non-biological surfaces, which minimize or prevent cell-cell contact and tissue adhesion, and methods of preparation and use thereof are disclosed. Embodiments include polyethylene glycol/polylysine (PEG/PLL) block or comb-type copolymers with high molecular weight PLL (greater than 1000, more preferably greater than 100,000); PEG/PLL copolymers in... Agent: Pabst Patent Group LLP

20090264539 - Fluoropolymer-based medical implant coating compositions: Polymers of fluorinated monomers and acrylate and alkyl acrylates are disclosed which demonstrate improved performance as coatings for implantable devices. Such coatings may, for example, be used to release a bioactive agent from the medical device. One specific application lies in drug-eluting coatings for stents.... Agent: Fulbright & Jaworski, LLP

20090264540 - Novel derivatives of cyclodextrins, process for their preparation and their use in particular for solubilizing pharmacologically active substances: The invention relates to a compound corresponding to general formula (I) wherein n is a whole number from 1-6, m is a whole number equal to 5, 6 or 7, R1 is an OH group, all R1 s are identical, Z is an NHX group, X is a hydrogen atom,... Agent: Young & Thompson

20090264541 - Cosmetic composition comprising an oil: The present invention relates to a composition for making up or caring for the skin in the form of a water-in-oil emulsion comprising an aqueous phase, at least 5% by weight, relative to the total weight of the composition, of a dispersed solid phase and a liquid fatty phase having... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20090258815 - Antiviral peptide and antiviral agent: Disclosed is an antiviral agent comprising a non-naturally occurring, artificially synthesized peptide as the main ingredient. The antiviral agent comprises an antiviral peptide, wherein the antiviral peptide has at least one unit of an amino acid sequence constituted by at least five contiguous amino acid residues (which is known as... Agent: Turocy & Watson, LLP

20090258814 - Method for treating a synucleinopathy: The present invention relates to methods for restoring fast axonal transport in a cell which expresses a pathological synuclein protein and for treating a synucleinopathy using a Protein Kinase C mu or Src-Family Tyrosine Kinase inhibitor.... Agent: Jane Massey Licata Licata & Tyrrell P.C.

20090258816 - Use of gpcr agonists to delay progression of diabetes: The present invention is directed to the use of G-protein coupled receptor agonists for the treatment of beta-cell degeneration.... Agent: Osi Pharmaceuticals, Inc.

20090258817 - Arylsulfanyl compounds and compositions for delivering active agents: Compounds and compositions for the delivery of active agents are provided. Methods of administration and preparation are also provided.... Agent: Emisphere Technologies, Inc

20090258818 - Compositions for the treatment of diabetes: A supramolecular insulin assembly and supramolecular exendin-4 assembly, which is useful as a protein therapeutic agent for the treatment of metabolic disorders particularly diabetes. The supramolecular assemblies disclosed in the present invention consists of insoluble and aggregated oligomers the protein. The invention also provides pharmaceutical compositions comprising the supramolecular assembly.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20090258820 - Echinocandin/carbohydrate complexes: A complex of an echinocandin compound with a carbohydrate is described having improved thermal stability and water solubility. A process for making the echinocandin/carbohydrate complex is also described as well as the use of the complex in pharmaceutical formulations and treatments of fungal infections.... Agent: Pfizer Inc Mary J Hosley

20090258819 - Reagents and methods for smooth muscle therapies: The present invention provides novel polypeptides comprising heat shock protein 20 (HSP20)-derived polypeptides to treat or inhibit smooth muscle vasospasm, as well to treat and inhibit smooth muscle cell proliferation and migration.... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20090258822 - Diagnosis and treatment of age-related macular degeneration: The invention relates to Factor H gene polymorphisms and haplotypes associated with an elevated or a reduced risk of AMD. The invention provides methods and reagents for diagnosis and treatment of AMD.... Agent: Townsend And Townsend And Crew, LLP

20090258821 - Tissue protective cytokines for the protection, restoration, and enhancement of responsive cells, tissues and organs with an extended therapeutic window: Methods and uses are provided for a pharmaceutical composition with an erythropoietin or a tissue protective cytokine for protecting or restoring function to a responsive cell, tissue, organ or body part function or viability in mammals when administered outside of the therapeutic window of previously approved therapeutics.... Agent: Jones Day

20090258824 - Amyloid beta receptor and uses thereof: The present invention relates to the identification that soluble assemblies of amyloid β function as a NMDA receptor antagonist. The present invention also provides methods and compositions for the detection and treatment of neurodegenerative and cognitive disorders and screening methods to identify agents that modulate the antagonistic effect of soluble... Agent: Mueting, Raasch & Gebhardt, P.A.

20090258823 - Composition and methods for the prevention and treatment of gastrointestinal infections: Methods for the prevention and treatment of gastrointestinal infections are described. Surfactant-associated protein-A (SP-A) or SP-D or an active fragment or derivative thereof is administered to mammals at risk of a gastrointestinal infection. Oral compositions of SP-A and/or SP-D are disclosed. Also disclosed is a method to prevent or treat... Agent: Foley & Lardner LLP

20090258832 - Cytokines and cytokine receptors with reduced immunocencity: The present invention provides methods for the identification of CD4+ T-cell epitopes in the sequences of various proteins, namely, human cytokines and cytokine receptors, as well as the production of peptides which when incorporated into the protein sequence, are no longer capable of initiating the CD4+ T-cell response. In some... Agent: Kamrin T. Macknight Genencor International, Inc.

20090258830 - Diagnostic and therapeutic uses of gelsolin in renal failure: The invention is directed, in part, to the use of gelsolin to diagnose, monitor, and treat subjects with renal failure (e.g., chronic renal failure subjects on dialysis).... Agent: Wolf Greenfield & Sacks, P.C.

20090258833 - Fortified liquid protein compositions and methods of making same: A fortified liquid protein composition and method includes hydrolyzed collagen and a desired abundance of sulfur containing amino acids and optionally taurine.... Agent: Workman Nydegger 1000 Eagle Gate Tower

20090258825 - Hopm1 mediated disease resistance to pseudomonas syringae in arabidopsis: The present invention relates to compositions and methods for enhancing plant defenses against pathogens. More particularly, the invention relates to enhancing plant immunity against bacterial pathogens, wherein HopM11-300 mediated protection is enhanced, such as increased protection to Pseudomonas syringae pv. tomato DC3000 HopM1 and/or there is an increase in activity... Agent: Medlen & Carroll, LLP

20090258828 - Investigation of mucosa dryness conditions: The present invention relates to diagnosis and/or treatment of medical conditions. The present invention relates to new method of diagnosing dry mucosa condition in a subject. The condition may be dry eye. The present invention also provides a method to monitor the efficacy of a treatment of a dry mucosa... Agent: Heslin Rothenberg Farley & Mesiti PC

20090258829 - New formulation for increasing bioavailability of neurturin: The present invention relates to formulations with protein growth factors, particularly neurturin as active ingredients and low molecular weight polyanionic excipients having increased bioavailability.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20090258826 - Pituitary adenylate cyclase activating peptide (pacap) receptor (vpac2) agonists and their pharmacological methods of use: This invention provides novel peptides that function in vivo as agonists of the VPAC2 receptor. These insulin secretagogue polypeptides are shown to lower blood glucose in vivo more than controls upon glucose challenge. The polypeptides of this invention are also stable in formulation and have long half-lives. The peptides of... Agent: Edwards Angell Palmer & Dodge LLP

20090258827 - Transcription factor modulator: The present invention relates to novel agents that are useful for modulating transcription factor activity. In particular, the present invention relates to A transcription factor modulator comprising (i) a pharmaceutically-effective amount of a HLS-5 polypeptide, isoform thereof, functional fragment thereof or pharmaceutical composition thereof; or (ii) a compound or composition... Agent: K&l Gates LLP

20090258831 - Treatment using neublastin polypeptides: The invention relates to treatments of neuropathic pain, including tactile allodynia, and to treatments for reducing loss of pain sensitivity associated with neuropathy. The present treatments involve the use of neublastin (NBN) polypeptides.... Agent: Fish & Richardson

20090258834 - Plasma protein-binding ligands: The invention provides an isolated or purified peptide that binds at least one plasma protein. In one embodiment, the isolated or purified peptide binds to fibrinogen, comprises no more than 10 amino acids, and comprises an amino acid sequence Xaa1-Xaa2-Xaa3-Xaa4-Xaa5, an amino acid sequence Gly-Xaa6-Arg-Xaa7, or an amino acid sequence... Agent: Drinker Biddle & Reath (dc)

20090258835 - Compounds that stimulate glucose utilization and methods of use: wherein W, Cyc, p, Y, X, Z, R, R1, R2, R3, R4, I, m and n are as defined for Formula (I) herein. The invention also relates to pharmaceutical compositions comprising compounds capable of stimulation of glucose oxidation, methods for increasing glucose oxidation rates in myocardial cells, and methods of... Agent: Pillsbury Winthrop Shaw Pittman LLP

20090258923 - Carrier composition for nucleic acid transport: e

20090258929 - Compositions and methods for modulating mtor signaling: The present invention relates to the use of antagonists of the mTOR signaling pathway and its constituent members (e.g., antagonists of MAPKAP) for the treatment, amelioration, and diagnosis of PI3K/AKT/mTOR-related disorders, e.g., cancers. The present invention also relates to methods of using modulators of mTOR (e.g., modulators of MAPKAP) for... Agent: Novartis Corporate Intellectual Property

20090258927 - Method for the modulation of function of transcription factors: There is provided a method of modulating the function of transcription factor by administering an effective amount of an oligonucleotide containing optimal nucleotide binding sites for the transcription factor. A therapeutic agent having an effective amount of an oligonucleotide for modulating function of transcription factors and a pharmaceutically acceptable carrier... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20090258926 - Methods and compositions for delivering sirna into mammalian cells: Complex comprising a peptide carrier of SEQ ID NO:1 GALFLGFLGAAGSTMGAWSQPKR1KRKVR2 and an appropriate siRNA, wherein R1 represents any amino acid residue and more preferably K or S, R2 is null or represents one of the following groups: cysteamide, cysteine, thiol, amide, linear or ramified C1-C6 alkyl optionally substituted, primary or... Agent: Morgan Lewis & Bockius LLP

20090258928 - Methods and compositions for diagnosing and modulating human papillomavirus (hpv): The present invention concerns methods and compositions for treating a patient having, suspected of having, or at risk of obtaining a HPV infection.... Agent: Fullbright & Jaworski L.L.P.

20090258924 - Methods, compositions and drug delivery systems for intraocular delivery of sirna molecules: Biocompatible intraocular drug delivery systems in the form of an implant for intraocular administration of siRNA molecules. The drug delivery systems may be placed in an eye to treat or reduce the occurrence of one or more ocular conditions, such as retinal damage, including glaucoma and proliferative vitreoretinopathy among others.... Agent: Allergan, Inc.

20090258925 - Natural antisense and non-coding rna transcripts as drug targets: Small interfering RNA (siRNA) knock down antisense transcripts, and regulate the expression of their sense partners. This regulation can either be discordant (antisense knockdown results in sense transcript elevation) or concordant (antisense knockdown results in concomitant sense transcript reduction).... Agent: Wilson Sonsini Goodrich & Rosati

20090258931 - Chimeric oligomeric compounds comprising alternating regions of northern and southern conformational geometry: The present invention relates to novel chimeric oligomeric compounds having a plurality of alternating regions having either RNA like having northern or 3′-endo conformational geometry (3′-endo regions) or DNA like having southern or C2′-endo/O4′-endo conformational geometry. The oligomeric compounds of the present invention have shown reduction in mRNA levels in... Agent: Woodcock Washburn LLP

20090258934 - Compositions and methods for inhibiting expression of nav1.8 gene: The invention relates to a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of the Nav1.8 gene (Nav1.8 gene), comprising an antisense strand having a nucleotide sequence which is less that 25 nucleotides in length and which is substantially complementary to at least a part of the Nav1.8 gene. The... Agent: Alnylam/fenwick

20090258930 - Double stranded rna structures and constructs, and methods for generating and using the same: The present invention relates to novel double stranded RNA (dsRNA) structures and dsRNA expression constructs, methods for generating them, and methods of utilizing them for silencing genes. Desirably, these methods specifically inhibit the expression of one or more target genes in a cell or animal (e.g., a mammal such as... Agent: Cooley Godward Kronish LLP Attn: Patent Group

20090258935 - Hybrid adeno-retroviral vector for the transfection of cells: An adenovirus, including adenoviral capsid proteins, and a replication-defective adenoviral vector that includes a 5′ retroviral LTR nucleic acid sequence, a 3′ retroviral LTR nucleic acid sequence, a nucleic acid sequence encoding a portion of a retroviral envelope protein adjacent to either the 5′ LTR or the 3′ LTR nucleic... Agent: Klarquist Sparkman, LLP

20090258932 - Lyophilized dna formulations for enhanced expression of plasmid dna: The present invention provides for a method of treating or preventing ischemic or liver disease in a subject by administering a composition reconstituted from a lyophilized hepatocyte growth factor (HGF) DNA formulation, where the DNA formulation comprises an HGF plasmid DNA, salt and a carbohydrate. The invention further provides for... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20090258933 - Oligonucleotides-transferring preparations: Preparations for transferring efficiently oligonucleotides necessary in antisense therapy or the like into animal cells so as to be useful in treatment for various diseases, which comprises a collagen as an essential component are provided.... Agent: Birch Stewart Kolasch & Birch

20090258836 - Effective delivery of cross-species a3 adenosine-receptor antagonists to reduce intraocular pressure: Provided are methods for reducing intraocular pressure in an individual having an ocular disorder causing elevated intraocular pressure, such as glaucoma. The method comprises administering to the individual an effective intraocular pressure-reducing amount of a pharmaceutical composition comprising an A3 subtype adenosine receptor (A3AR) antagonist, including dihydropyridine, pyridine, pyridinium salt... Agent: Montgomery, Mccracken, Walker & Rhoads, LLP

20090258837 - Analogous compounds of 6-thioguanosine triphosphate, their use in medical fields and processes for their preparation: The invention relates to analogous compounds of 6-thioguanosine triphosphate of general formula (I). A compound of the general formula (I); wherein the dashed bond in the sugar moiety can be either single or double and wherein R1, R2, R3, R4 or R5, equal or different between each other, have general... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20090258838 - Gel formulation: The present invention relates to a sterile gel formulation comprising calcium gluconate. It also relates to a sterilisable gel formulation comprising calcium gluconate, which is stable under gamma-radiation sterilisation conditions, and also to the use of these formulations in, for example, treating burns caused by exposure of a human or... Agent: Barlow, Josephs & Holmes, Ltd.

20090258839 - Compositions comprising chitosan suitable for comprehensive therapeutic treatment or comprehensive prevention of the metabolic syndrome: The present invention relates to compositions comprising chitosan, in the form of drugs or food supplements, suitable for comprehensive therapeutic treatment or comprehensive prevention of the metabolic syndrome. Also described is their preparation. More generally, the invention concerns the use of chitosan for comprehensive therapeutic treatment or comprehensive prevention of... Agent: Knobbe Martens Olson & Bear LLP

20090258840 - Method and compositions for treating hematological malignancies: A compound of formula (1), and/or its salts, tautomers or solvates is used to treat hematological malignancies. In an embodiment, an organic acid salt of compound 1 is provided for general use in treatment of neoplasms, and in a further embodiment the salt is stabilized with carbohydrate.... Agent: Gilead Sciences Inc

20090258841 - Compositions and methods for skin care: Compositions and methods are for disclosed for treating a skin condition that results from reactive oxygen species production in skin of a subject, including applying a topical formulation that contains a lipophilic cation-mitochondrially targeted antioxidant compound and that delivers a therapeutically effective amount of the antioxidant compound to skin fibroblasts... Agent: Seed Intellectual Property Law Group PLLC

20090258842 - 7-phenyl-substituted tetracycline compounds: 7-phenyl-substituted tetracycline compounds, methods of treating tetracycline responsive states, and pharmaceutical compositions containing the 7-phenyl-substituted tetracycline compounds are described.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20090258843 - Compositions containing antiviral compounds and methods of using the same: The present invention is directed to compositions and methods for the treatment of various diseases, pathological disorders, and medical conditions such as viral infections and cancer. The compositions include (A) an antiviral compound or a pharmaceutically acceptable salt thereof; and (B) an agent selected from the group consisting of a... Agent: Mallinckrodt Inc.

20090258844 - Compositions and methods for the treatment of disorders of the central and peripheral nervous systems: The present invention relates to methods and compositions for treating selected conditions of the central and peripheral nervous systems employing non-synaptic mechanisms. More specifically, one aspect of the present invention relates to methods and materials for treating seizure and seizure disorders, epilepsy, status epilepticus, migraine, spreading depression, intracranial hypertension; for... Agent: Hunton & Williams LLP Intellectual Property Department

20090258845 - Combination dosage forms and therapies for supporting bone health: Combined therapies and oral dosage forms based on genistein for the support of osteoporotic health.... Agent: Patent Correspondence Arnall Golden Gregory LLP

20090258847 - Cholanic acid amides: 4-(3-hydroxy-10,13-dimethyl-hexadecahydro-cyclopenta[a]phenanthren-17-yl)-pentanoic acid amides wherein the nitrogen of the amide group is substituted by a sulfonylaminocarbonyl-(C1-4)-alkyl group; and the use of such compounds as pharmaceuticals.... Agent: Novartis Institutes For Biomedical Research, Inc.

20090258846 - Eyebrow re-growth stimulator for re-growth of lost eyebrows: A chemical composition and method of an eyebrow re-growth stimulator for women who has lost there eyebrows due to dease and treatments. The lose of harmons and other causes such as in ageing women population. The eyebrow regrowth composition methods of topical treatment in an effective amount of the treatment... Agent: Linda Sue Apple

20090258848 - Biomarkers for inflammatory bowel disease: The present invention relates to methods of determining inflammatory bowel disease status in a subject. The invention further relates to kits for determining inflammatory bowel disease status in a subject. The invention further related to methods of identifying biomarker for determining inflammatory bowel disease status in a subject.... Agent: Edwards Angell Palmer & Dodge LLP

20090258849 - Nitrooxy derivatives of glucocorticoids: The invention relates to new steroids nitrooxyderivatives, to topical pharmaceutical formulations thereof, and their use for treating skin or mucosal membrane diseases or disorders. These new steroids nitrooxyderivatives have an improved pharmacological activity and enhanced local tolerability.... Agent: Arent Fox LLP

20090258850 - Stabilized therapeutic compositions and formulations: The invention relates to pharmaceutically acceptable formulations comprising an active pharmaceutical ingredient such as androst-5-ene-3β,17β-diol, androst-5-ene-3β,7β,17β-triol or derivatives of either of these compounds and an air oxidizable excipient that have been stabilized with respect to efficacy. Use of the efficacy-stabilized formulations to treat a number of conditions or symptoms thereof,... Agent: Hollis-eden Pharmaceuticals, Inc.

20090258851 - Diaryl substituted alkanes: e

20090258855 - Bicyclic triazoles as protein kinase modulators: The present disclosure provides bicyclic triazole protein kinase modulators and methods of using these compounds to treat diseases mediated by kinase activity.... Agent: Eli Lilly & Company

20090258852 - Inhibitors of checkpoint kinases: The instant invention provides for compounds which comprise benzoisoquinolinones and aza derivatives that inhibit CHK1 activity. The invention also provides for compositions comprising such inhibitory compounds and methods of inhibiting CHK1 activity by administering the compound to a patient in need of treatment of cancer.... Agent: Merck And Co., Inc

20090258853 - Somatostatin agonists: This invention relates to compounds which are agonists of somatostatin and selective toward somatostatin receptor subtype SSTR2. The compounds are useful in the treatment and prevention of diabetes, and diabetes-related pathologies, including retinopathy, neuropathy and nephropathy. Many of the compounds are orally active. Thus, it is an object of this... Agent: Merck And Co., Inc

20090258854 - Thiazolopyridin-2-yloxy-phenyl and thiazolopyrazin-2-yloxy-phenyl amines as modulators of leukotriene a4 hydrolase: Thiazolopyridin-2-yloxy-phenyl and thiazolopyrazin-2-yloxy-phenyl amine compounds are described, which are useful as LTA4 hydrolase (LTA4H) modulators. Such compounds may be used in pharmaceutical compositions and methods for modulation of LTA4H and for the treatment of disease states, disorders, and conditions mediated by LTA4 hydrolase activity.... Agent: Philip S. Johnson Johnson & Johnson

20090258856 - Imidazopyridazinone and imidazopyridone derivatives, the preparation thereof and their use as pharmaceutical compositions: i

20090258857 - Chemical compounds: The present invention encompasses compounds of general formula (1) wherein R1, M1, L1 and Q are defined as in claim 1, which are suitable for the treatment of diseases characterised by excessive or anomalous cell proliferation, and the use thereof for preparing a pharmaceutical composition with the above-mentioned properties.... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation

20090258858 - Muscarinic acetylcholine receptor antagonists: Muscarinic Acetylcholine receptor antagonists and methods of using them are provided.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20090258859 - Metronidazole cocrystals and imipramine cocrystals: Cocrystals of metronidazole are described herein. Such cocrystals are a cocrystal of metronidazole with gentisic acid and a cocrystal of metronidazole with gallic acid. Cocrystals of imipramine hydrochloride are also described. Such cocrystals are a cocrystal of imipramine hydrochloride with (+)-camphoric acid, a cocrystal of imipramine hydrochloride with fumaric acid,... Agent: Nixon Peabody, LLP

20090258860 - Xanthine derivatives for the treatment of vascular depression: Methods and compositions are provided for treating vascular depression. The methods involve administering to a subject in need thereof a xanthine derivative in a therapeutically effective amount to treat vascular depression, particularly the xanthine derivatives pentoxifylline or propentofylline. The methods may further include administration of an additional therapeutic agent in... Agent: Alston & Bird LLP

20090258861 - Tetrahydronaphthyridine derivatives: t

20090258862 - Niacin receptor agonists, compositions containing such compounds and methods of treatment: Compounds of the formula (I): as well as pharmaceutically acceptable salts and solvates are disclosed. The compounds are useful for treating dyslipidemias, and in particular, reducing serum LDL, VLDL and triglycerides, and raising HDL levels. Pharmaceutical compositions and methods of treatment are also included.... Agent: Merck And Co., Inc

20090258863 - Method for treatment of amyotrophic lateral sclerosis using talampanel: A method of treating a human patient afflicted with amyotrophic lateral sclerosis (ALS) comprising periodically administering to the human patient for a therapeutically effective duration a pharmaceutical composition comprising an amount of talampanel therapeutically effective to provide a benefit to the human patient, thereby treating the human patient.... Agent: Cooper & Dunham, LLP

20090258865 - Administration of benzodiazepine compositions: The invention relates to pharmaceutical compositions comprising one or more benzodiazepine drugs for nasal administration, methods for producing and for using such compositions.... Agent: Wilson, Sonsini, Goodrich & Rosati

20090258866 - Cgrp receptor antagonists: The disclosure generally relates to the novel compounds of formula I, including their salts, which are CGRP receptor antagonists. The disclosure also relates to pharmaceutical compositions and methods for using the compounds in the treatment of CGRP related disorders including migraine and other headaches, neurogenic vasodilation, neurogenic inflammation, thermal injury,... Agent: Louis J. Wille Bristol-myers Squibb Company

20090258864 - Pyrimidine-2-amine compounds and their use as inhibitors of jak kinases: n, m, Y, R1, R2, R3, R4 and R5 are disclosed herein, as isolated stereoisomers or mixtures thereof, or as pharmaceutically acceptable salts thereof; pharmaceutical compositions comprising the compounds of formula (I); and methods of using the compounds and the pharmaceutical compositions in treating diseases or conditions associated with JAK2... Agent: Seed Intellectual Property Law Group PLLC

20090258867 - Pyrazolo[1,5-a] pyrimidine compounds as cb1 receptor antagonist: The present invention provides a pyrazolo[1,5-a]pyrimidine compound, having CB1 receptor-antagonizing activity, of the following formula [I]: in which R1 and R2 are the same or different and each an optionally substituted aryl group etc, R0 is hydrogen atom, an alkyl group etc, E is a group of the formula: —C(═O)—... Agent: Birch Stewart Kolasch & Birch

20090258868 - Heterocyclic aspartyl protease inhibitors: e

20090258869 - Methods and compounds for treatment or prevention of substance-related disorders: The present disclosure provides methods of treating or preventing a substance-related disorder using Hsp90 inhibitors, Hsp90 modulators, tyrosine hydroxylase modulators, and modulators that reduce the interaction between Hsp90 and tyrosine hydroxylase.... Agent: Jones Day

20090258870 - Novel ansamitocin derivatives: Provided are among other things ansamitocin derivatives, pharmaceutical compositions comprising these novel ansamitocin derivatives, methods for the production of the ansamitocin derivatives and their use for the treatment of cancer.... Agent: Edwards Angell Palmer & Dodge LLP

20090258871 - Aza-substituted spiro derivatives: [wherein X, Y, Z and W each independently represent a methine group or a nitrogen atom, provided that a case where all of X, Y, Z and W are methine group; A represents —O— or the like, B represents —C(O)— or the like, D represent —(CH2)m2-, —O— or the like,... Agent: Merck And Co., Inc

20090258872 - Use of aryl-substituted polycyclic amines as medicaments: h

20090258873 - Novel tetrahydropyridothiophenes: Compounds of a certain formula (I), in which Ra and Rb have the meanings indicated in the description, are novel effective compounds with anti-proliferative and apoptosis inducing activity.... Agent: Millen, White, Zelano & Branigan, P.C.

20090258874 - Pyrazolo-heteroaryl compounds: m

20090258875 - Fungicide hydroximoyl-tetrazole derivatives: The present invention relates to hydroximoyl-tetrazole derivatives of formula (I) wherein T represent a tetrazolyl substituents, A represents a carbo- or heterocycle, L1 and L2 represent various linking groups and Q represents a carbocycle, their process of preparation, their use as fungicide active agents, particularly in the form of fungicide... Agent: Ostrolenk Faber Gerb & Soffen

20090258876 - Novel indol carboxylic acid bispyridyl carboxamide derivatives, pharmaceutically acceptable salt thereof, preparation method and composition containing the same as an active ingredient: Disclosed herein are a new indole carboxylic acid bispyridyl carboxamide derivative, a preparation method thereof, and a composition for prevention or treatment of obesity, urinary disorders, and CNS disorders, containing the same as an active ingredient. Because the indole carboxylic acid bispyridyl carboxamide derivatives according to the present invention have... Agent: Lucas & Mercanti, LLP

20090258877 - Triazolotriazines and triazolopyrazines and their use: The invention relates to substituted triazolotriazines and triazolopyrazines and to processes for their preparation, and also to their use for preparing medicaments for the treatment and/or prophylaxis of diseases, in particular haematologic disorders, preferably of leukopenias and neutropenias.... Agent: Nixon Peabody LLP

20090258878 - Triazine derivative compound and composition for treating cancer containing them: The present invention relates to a Triazine derivative compound, pharmaceutically acceptable salt thereof and a pharmaceutical composition containing them. Compound or composition of the present invention is useful for cancer treatment, and especially has superior effect in breast cancer treatment.... Agent: Robert E. Bushnell & Law Firm

20090258881 - Aryl-substituted polycyclic amines, method for the production thereof, and use thereof as a medicament: e

20090258879 - Method for treating cancer, rheumatoid arthritis and other medical diseases by utilizing modified virus virions to insert medications into targeted cells: A safer, more effective treatment of many medical diseases may be approached by a method utilizing modified viruses as vehicles to transport medically therapeutic drug molecules to specific cells in the body with the intent to have the drug exert an effect only on those cells to which the modified... Agent: Lane B. Scheiber

20090258880 - Substituted tetrahydropyrrolopyrazine compounds and the use thereof in pharmaceutical compositions: s

20090258882 - 2,4-substituted quinazolines as lipid kinase inhibitors:

20090258883 - 1h-indole-pyridinecarboxamide and 1h-indole-piperidinecarboxamide compounds:

20090258884 - Substituted amides: Novel compounds of the structural formula (I) are antagonists and/or inverse agonists of the Cannabinoid-1 (CB1) receptor and are useful in the treatment, prevention and suppression of diseases mediated by the CB1 receptor. The compounds of the present invention are useful as centrally acting drugs in the treatment of psychosis,... Agent: Merck And Co., Inc

20090258885 - Diphenylmethane derivatives as inhibitors of leukotriene biosynthesis: The instant invention provides compounds of Formula I which are 5-lipoxygenase activating protein inhibitors. Compounds of Formula I are useful as anti-atherosclerotic, anti-asthmatic, anti-allergic, anti-inflammatory, and cytoprotective agents.... Agent: Merck And Co., Inc

20090258886 - Heteroalkyl linked pyrimidine derivatives: The present invention relates to pyrimidine compounds that are useful as anti-proliferative agents. More particularly, the present invention relates to heteroalkyl linked and substituted pyrimidine compounds, methods for their preparation, pharmaceutical compositions containing these compounds and uses of these compounds in the treatment of proliferative disorders. These compounds may be... Agent: Connolly Bove Lodge & Hutz LLP

20090258887 - Novel carboxylic acid derivatives: The present invention is concerned with novel arylalkyl carboxylic acid derivatives, more specifically, with acylates of arylalkyl carboxylic acids with naturally occurring, non-toxic hydroxy, sulfhydryl, amino or imino compounds, and to compositions containing them. The compositions are preferably cosmetic preparations.... Agent: Nixon & Vanderhye, PC

20090258888 - Pyrimidine derivatives: This invention relates to novel compounds and processes for their preparation, methods of treating diseases, particularly cancer, comprising administering said compounds, and methods of making pharmaceutical compositions for the treatment or prevention of disorders, particularly cancer.... Agent: Edwards Angell Palmer & Dodge LLP

20090258889 - Pesticidal compositions: The present disclosure relates to pesticidal compositions and to methods for controlling pests such as insects and other arthropods. More particularly, the disclosure relates to a pesticidal compositions containing mineral oil and one or more additional components which, when used in combination, act synergistically to control insect and pest populations.... Agent: Patent Docket Department Armstrong Teasdale LLP

20090258890 - Topoisomerase-targeting agents: the bond represented by is a single bond or a double bond, and R1-R5, X, and Y have any of the meanings defined in the specification and their pharmaceutically acceptable salts. The invention also provides pharmaceutical compositions comprising a compound of formula I or II, processes for preparing compounds... Agent: Viksnins Harris & Padys Pllp

20090258891 - Macrocyclic compounds as antiviral agents: The present invention relates to macrocyclic compounds of formula (I): wherein W, n, R1, Ra, Rb, R3, R4, M, Z, ring A and ring B are defined herein, and pharmaceutically acceptable salts thereof, pharmaceutical compositions comprising them, and their use for the treatment or prevention of infection by hepatitis C... Agent: Merck And Co., Inc

20090258892 - Fused pyrazole derivatives and methods of treatment of metabolic-related disorders thereof: Also provided by the present invention are pharmaceutical compositions containing compounds of the invention, and methods of using the compounds and compositions of the invention in the treatment of metabolic-related disorders, including dyslipidemia, atherosclerosis, coronary heart disease, insulin resistance, type 2 diabetes, Syndrome-X and the like. In addition, the present... Agent: Fish & Richardson P.C.

20090258893 - Fused quinoline derivative and use thereof: s

20090258894 - Fused aminopiperidines as dipeptidyl peptidase-iv inhibitors for the treatment or prevention of diabetes: The present invention is directed to novel substituted fused aminopiperidines which are inhibitors of the dipeptidyl peptidase-IV enzyme (“DPP-IV inhibitors”) and which are useful in the treatment or prevention of diseases in which the dipeptidyl peptidase-IV enzyme is involved, such as diabetes and particularly Type 2 diabetes. The invention is... Agent: Merck And Co., Inc

20090258895 - Pharmaceutical formulation and process comprising a solid dispersion of macrolide (tacrolimus): The present invention relates to a pharmaceutical formulation and process for preparing the same comprising an oral dosage formulation, such as a capsule formulation, of a macrolide compound, such as tacrolimus, wherein the capsule formulation contains both a solid dispersion of the macrolide along with a non-dispersed form of the... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation

20090258896 - Composition comprising at least one higher aliphatic alcohol and an extract of griffonia simplicifolia: Novel compositions comprising a combination of at least one higher primary aliphatic alcohol preferably selected from those having 18 to 40 carbon atoms or mixtures thereof, at least one source of 5-hydroxytryptophan (5-HTP) optionally additionally comprising a source of caffeine and/or catechin-polyphenol and/or epigallocatechin gallate as active agents, either alone... Agent: Ladas & Parry LLP

20090258897 - Substituted benzimidazoles: Disclosed herein are substituted benzimidazole-based proton pump modulators of Formula I, processes of preparation thereof, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20090258898 - Amides of acetic and propionic acids: The invention relates to novel amides of acetic and propionic acids, methods for production and use thereof for the production of medicaments for the treatment and/or prophylaxis of diseases and for improving perception, concentration, learning ability and memory.... Agent: Edwards Angell Palmer & Dodge LLP

20090258899 - Derivatives of pyrrolizine, indolizine and quinolizine, preparation thereof and therapeutic use thereof: e

20090258900 - Amide derivative: A is a cycloalkyl group, an aryl group or a heteroaryl group; X is a nitrogen atom or CR17; Y is —NRa—, —(CRbRb′)m-, and the like; m is 0 to 4; and R1 to R17 may be the same or different and each is a hydrogen atom, a halogen atom,... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20090258901 - Ligands for monoamine receptors and transporters, and methods of use thereof: One aspect of the present invention relates to heterocyclic compounds. A second aspect of the present invention relates to the use of the heterocyclic compounds as ligands for various mammalian cellular receptors, including dopamine, serotonin, or norepinephrine transporters. The compounds of the present invention will find use in the treatment... Agent: Jones Day

20090258902 - Biphenyl-pyrazolecarboxamide compounds: The present invention relates to biphenyl-pyrazole compounds and in particular biphenyl-pyrazolecarboxamides. The invention further provides compositions comprising a compound of this invention and the use of such compositions in methods of treating diseases and conditions beneficially treated by antagonism or inverse agonism of the CB1 receptor, such as obesity, smoking... Agent: Edwards Angell Palmer & Dodge LLP

20090258903 - Aminoethane sulfonamide orexin receptor antagonists: The present invention is directed to aminoethane sulfonamide compounds which are antagonists of orexin receptors, and which are useful in the treatment or prevention of neurological and psychiatric disorders and diseases in which orexin receptors are involved. The invention is also directed to pharmaceutical compositions comprising these compounds and the... Agent: Merck And Co., Inc

20090258904 - Epithiolone analogues: Epothilone analogues include a molecular scaffold which holds at least one segment of epothilone in a predetermined orientation and which rigidities a region between the macrolactone ring and the aromatic side-chain.... Agent: Macmillan Sobanski & Todd, LLC

20090258905 - Phosphodiesterase-4 inhibitors belonging to the tertiary amine class: o

20090258906 - Cxcr2 antagonists: in which R1, R2, A, B, X and Y have the meanings indicated in the claims, and/or a pharmaceutically acceptable salt and/or a prodrug thereof. Because of their properties as inhibitors of chemokine receptors, especially as CXCR2 inhibitors, the compounds of the formula I and the pharmaceutically acceptable salts and... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20090258907 - Compounds useful as inhibitors of rock kinases:

20090258908 - Crystalline s-omeprazole strontium hydrate, method for preparing same, and pharmaceutical composition containing same: This invention provides a crystalline S-omeprazole strontium hydrate for the prevention or treatment of gastric acid-related diseases, which has high optical purity, theremostability, solubility and nonhygroscopicity, a method for preparing same, and a pharmaceutical composition containing same.... Agent: Sughrue Mion, PLLC

20090258909 - Novel benzimidazole derivatives useful as selective androgen receptor modulators (sarms): The present invention is directed to novel benzimidazole derivatives, pharmaceutical compositions containing them and their use in the treatment of disorders and conditions modulated by the androgen receptor.... Agent: Philip S. Johnson Johnson & Johnson

20090258910 - Compounds and compositions as protein kinase inhibitors: The invention provides a novel class of compounds, pharmaceutical compositions comprising such compounds and methods of using such compounds to treat or prevent diseases or disorders associated with abnormal or deregulated kinase activity, particularly diseases or disorders that involve abnormal activation of the Abl, BCR-Abl, PDGF-R, lck, SAPK2α, p38, TGFβ,... Agent: Genomics Institute Of The Novartis Research Foundation

20090258911 - Composition and method for treating fibrotic diseases: The present invention discloses 5-methyl-1-(substituted phenyl)-2(1H)-pyridones have enhanced anti-fibrotic activities than 5-methyl-1-(non-substituted phenyl)-2(1H)-pyridones. An representative example of 5-methyl-(1-substituted phenyl)-2(1H)-pyridones is 1-(3′-fluorophenyl)-5-methyl-2(1H)-pyridone. Accordingly, there are provided compositions comprising one or more compounds selected from the group consisting of 5-methyl-1-(substituted phenyl)-2(1H)-pyridones and methods of using the same to treat or prevent fibrosis... Agent: Law Offices Of Albert Wai-kit Chan, PLLC

20090258912 - N-(1-alkyl-2-phenylethyl)-carboxamide derivatives and use thereof as fungicides: e

20090258913 - Triazole derivatives as inhibitors of 11-beta-hydroxysteroid dehydrogenase-1: Triazole derivatives of structural formula I are selective inhibitors of the 11β-hydroxysteroid dehydrogenase-1. The compounds are useful for the treatment of diabetes, such as noninsulin-dependent diabetes (NIDDM), hyperglycemia, obesity, insulin resistance, dyslipidemia, hyperlipidemia, hypertension, Metabolic Syndrome, and other symptoms associated with NIDDM.... Agent: Merck And Co., Inc

20090258914 - Inhibitor of anti-apoptotic proteins: A compound having the structure A is described as well as the use of such compounds to inhibit at least one BCL-2 protein family member.... Agent: Dla Piper LLP (us)

20090258915 - Ribonucleotide reductase inhibitors and methods of use: Provided herein are novel compounds that inhibit ribonucleotide reductase (RR) by binding to RRM2 and interfering with the activity of the RRM1/RRM2 holoenzyme. These inhibitors may be used to inhibit RR activity and to treat various conditions associated with RRM2 expression, such as for example certain cancer types, mitochondrial diseases,... Agent: Perkins Coie LLP

20090258916 - Low-melting biocidal formulation: A low-melting biocidal composition comprising 4,5-dichloro-2-octyl-3(2H)-isothiazolone, 3-iodopropargyl-N-butyl carbamate and at least one C1-C4 alkyl 4-hydroxybenzoate. The composition is stable with regard to agglomeration and crystallization at room temperature.... Agent: Rohm And Haas Company Patent Department

20090258917 - Benzoxazoles useful in the treatment of inflammation: wherein Y, W1 to W4, Z1 to Z4 and R have meanings given in the description, and pharmaceutically-acceptable salts thereof, for the manufacture of a medicament for the treatment of a disease in which inhibition of the activity of a member of the MAPEG family is desired and/or required, and... Agent: Morgan Lewis & Bockius LLP

20090258918 - Ep4 receptor agonist, compositions and methods thereof: This invention relates to potent selective agonists of the EP4 subtype of prostaglandin E2 receptors, their use or a formulation thereof in the treatment of glaucoma and other conditions which are related to elevated intraocular pressure in the eye of a patient.... Agent: Merck And Co., Inc

20090258919 - Pharmaceutical formulations and use thereof in the prevention of stroke, diabetes and / or congestive heart failure: The present invention relates to use of an inhibitor of the renin-angiotensin system (RAS) or a pharmaceutically acceptable derivative thereof, such as ramipril or ramiprilat, in the prevention of stroke, diabetes and/or congestive heart failure (CHF).... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20090258921 - Indole derivatives: e

20090258920 - Injectable formulation of antibiotic and solution for intravenous administration thereof: A pharmaceutical composition for injection comprising a depsipeptide antibiotic, WAP-8294A2, as an active ingredient, which is stable and contains WAP-8294A2 in high concentrations is provided. This composition comprises WAP-8294A2 of the following structural formula (1) as an active ingredient and is characterized in that 2-hydroxypropyl-β-cyclodextrin or β-cyclodextrin is contained as... Agent: Buchanan, Ingersoll & Rooney PC

20090258922 - Compound exhibiting pgd2 receptor antagonist: p

20090258936 - Cxcr2 inhibitors: in which R1, R2, A, B, X and Y have the meanings indicated in the claims, and/or a pharmaceutically acceptable salt and/or a prodrug thereof. Because of their properties as inhibitors of chemokine receptors, especially as CXCR2 inhibitors, the compounds of the formula I and the pharmaceutically acceptable salts and... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20090258937 - Methods for modulating tumor growth and metastasis: Methods and pharmaceutical compositions for modulating tumor growth or metastasis are provided.... Agent: Oxigene, Inc. C/o Law Offices Of Karen E. Flick

20090258938 - Administration of 6'-ethyl lepimectin, 6' -methyl lepimectin or derivatives thereof for treating dermatological disorders in humans: 6′-ethyl lepimectin, 6′-methyl lepimectin or derivatives thereof are formulated into pharmaceutical compositions useful for the treatment of dermatological conditions in humans, in particular rosacea.... Agent: Buchanan, Ingersoll & Rooney PC

20090258940 - American cranberry extract and its use: The present invention relates to an extract derived from Vaccinium and to the process for obtaining this extract. This proanthocyanidin-rich extract can be used as a dietary or nutraceutical preparation.... Agent: Wiggin And Dana LLP Attention: Patent Docketing

20090258942 - Calycosin and analogs thereof for the treatment of estrogen receptor beta-mediated diseases: Estrogenic compositions comprising calycosin and analogs thereof are provided. Also provided are methods of using said extracts to achieve an estrogenic effect, especially in a human, e.g. a female human. In some embodiments, the methods include treatment of climacteric symptoms. In some embodiments, the methods include treatment of estrogen receptor... Agent: Wilson, Sonsini, Goodrich & Rosati

20090258939 - Pyrone analog compositions and methods: Novel pyrone analogs are described which can enhance the effectiveness of a therapeutic agent when administered and/or reduce side effects caused by the administration of a therapeutic agent.... Agent: Wilson Sonsini Goodrich & Rosati

20090258941 - Use of fusarochromanone and its derivatives in the diagnosis and treatment of cancer and other diseases: A method of photodynamic therapy to treat diseased cells in an animal is generally provided. According to the method, 5-amino-2,2-dimethyl-6-[3′-(R,S)amino-4′-hydroxy-butan-1-one]-2,3-dihydro-4H-1-benzopyran-4-one or an analog thereof is administered to the animal such that the 5-amino-2,2-dimethyl-6-[3′-(R,S)amino-4′-hydroxy-butan-1-one]-2,3-dihydro-4H-1-benzopyran-4-one or an analog thereof accumulates in the diseased cells. Then, the diseased cells containing 5-amino-2,2-dimethyl-6-[3′-(R,S)amino-4′-hydroxy-butan-1-one]-2,3-dihydro-4H-1-benzopyran-4-one or an... Agent: Dority & Manning, P.A.

20090258943 - Hybrid strategies for reducing leaching of metal biocides from biodegradable substrates: Hybrid strategies generally involve treating biodegradable substrates with preservative compositions having at least two phases in which the metal biocide is distributed among at least the two phases and via equilibrium reactions moves between the two phases. Both phases are caused to contact the substrate in a manner so that... Agent: The Dow Chemical Company Kagan Binder, PLLC

20090258944 - Method for the manufacture of therapeutic compounds and compositions, compounds and compositions produced therewith, and their use: Organic nitrites can be produced from a compound which is a mono/polyhydric alcohol or an aldehyde- or ketone-derivate thereof after de-aeration of the same, using NO gas, and stored in an environment saturated with gaseous NO. Organic nitrites produced according to the invention exhibit less impurities and improved storage stability... Agent: Morrison & Foerster LLP

20090258945 - Lipoxin compounds and their use in treating cell proliferative disorders: Compounds having the active site of natural lipoxins, but a longer tissue half-life are disclosed. In particular, 15-epi-lipoxins and their use in ameliorating undesired cell proliferation, which characterizes diseases such as cancer, are also disclosed.... Agent: Fulbright & Jaworski L.L.P. Attn: MnIPDocket

20090258946 - Electrostatically charged nasal application multipurpose products and method: A family of products designed to ameliorate sinusitis and allergic rhinitis, produced by combining certain chemical substances with existing products, thereby producing a synergistic effect and relief. The chemical substances create an electrostatically charged field around the nose and prevent allergens or pollutants from entering the nostrils to cause a... Agent: Stanley H. Kremen

20090258947 - Novel low dose pharmaceutical compositions comprising nimesulide, preparation and use thereof: Low dose pharmaceutical dosage form comprising nimesulide or its pharmaceutically acceptable salts, esters, solvates or hydrates thereof, along with one or more pharmaceutically acceptable excipient(s) are provided. The present invention also provides process of preparing such dosage forms and therapeutic methods of using such dosage forms. The low dose compositions... Agent: Ladas & Parry LLP

20090258948 - Pharmaceutical salts: The invention relates to pharmaceutical salts comprised of a pharmaceutical active substance and of at least one sugar substitute, to medicaments containing these salts, and to the use of these salts for producing medicaments.... Agent: Norris, Mclaughlin & Marcus, Pa

20090258949 - Amorphous form of cinacalcet: The present invention relates to dispersions of stable amorphous cinacalcet hydrochloride in a matrix material, methods for the preparation thereof, and pharmaceutical compositions comprising said dispersions.... Agent: Manelli Denison & Selter

20090258950 - Non-toxic insecticide: A non-toxic insecticidal composition includes a base horticultural oil, an emulsifier such as potassium salts of fatty acids, cinnamaldehyde and eugenol.... Agent: Edward Yoo C/o Bennett Jones

20090258951 - Use of vanillyl alcohol for the treatment of parkinson's disease: A use of Vanillyl alcohol for treatment of Parkinson's disease is disclosed in accordance with the present invention. The Vanillyl alcohol's formula is 4-hydroxy-3-methoxy-benzyl alcohol and similitude with the human neurotransmitter dopamine. The Vanillyl alcohol has dopamine receptor stimulant and which is applied for pharmaceutical preparation of treating Parkinson's disease.... Agent: Bacon & Thomas, PLLC

20090258952 - Patch containing anti-inflammatory agent: An anti-inflammatory-containing plaster is provided. The anti-inflammatory-containing plaster may include, e.g., a styrene-isoprene-styrene block copolymer, a high molecular weight polyisobutylene, a low molecular weight polyisobutylene, a tackifier, a plasticizer, a dispersant, and an anti-inflammatory having a carboxyl group or a salt thereof. However, the anti-inflammatory-containing plaster does not contain L-menthol.... Agent: The Nath Law Group

20090258953 - Use of vinyl acetate-sulfonate copolymers as solubilizers for slightly water-solubable compounds:

20090258954 - Protective hydrocolloid for active ingredients: (Modified) rice endosperm protein is used as novel protective hydrocolloid for active ingredients, especially fat-soluble active ingredients and/or colorants. Included are compositions comprising (modified) rice endosperm protein and at least one active ingredient and to their manufacture, as well as to the (modified) rice endosperm protein itself and its manufacture.... Agent: Nixon & Vanderhye, PC

20090258955 - Intraocular irrigating solution having improved flow characteristics: Improved intraocular irrigating solutions are described comprising a cellulose derivative such as hydroxypropylmethylcellulose. In addition, certain solutions of the present invention comprise glutathione and dextrose. The solutions have enhanced viscosities that reduce the risk of damage to intraocular tissues during intraocular surgical procedures by reducing the turbulence of the solutions... Agent: Alcon

20090253613 - Solid-fluid composition: A nanostructure comprising a core material of a nanometric size surrounded by an envelope of ordered fluid molecules is disclosed. The core material and the envelope of ordered fluid molecules are in a steady physical state. Also disclosed, a liquid composition comprising liquid and the nanostructure.... Agent: Foley And Lardner LLP Suite 500

20090253614 - Oral insulin therapies & protocol: Methods for treating impaired glucose tolerance and early and late stage diabetes in mammals, for prophylactically sparing β-cell function, aiding in preventing β-cell death, preventing the onset of overt diabetes in a mammal with type 2 diabetes, treating the current level of glycemic control dysfunction of a mammal with impaired... Agent: Pearl Cohen Zedek Latzer, LLP

20090253615 - No-modified hemoglobins and uses therefor: Nitrosylhemoglobin can be produced by introducing gaseous NO into an aqueous solution of hemoglobin. It has been demonstrated that nitrosylhemoglobin in aqueous solution can be converted to SNO-hemoglobin upon introduction of oxygen to the solution, as is postulated to occur in the lungs. Nitrosylhemoglobin can be used in methods to... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20090253616 - Combination therapy for the treatment of cancer: A combination comprising an aurora kinase inhibitor and an efflux transporter inhibitor wherein the aurora kinase inhibitor is a compound of formula (I) or pharmaceutically acceptable salt thereof for use in the treatment of hyperproliferative diseases such as cancer.... Agent: Astrazeneca R&d Boston

20090253626 - 50 human secreted proteins: The present invention relates to novel human secreted proteins and isolated nucleic acids containing the coding regions of the genes encoding such proteins. Also provided are vectors, host cells, antibodies, and recombinant methods for producing human secreted proteins. The invention further relates to diagnostic and therapeutic methods useful for diagnosing... Agent: Foley And Lardner LLP Suite 500

20090253621 - Arabinogalactan protein having the property of absorbing fats and method for obtaining this arabinogalactan protein: The invention relates, firstly, to a method for eliminating ingested dietary fats before they are assimilated by the body, using an AGP extracted from cactus mucilage. Said AGP can be in any galenic or commercial form which is solid or dissolved in water. The invention also discloses the method of... Agent: The Marbury Law Group, PLLC

20090253617 - Diagnosis and treatment of attentional disorders: This invention features methods and compositions useful for the treatment and diagnosis of attentional disorders including attention deficit hyperactivity disorder (ADHD). Also disclosed are methods for identifying compounds useful for such therapy.... Agent: Foley & Lardner LLP

20090253623 - Gh secretagogues and uses thereof: The invention relates to use of a GH secretagogue (e.g. GRF or an analog thereof) for (1) altering a lipid parameter in a subject; (2) altering a body composition parameter in a subject, (3) treating a condition characterized by deficient or decreased bone formation in a subject (4) improving daytime... Agent: Darby & Darby P.C.

20090253625 - Glp-1, exendin-4, peptide analogs and uses thereof: The invention relates to novel polypeptide analogues of GLP-1 and exendin-4. The polypeptide, in a preferred embodiment, is insulinotropic and long-acting. Preferably, the polypeptide's insulinotropic effect is comparable to or exceeds the effect of an equimolar amount of GLP-1 or exendin-4. The invention also relates to a method of treating... Agent: National Institute Of Health C/o Ballard Spahr Andrews & Ingersoll, LLP

20090253627 - Lactoferrin compositions and methods of wound treatment: The present invention relates to lactoferrin compositions and methods of using the compositions to treat wounds. The compositions can be administered alone or in combination with other standard wound healing therapies.... Agent: Fulbright & Jaworski, LLP

20090253620 - Methods and compositions for treating gastrointestinal radiosensititivity in a subject: A method and a related composition for treating gastrointestinal radiation sensitivity in a subject are disclosed. The method comprises administering to the subject an agent that increases either the amount of or the activity of a fasting-induced adipose factor (Fiaf) protein in a subject. The composition comprises a first agent... Agent: Polsinelli Shughart PC

20090253618 - Neuronal differentiation-inducing peptide and use thereof: A neuronal differentiation inducer comprising at least one peptide which can induce the differentiation of at least one cell into a neurocyte. The peptide is an artificially synthesized peptide comprising an amino acid sequence derived from a BC-box of at least one protein belonging to the SOCS protein family or... Agent: Turocy & Watson, LLP

20090253619 - Novel peptide involved in energy homeostasis: The expression of a mRNA encoding a putative 76 amino acid, secreted protein (“Enho1”) was found to negatively correlate with fasting triglyceride and cholesterol levels. A recombinant adenovirus was used to increase the expression of Enho1 mRNA in two mouse models of obesity, KK-Ay and Lepob/Lepob mice. Over-expression of Enho1... Agent: Alan F. Feeney, Esq. Biomeasure, Incorporated

20090253630 - Pegylated pth as pth receptor modulators and uses thereof: Pharmaceutical compositions and methods are provided for the treatment and prevention of bone loss diseases including osteoporosis in a mammal.... Agent: Eli Lilly & Company

20090253624 - Pharmacologically active antiviral peptides and methods of use: This invention relates to peptides having antiviral properties. The antiviral peptides comprise membrane transiting peptides, and active fragments and derivatives of such peptides. The antiviral peptides exhibit activity against a broad spectrum of viruses, including enveloped and nonenveloped viruses, and are used in pharmaceutical compositions to prevent and/or treat viral... Agent: Patent Docket Department Armstrong Teasdale LLP

20090253629 - Use of defensins against meningitis: The present invention relates to methods for treating meningitis, such as bacterial meningitis, with defensin polypeptides.... Agent: Novozymes North America, Inc.

20090253628 - Use of pegylated igf-i variants for the treatment of neuromuscular disorders: The present invention relates to a pharmaceutical composition containing a PEGylated IGF-I variant derived from the wild-type human IGF-I amino acid sequence where one or two of the lysine amino acids at positions 27, 65, and 68 are altered to be a polar amino acid other than lysine and where... Agent: Hoffmann-la Roche Inc. Patent Law Department

20090253622 - Use of tlr3 agonists for the treatment of neurodegenerative disorders: The present invention relates to a method for the treatment and/or prophylaxis of a degenerative inflammatory process in a tissue of a subject, said method comprising increasing the activity of Toll-like receptor 3 (TLR3) in cells of said tissue. In a preferred embodiment, the TLR3 agonist is stathmin or stathmin-like... Agent: Lucas & Mercanti, LLP

20090253631 - Anti-inflammatory peptides: The present invention relates, inter alia, to a method of ameliorating an inflammatory skin condition. Thus, the present invention provides a peptide that includes the amino acid sequence KMIKP (SEQ ID NO: 20), wherein the peptide includes no more than 70 amino acids and wherein the peptide is capable of... Agent: Jenkins, Wilson, Taylor & Hunt, P. A.

20090253633 - Novel combinations of dnak inhibitors with known antibacterial agents: Compositions, methods and kits are provided comprising (a) a therapeutically effective amount of a DnaK inhibitor; and (b) a therapeutically effective amount of a known antibacterial agent. Such compositions, methods and kits are useful in the treatment of various bacterial infections.... Agent: Fox Rothschild LLP Princeton Pike Corporate Center

20090253632 - Therapeutic peptides and method: A polypeptide comprising one or more sequences derived from CDR2 or CDR3 of a TREM-1 protein, characterised by the ability to treat, ameliorate, or lessen the symptoms of conditions including sepsis, septic shock or sepsis-like conditions and IBD.... Agent: Foley And Lardner LLP Suite 500

20090253634 - Methods and compositions for the treatment of gastrointestinal disorders: The present invention features compositions and related methods for treating IBS and other gastrointestinal disorders and conditions (e.g., gastrointestinal motility disorders, functional gastrointestinal disorders, gastnoesophageal reflux disease (GERD), duodenogastric reflux, Crohn's disease, ulcerative colitis, Inflammatory bowel disease, functional heartburn, dyspepsia (including functional dyspepsia or nonulcer dyspepsia), gastroparesis, chronic intestinal pseudo-obstruction... Agent: Fish & Richardson PC

20090253635 - Peptides and peptidomimetics having anti-proliferative activity and/or that augment nucleic acid damaging agents or treatments: This invention provides compounds including peptides and peptidomimetics that can be used to treat cell proliferative disorders, such as those associated with benign and malignant tumor cells. While the invention is not limited to any particular mechanism, the compounds of the invention appear to function at least in part by... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20090253636 - Novel antifungal agent: It is intended to provide a novel peptide which can exert higher antifungal effect also on a patient whose organ function is impaired with no side effect problems. The peptide comprises the following amino acid sequence: (1) SEQ ID NO:1: Lys-Arg-Leu-Phe-Arg-Arg-Trp-Gln-Trp-Arg-Tyr, (2) SEQ ID NO:2: Arg-Arg-Trp-Gln-Trp-Arg-Met-Lys-Lys-Tyr, (3) SEQ ID NO:3:... Agent: Birch Stewart Kolasch & Birch

20090253637 - Small peptides for the treatment of alzheimer's disease and other beta-amyloid protein disorders: Use of a peptide or pharmaceutical composition comprising Leu-Ala-Phe-Val-Leu-Arg-Lys-amide having at least one D amino acid for the reduction of beta-amyloid protein, modulating APP processing, modulating activity of APP secretases, treatment of beta-amyloid protein diseases and the treatment of Alzheimer's disease.... Agent: Proteotech, Inc.

20090253638 - Somatostatin antagonists: The invention features somatostatin antagonists having a D-amino acid at the second residue.... Agent: Biomeasure, Incorporated

20090253639 - Opiorphin peptide derivatives as potent inhibitors of enkephalin-degrading ectopeptidases: The present invention relates to modified opiorphin peptides as new inhibitors of metallo-ectopeptidases.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, P.C.

20090253640 - Inhibitors of polyisoprenylated methylated protein methyl esterase: Inhibitors of the enzyme prenylated methylated protein methyl esterase (PMPMEase), the last step in the prenylation process for many eukaryotic proteins, having the general structure R1-X-A-B(R2)-Y or R1-X-A(R2)-B-Y, where R1 is preferably a polyisoprenyl group, X is a linking group, Y is a group that promotes affinity interactions to the... Agent: ParksIPLaw LLC

20090253641 - Methods for preventing or treating insulin resistance: The invention provides methods of preventing or treating insulin resistance in a mammalian subject. The methods comprise administering to the subject an effective amount of an aromatic-cationic peptide having at least one net positive charge; a minimum of four amino acids; a maximum of about twenty amino acids; a relationship... Agent: Foley & Lardner LLP

20090253642 - Mimicking the metabolic effects of caloric restriction by administration of glucose anti-metabolites: Methods of maintaining and/or attenuating a decline in the quality of life of a mammal comprising the step of administering to the mammal a composition comprising an effective amount of mannoheptulose wherein the effective amount of mannoheptulose provides a dosage to the mammal on a daily basis from about 0.001... Agent: The Procter & Gamble Company Global Legal Department - Ip

20090253643 - Equol level regulator: An object of the invention is to provide a medical drug, a food and drink having a role in regulating the concentration of equal in vivo and being capable of taking for a long time with high safety and provide a selective medium for a microorganism having conversion ability to... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, P.C.

20090253644 - Radiosensitizer:

20090253645 - Methods and materials for treating and preventing inflammation of mucosal tissue: The invention involves methods and materials for treating and preventing non-invasive fungus-induced mucositis. Specifically, the invention involves administrating an antifungal agent such that it contact mucus in an amount, at a frequency, and for a duration effective to prevent, reduce, or eliminate non-invasive fungus-induced rhinosinusitis. This invention also provides methods... Agent: Fish & Richardson P.C.

20090253646 - Pan-selectin inhibitor with enhanced pharmacokinetic activity: Compounds, compositions and methods are provided for treatment of diseases or complications associated therewith, in which a selectin plays a role. More specifically, particular glycomimetics and uses thereof are described. For example, use of particular glycomimetics for treating sickle cell disease or a cancer involving a selectin, or complications associated... Agent: Seed Intellectual Property Law Group PLLC

20090253775 - Compositions and methods for therapy and diagnosis of cancer and cancer metastasis: The present invention relates to methods which make possible to assess and/or prognose a cancer disease, the metastatic behaviour of a cancer disease and/or the occurrence of a relapse of cancer. In particular, the methods of the invention make possible to assess and/or prognose the occurrence of cancer metastasis, in... Agent: Mcandrews Held & Malloy, Ltd

20090253771 - Inhibition of gliotoxin: The present invention relates to the inhibition of the interaction between Gliotoxin (GT) and its intracellular target for the prevention and/or treatment of fungal infections. Further, novel methods and systems for identifying antifungal agents are disclosed.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20090253769 - Inhibitors of mammalian hdac 11 useful for treating hdac 11 mediated disorders: The present invention, relies, in part, on the discovery of the role of HDAC 11 in various cell proliferative disorders including cancer. In the main, the invention provides for methods of inhibiting HDAC 11 as a means of treating cell proliferative disorders. Reagents for use in inhibiting human HDAC 11... Agent: Merck And Co., Inc

20090253772 - Rna interference mediated inhibition of cxcr4 gene expression using short interfering nuceleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating chemokine receptor (CXCR) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways of CXCR gene expression and/or... Agent: Sirna Therapeutics, Inc.

20090253774 - Rna interference mediated inhibition of platelet derived growth factor (pdgf) and platelet derived growth factor receptor (pdgfr) gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating platelet derived growth factor (PDGF) and/or platelet derived growth factor receptor (PDGFr) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other... Agent: Sirna Therapeutics, Inc.

20090253773 - Rna interference mediated inhibition of tnf and tnf receptor gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating tumor necrosis factor and/or tumor necrosis factor receptor gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways... Agent: Sirna Therapeutics, Inc.

20090253776 - Sirna targeting gremlin: Efficient sequence specific gene silencing is possible through the use of siRNA technology. By selecting particular siRNAs by rational design, one can maximize the generation of an effective gene silencing reagent, as well as methods for silencing genes. Methods, compositions, and kits generated through rational design of siRNAs are disclosed... Agent: Kalow & Springut LLP

20090253770 - Target gene mimitin of myc: A new diagnosis or treatment of cancer is provided. The present invention provides a protein Mimitin which is a target of a cancer gene myc protein, a variant thereof and a fragment thereof, as well as a polynucleotide molecule encoding them. An inhibitory substance of biological activity of the present... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090253780 - Compositions and methods related to mir-16 and therapy of prostate cancer: The present invention concerns methods and compositions for identifying genes or genetic pathways modulated by miR-16, using miR-16 to modulate a gene or gene pathway, using this profile in assessing the condition of a patient and/or treating the patient with an appropriate miRNA.... Agent: Fulbright & Jaworski L.L.P.

20090253778 - Dna composition against tumor stromal antigen fap and methods of use thereof: A DNA composition effective for eliciting an immune response against tumor cells and tumor metastases comprising a DNA construct that encodes for at least one epitope of fibroblast activation protein (FAP), which is expressible in immune cells, and which is incorporated in a pharmaceutically acceptable carrier. The composition can encode... Agent: Olson & Cepuritis, Ltd.

20090253779 - Expression of rbap48 in memory and aging and methods related thereto: This invention provides a method for increasing the expression of RbAp48 protein in a eukaryotic cell comprising introducing into the cell an agent which specifically increases the expression of RbAp48 protein in the cell. This invention also provides a method for treating a subject afflicted with age-related memory decline comprising... Agent: Cooper & Dunham, LLP

20090253777 - Methods of diagnosing and treating hyperproliferative disorders: The invention relates to compositions and methods for diagnosing and treating hyperproliferative disorders using ligands which specifically recognize the hypusine and/or folate binding region of mature eukaryotic translation initiation factor 5A (hypusine-containing eIF-5A). The invention further relates to methods of identifying molecules which displace immunoreagents binding to mature eIF-5A. Such... Agent: Klauber & Jackson

20090253647 - 2-propynyl adenosine analogs with modified 5'-ribose groups having a2a agonist activity: e

20090253648 - Tricyclic-nucleoside compounds for treating viral infections: Disclosed are compounds represented by formulae I, II, and III, and the compositions and methods thereof for treating viral infections caused by a Flaviviridae family virus.... Agent: Dority & Manning, P.A.

20090253649 - Agents containing folic acid, vitamin b6 and vitamin b12, and the use thereof: (EN) The invention relates to agents that contain folic acid, vitamin B6 and vitamin B12. and to the use thereof in hyperhomocysteinemia for controlling homocysteine levels. The agents are mainly suitable for the preventive and acute treatment of vascular diseases, of pregnant women and neurodegenerative diseases and are particularly advantageous... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, P.C.

20090253651 - Drug delivery system based on regioselectively amidated hyaluronic acid: New drug delivery systems (DDS) are described containing hyaluronic acid and a therapeutic agent, wherein the therapeutic agent is linked, directly or via a linker, to 6-aminohyaluronic acid and where the linkage of the drug or linker with 6-aminohyaluronic acid is realised by an amide bond. Preferred therapeutic agents for... Agent: Christensen, O'connor, Johnson, Kindness, PLLC

20090253650 - Teat antiseptic prepared from polysaccharide gel with bactericidal and immuno-stimulating activity isolated from durian fruit-rind: A teat antiseptic having bactericidal activity against bacteria causing bovine mastitis. A post-milking teat dip and teat seal were prepared using polysaccharide gel with bactericidal, immuno-stimulating and wound healing activity isolated from durian fruit rind as active ingredient.... Agent: Dr. S. Pongsamart Faculty Of Pharmaceutical Sciences

20090253652 - Phosphate-binding chitosan and uses thereof: The present invention provides compositions and methods for removing phosphate from a subject using chitosan. The present invention also provides compositions and methods for treating hyperphosphatemia based on phosphate-binding chitosan.... Agent: Choate, Hall & Stewart LLP

20090253653 - Analogs of benzoquinone-containing ansamycins and methods of use thereof: The present invention provides analogs of benzoquinone-containing ansamycins and uses thereof for treating and modulating disorders associated with hyperproliferation, such as cancer. The present invention provides analogs of benzoquinone-containing ansamycins where the benzoquinone is reduced to a hydroquinone and trapped by reaction with a suitable acid, preferably ones that increase... Agent: Foley Hoag, LLP (w/ipx)

20090253654 - Cholinergic enhancers with improved blood-brain barrier permeability for the treatment of diseases accompanied by cognitive impairment: The present invention refers to compounds that, in addition to enhancing the sensitivity to acetylcholine and choline, and their exogenous agonists, of neuronal cholinergic receptors and/or acting as cholinesterase inhibitors and/or neuroprotective agents, have enhanced blood-brain barrier permeability in comparison to their parent compounds. The compounds are derived (either formally... Agent: Knobbe Martens Olson & Bear LLP

20090253655 - Quinolinone farnesyl transferase inhibitors for the treatment of synucleinopathies and other indications: e

20090253656 - Bcrp/abcg2 inhibitor:

20090253657 - Use of clodronic acid for treatment podotrochlosis: The invention describes the use of clodronic acid, its addition salts or esters as active ingredient for the preparation of a pharmaceutical for treating podotrochlosis with associated osteoporosis in horses.... Agent: The Nath Law Group

20090253658 - Fat accumulation inhibitor: A fat accumulation inhibitor for a fat cell, which comprises a milk-derived phospholipid as an active ingredient, and a food or drink for inhibiting fat accumulation in a fat cell, which comprises a milk-derived phospholipid. A visceral fat accumulation inhibitor comprising a sphingosine-containing phospholipid or a derivative thereof as an... Agent: Morgan Lewis & Bockius LLP

20090253659 - Cycloalkylidene compounds as modulators of estrogen receptor: The present invention relates to novel compounds with a variety of therapeutic uses, more particularly novel substituted cyclic alkylidene compounds that are particularly useful for selective estrogen receptor modulation.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B482

20090253660 - Minocycline compounds and methods of use thereof: Methods and compositions for using a tetracycline compound to treat bacterial infections are described. In one embodiment, for example, the invention provides a method of treating a subject for an infection, comprising administering to said subject an effective amount of 9-[(2,2-dimethyl-propyl amino)-methyl]-minocycline or a salt thereof, such that said subject... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20090253661 - Ocular agents: A method to reduce or ameliorate an ocular condition, such as ocular scarring that may occur after ocular surgery or another non-surgical ocular inflammatory or other condition, by topically administering doxycycline as the sole active agent to a patient in need thereof under conditions to reduce or ameliorate the ocular... Agent: Thompson Hine L.L.P. Intellectual Property Group

20090253664 - Combination andolast/glucocorticoids: The invention relates to the combination of Andolast, a calcium-activated potassium channel opener and glucocorticoids for the treatment of patients suffering for airway diseases. Pharmaceutical compositions comprising Andoalst and glucocorticoids are also disclosed.... Agent: Sughrue Mion, PLLC

20090253662 - Genetic risk assessment in heart failure: impact of genetic variation of aldosterone synthase promoter polymorphism: The invention provides methods for (a) reducing mortality associated with heart failure; (b) improving oxygen consumption; (c) treating heart failure; (d) treating hypertension; (e) improving the quality of life in a heart failure patient; (f) inhibiting left ventricular remodeling; (g) reducing hospitalizations related to heart failure; (h) improving exercise tolerance;... Agent: Wilmerhale/nitromed

20090253665 - Method of treatment of disease using an adenosine a1 receptor antagonist and an aldosterone inhibitor: Pharmaceutical compositions comprising an aldosterone inhibitor and an adenosine A1 receptor antagonist (AA1RA) and methods of treating cardiovascular disease comprising identifying a patient in need of such treatment, and administering a pharmaceutical composition disclosed herein to said patient are disclosed.... Agent: Merck And Co., Inc

20090253663 - Skin external preparation containing triterpenic acid: Disclosed is a skin external preparation containing a triterpenic acid typified by ursolic acid. For obtaining a skin external preparation having excellent storage stability by improving the dissolution stability of the triterpenic acid and the like, 4-alkylresorcinol such as 4-n-butylresorcinol is added into a skin external preparation containing a triterpenic... Agent: Knobbe Martens Olson & Bear LLP

20090253666 - Composition comprising sarsasapogenin: The présent invention relates to a composition comprising sarsasapogenin or a plant extract containing it in order to improve the gêneral state of the skin and in particular to improve and/or embellish any part of the body showing a déficit in lipids. More particularly, the invention is directed to a... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20090253667 - 18 ,21-didesoxymacbecin derivatives for the treatment of cancer: The present invention relates to 18,21-didesoxymacbecin analogues that are useful, e.g. in the treatment of cancer, B-cell malignancies, malaria, fungal infection, diseases of the central nervous system and neurodegenerative diseases, diseases dependent on angiogenesis, autoimmune diseases and/or as a prophylactic pre-treatment for cancer. The present invention also provides methods for... Agent: Dann, Dorfman, Herrell & Skillman

20090253668 - Hair loss prevention by natural amino acid and peptide complexes: This invention relates to certain skin and hair care agents of formula (I), derived from natural amino acids and peptides. These agents provide multi-functional treatment of enzyme-related skin, hair and scalp problems, for example, hair aging including premature hair loss and hair graying; male pattern baldness; hair loss from dandruff;... Agent: Shyam K. Gupta Bioderm Research

20090253670 - Amide derivatives as positive allosteric modulators and methods of use thereof: The invention relates to novel amide derivatives that are positive allosteric modulators of neuronal nicotinic receptors, compositions comprising the same, processes for preparing such compounds, and methods for using such compounds and compositions.... Agent: Paul D. Yasger Abbott Laboratories

20090253669 - Substituted sulfonamide compounds: e

20090253672 - Cathepsin cysteine protease inhibitors: This invention relates to a novel class of compounds, represented by the formula (I) below, wherein the meanings of R1, R2, R3, R4, R5, R6, R7, X and Y are indicated therein, which are cysteine protease inhibitors, including but not limited to, inhibitors of cathepsms K L, S and B... Agent: Merck And Co., Inc

20090253675 - Pharmaceutical formulation: The instant invention provides a pharmaceutical composition comprised of a cholesterol absorption inhibitor and an HMG-CoA reductase inhibitor, one or more anti-oxidants, microcrystalline cellulose, hydroxypropyl methylcellulose, magnesium stearate and lactose. The composition need not contain ascorbic acid in order to obtain desirable stability.... Agent: Foley And Lardner LLP Suite 500

20090253676 - Heteroaryl benzamide derivatives for use as glk activators in the treatment of diabetes: e

20090253677 - Hiv integrase inhibitors: The disclosure generally relates to the novel compounds of formula I, including their salts, which inhibit HIV integrase and prevent viral integration into human DNA. This action makes the compounds useful for treating HIV infection and AIDS. The invention also encompasses pharmaceutical compositions and methods for treating those infected with... Agent: Louis J. Wille Bristol-myers Squibb Company

20090253673 - Substituted pyrazoles as ghrelin receptor antagonists: Certain novel N-acylated spiropiperidine derivatives are ligands of the human ghrelin receptor(s) and, in particular, are antagonists/inverse agonists of the human ghrelin receptor. They are therefore useful for the treatment, control, or prevention of diseases and disorders responsive to the modulation of the ghrelin receptor, such as obesity, diabetes, and... Agent: Merck And Co., Inc

20090253674 - Substituted triazole derivatives as oxytocin antagonists: The present invention relates to substituted triazoles of formula (I), uses thereof, processes for the preparation thereof and compositions containing said compounds. These inhibitors have utility in a variety of therapeutic areas including sexual dysfunction.... Agent: Pfizer Inc. Patent Department

20090253671 - Tricyclic derivatives of azetidine and pyrrole with antibacterial activity: Compounds of formula (I) and their pharmaceutically acceptable salts are described. Processes for their preparation, pharmaceutical compositions containing them, their use as medicaments and their use in the treatment of bacterial infections are also described.... Agent: Astrazeneca R&d Boston

20090253678 - Macrocyclic pyrimidine derivatives: Macrocyclic pyrimidine compounds, compositions comprising such compounds, methods for making the compounds, and methods of treating and preventing the progression of diseases, conditions, and disorders using such compounds and compositions are described herein.... Agent: Paul D. Yasger Abbott Laboratories

20090253679 - New imidazolone derivatives, preparation thereof as drugs, pharmaceutical compositions, and use thereof as protein kinase inhibitors, in particular cdc7: c

20090253680 - Selected cgrp-antagonists, processes for preparing them and their use as pharmaceutical compositions: wherein R1, R2, R3 and R4 are defined as in claim 1, the tautomers, the isomers, the diastereomers, the enantiomers, the hydrates thereof, the mixtures thereof and the salts thereof and the hydrates of the salts thereof, particularly the physiologically acceptable salts thereof with inorganic or organic acids or bases,... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation

20090253681 - Hiv integrase inhibitors: Compounds of Formula I are inhibitors of FHV integrase and inhibitors of FHV replication (I), wherein m, n, X, R1, R2, R3, R4, R5, R6, R7; R8, R9 and R10 are defined herein. The compounds are useful for the prophylaxis or treatment of infection by HTV and the prophylaxis, treatment,... Agent: Merck And Co., Inc

20090253682 - Heterocyclic derivatives for modulation of calcium channels: Heterocyclic derivatives act as Ca channel antagonists. The compositions are useful for treating or relieving Ca channel mediated conditions.... Agent: Vertex Pharmaceuticals Inc.

20090253683 - 7-membered ring compound and method of production and pharmaceutical application thereof: t

20090253684 - Leukotriene b4 inhibitors:

20090253685 - Product comprising at least one cdc25 phosphatase inhibitor in combination with at least one other anti-cancer agent:

20090253686 - Unsolvated benzodiazepine compositions and methods: The present invention relates to systems and methods for generating new forms of benzodiazepine and benzodiazepine related compounds as well as new compounds and formulations generated by such methods. In particular, the present invention provides high throughput systems and methods for generating and identifying new crystalline benzodiazepine and benzodiazepine related... Agent: Casimir Jones, S.c.

20090253687 - Fused heterocyclic compounds and their use as mineralocorticoid receptor ligands: The present invention relates to wherein each symbol is as defined in the specification. The compound has a superior mineral corticoidreceptorantagonistic action and is useful as an agent for the prophylaxis or treatment of hypertension, cardiac failure and the like, a compound having a fused heterocycle, or a prodrug thereof,... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090253688 - Semicarbazide derivatives as kinase inhibitors: The present invention relates to semicarbazide derivatives of formula I, the use of the compounds of formula I as inhibitors of one or more kinases, the use of the compounds of formula I for the manufacture of a pharmaceutical composition and a method of treatment, comprising administering said pharmaceutical composition... Agent: Arent Fox LLP

20090253689 - Organic compounds: e

20090253690 - Pharmaceutically effective compounds: The subject invention relates to carboxamidine derivatives, to pharmaceutical compositions containing the carboxamidine derivatives of the invention, and the use thereof for the treatment of vascular diseases and in the preparation of pharmaceutical compositions for the treatment of vascular diseases.... Agent: Ropes & Gray LLP

20090253693 - 2h-benzo[b][1,4]oxazin-3(4h)-one derivatives for use as stearoyl coa desaturase inhibitors: e

20090253692 - Crystalline form of n-[[4-fluoro-2-(5-methyl-1h-1,2,4-triazol-1-yl)phenyl]methyl]-4,6,7,9-tetrahydro-3-hydroxy-9,9-dimethyl-4-oxo-pyrimido[2,1-c][1,4]oxazine-2-carboxamide, sodium salt monohydrate: Disclosed is a crystalline form of N-[[4-fluoro-2-(5-methyl-1H-1,2,4-triazol-1-yl)phenyl]methyl]-4,6,7,9-tetrahydro-3-hydroxy-9,9-dimethyl-4-oxo-pyrimido[2,1-c][1,4]oxazine-2-carboxamide, sodium salt monohydrate. Also disclosed are at least one pharmaceutical composition comprising at least one crystalline form of N-[[4-fluoro-2-(5-methyl-1H-1,2,4-triazol-1-yl)phenyl]methyl]-4,6,7,9-tetrahydro-3-hydroxy-9,9-dimethyl-4-oxo-pyrimido[2,1-c][1,4]oxazine-2-carboxamide, sodium salt monohydrate, and at least one method of using at least one crystalline form of N-[[4-fluoro-2-(5-methyl-1H-1,2,4-triazol-1-yl)phenyl]methyl]-4,6,7,9-tetrahydro-3-hydroxy-9,9-dimethyl-4-oxo-pyrimido[2,1-c][1,4]oxazine-2-carboxamide, sodium salt monohydrate to treat AIDS or... Agent: Louis J. Wille Bristol-myers Squibb Company

20090253691 - Trisubstituted 1,2,4-triazoles: s

20090253694 - Fused hetrocyclic compounds: This invention provides fused heterocyclic compounds, pharmaceutical compositions of the compounds, and methods of using the compounds for the treatment of, inter alia, IL-12 related disease and disorders.... Agent: Edwards Angell Palmer & Dodge LLP

20090253695 - Hydroxyalkyl substituted imidazonaphthyridines: Certain imidazonaphthyridines with a hydroxymethyl or hydroxyethyl substituent at the 2-position, pharmaceutical compositions containing the compounds, intermediates, methods of making and methods of use of these compounds as immunomodulators, for preferentially inducing IFN-α biosynthesis in animals and in the treatment of diseases including viral and neoplastic diseases are disclosed.... Agent: Wolf Greenfield & Sacks, P.C.

20090253696 - Substituted pyrido(3,2-d) pyrimidines and pharmaceutical compositions for treating viral infections: This invention provides di-, tri- and tetra-substituted pyrido(3,2-d)pyrimidine derivatives with specific substituting patterns, their pharmaceutically acceptable salts, N-oxides, solvates, pro-drugs and enantiomers, possessing unexpectedly desirable pharmaceutical properties, in particular being highly active antiviral agents. The invention also provides use of such derivatives in the treatment of viral infections and pathologic... Agent: Clark & Elbing LLP

20090253697 - Novel indole derivatives, preparation thereof as medicinal products and pharmaceutical compositions, and especially as kdr inhibitors: i

20090253698 - Brain, spinal and nerve injury treatment: A treatment for brain, spinal and nerve injury comprising use of a substance P receptor antagonist optionally in combination with a magnesium compound. There is also provided a formulation for use in this treatment comprising a substance P receptor antagonist and a magnesium compound.... Agent: Hoffmann-la Roche Inc. Patent Law Department

20090253699 - Compounds for nonsense suppression, and methods for their use: The present invention relates to methods, compounds, and compositions for treating or preventing diseases associated with nonsense mutations in an mRNA by administering the compounds or compositions of the present invention. More particularly, the present invention relates to methods, compounds, and compositions for suppressing premature translation termination associated with a... Agent: Hoffmann & Baron, LLP

20090253700 - N-'4-4(4-morpholinyl) phenyl!- '(4-piperidinyl) methyl! carboxamide derivatives and their use as glycine transporter inhibitors: e

20090253701 - Organic compounds: and the salts thereof, having renin-inhibiting properties. Also disclosed are pharmaceutical compositions comprising these compounds and methods of administering them for the treatment of hypertension, atherosclerosis, unstable coronary syndrome, congestive heart failure, cardiac hypertrophy, cardiac fibrosis, cardiomyopathy postinfarction, unstable coronary syndrome, diastolic dysfunction, chronic kidney disease, hepatic fibrosis, complications resulting... Agent: Novartis Institutes For Biomedical Research, Inc.

20090253702 - Fast acting naratriptan composition: The present invention relates to pharmaceutical compositions containing Naratriptan, a compound selected from the group consisting of 2-HPOD, 2-HPHM, 4-PPED, 4-BPED and 2-PPED, and optionally, a pharmaceutically acceptable excipient.... Agent: Emisphere Technologies, Inc

20090253703 - Organic compounds: and the salts thereof, having renin-inhibiting properties. Also disclosed are pharmaceutical compositions comprising these compounds and methods of administering them for the treatment of hypertension, atherosclerosis, unstable coronary syndrome, congestive heart failure, cardiac hypertrophy, cardiac fibrosis, cardiomyopathy postinfarction, unstable coronary syndrome, diastolic dysfunction, chronic kidney disease, hepatic fibrosis, complications resulting... Agent: Novartis Institutes For Biomedical Research, Inc.

20090253704 - Pyrrolotriazinone derivatives for use as stearoyl coa desaturase inhibitors: d

20090253705 - Hydroxymethyl pyrrolidines as beta 3 adrenergic receptor agonists: The present invention provides compounds of Formula (I), pharmaceutical compositions thereof, and method of using the same in the treatment or prevention of diseases mediated by the activation of β3-adrenoceptor.... Agent: Merck And Co., Inc

20090253706 - Methods and compositions for the treatment of rheumatoid arthritis and other inflammatory diseases: Compositions and methods for the treatment of inflammatory diseases are disclosed.... Agent: Dann, Dorfman, Herrell & Skillman

20090253707 - Heteroannelated anthraquinone derivatives and the synthesis method thereof: wherein R1 is a substituent being one selected from a group consisting of i) a first substituent being one selected from a group consisting of a hydryl group, an amino group, a nitro group, a hydroxyl group and a cyan group, ii) a second substituent being one selected from a... Agent: Volpe And Koenig, P.C.

20090253708 - 2-alkynyl-6-pyridin-2-yl-pyridazinones, 2-alkynyl-6-pyridin-2-yl-dihydropyridazinones, 2-alkynyl-6-pyrimidin-2-yl-pyridazinones and 2-alkynyl-6-pyrimidin-2-yl-dihydropyridazinones and their use as fungicides: This invention relates to certain novel 2-alkynyl-6-pyridin-2-yl-pyridazinones, 2-alkynyl-6-pyridin-2-yl-dihydropyridazinones, 2-alkynyl-6-pyrimidin-2-yl-pyridazinones and 2-alkynyl-6-pyrimidin-2-yl-dihydropyridazinones and to the use of these compounds for control of fungal pathogens of plants and mammals.... Agent: Dow Agrosciences LLC

20090253709 - Synthesis, telomerase inhibition and cytotoxic studies on 2,7-disubstituted anthraquinone derivatives: R is a first substituted group selected from a group consisting of a hydrogen, an amino group, a nitro group, a hydroxyl group, a C1-C12 alkyl group, a C1-C12 alkyl halide group (—(CH2)nX), a C3-C12 cycloalkyl group, a benzyl group, a C1-C12 alkylamino group, a C5-C12 nitrocycloalkyl group and a... Agent: Volpe And Koenig, P.C.

20090253710 - Nmda receptor antagonists for neuroprotection: each (L)k-Ar1 is a substituted or unsubstituted, mono or bicyclic aryl or heteroaryl; W is a bond, alkyl, or alkenyl; X is a bond, NR1 or O and each R1 and R2 is independently H, alkyl, alkenyl or aralkyl or R1 and R2 taken together form a 5-8 membered ring;... Agent: King & Spalding LLP

20090253711 - Heterocyclyl-3-sulfonylindazoles as 5-hydroxytryptamine-6 ligands: The present invention provides a compound of formula I and the use thereof in the therapeutic treatment of disorders related to or affected by the 5-HT6 receptor.... Agent: Wyeth Patent Law Group

20090253712 - Aqueous solvent system for solubilization of azole compounds: e

20090253713 - Small molecule compositions for sexual dysfunction: or a pharmaceutically acceptable salt thereof, wherein R1, R2, R3, and X are as defined. Further provided are methods for treatment of sexual dysfunction, including erectile dysfunction and female sexual dysfunction, and combination drugs and method of use thereof, including a compound of the invention and one or more second... Agent: Palatin Technologies, Inc.

20090253714 - Methods of reducing risk of infection from pathogens: Prophylactic treatment methods are provided for protection of individuals and/or populations against infection from airborne pathogens. In particular, prophylactic treatment methods are provided comprising administering amiloride, benzamil, phenamil or pharmaceutically acceptable salts thereof to one or more members of a population at risk of exposure to or already exposed to... Agent: Brinks, Hofer, Gilson & Lione

20090253715 - Heteroaryl-containing isoflavones as aromatase inhibitors: wherein X is selected from O, N, S, SO, SO2, and S(CH2)n, wherein n=1-10; R1 and R2 may be the same or different and are selected from H, OH, OCH3, OCH2CH3, OCH2C6H5, NH2, NHCH3, N(CH3)2, CH3, CH2CH3, CH2CH2CH3, CH(CH3)2, C(CH3)3, NO2, F, Cl, Br, CF3, SH, SCH3, SCH2CH3, OCOCH3, OCOC(CH3)3,... Agent: Calfee Halter & Griswold, LLP

20090253716 - Amino-imidazolones for the inhibition of beta-secretase: e

20090253717 - Inhibitors of p97: One aspect of the invention relates to compounds that inhibit the activity of p97, such as by binding covalently to a cysteine residue in the active site. In certain embodiments, the invention relates to the treatment of disease, such as cancer, comprising administering a compound of the invention.... Agent: Ropes & Gray LLP

20090253718 - Pharmaceutical compounds: or salts, solvates, tautomers or N-oxides thereof, wherein T is N or CR5; J1-J2 is N═C(R6), (R7)C═N, (R8)N—C(O), (R8)2C—C(O), N═N or (R7)C═C(R6); A is an optionally substituted saturated C1-7 hydrocarbon linker group having a maximum chain length of 5 atoms extending between R1 and NR2R3 and a maximum chain length... Agent: Heslin Rothenberg Farley & Mesiti PC

20090253720 - Antifolate compositions: The present invention provides pharmaceutical compositions comprising an antifolate compound. The composition exhibit improved bioavailability, and they particularly incorporate beneficial excipients that increase solubility and bioavailability, such as cyclodextrins or compounds formed of fatty acid esters of glycerol and polyethylene glycol esters. The pharmaceutical compositions are useful in the treatment... Agent: Alston & Bird LLP

20090253721 - Combined treatment with radiation and an epidermal growth factor receptor kinase inhibitor: The present invention provides a method for treating tumors or tumor metastases in a patient, comprising administering to the patient a therapeutically effective amount of an EGFR kinase inhibitor, combined with treating the patient simultaneously or sequentially with radiation therapy, with or without additional agents or treatments, such as other... Agent: Osi Pharmaceuticals, Inc.

20090253719 - Crystalline salt forms of antifolate compounds and methods of manufacturing thereof: The present invention provides methods of preparing antifolate compounds. The inventive methods can particularly be use for preparing compounds exhibiting improved bioavailability, making the compound particularly useful in pharmaceutical compositions. The compounds prepared according to the inventive methods are useful in the treatment of multiple conditions, including abnormal cell proliferation,... Agent: Alston & Bird LLP

20090253722 - Aqueous pharmaceutical formulation: The invention concerns a stable aqueous pharmaceutical composition comprising 5-[(2RS)-2-cyclopropyl-7,8-dimethoxy-2H-1-benzopyran-5-ylmethyl]-pyrimidine-2,4-diamine in form of the water soluble methanesulfonic acid salt, a physiological sodium chloride solution, ethanol and Povidone 12 PF, the liquid having a pH of over and above 4.8, but not higher than 5.2, and wherein the oxygen amount is... Agent: Dickstein Shapiro LLP

20090253723 - Protein kinase inhibitors: Compounds that inhibit protein kinases, compositions containing the compounds and methods of treating diseases using the compounds are disclosed.... Agent: Paul D. Yasger Abbott Laboratories

20090253724 - Therapeutic or prophylactic agent for leukemia: A therapeutic or prophylactic agent for leukemia is disclosed. The therapeutic or prophylactic agent comprises as an effective ingredient a glycine derivative having a specific structure or a pharmaceutically acceptable salt thereof, for example, the below-described compound [(E)-2-(2,6-dichlorobenzamido)-5-[4-(isopropyl-pyrimidin-2-ylamino)phenyl]pent-4-enoic acid]. The therapeutic or prophylactic agent for leukemia according to the present... Agent: Darby & Darby P.C.

20090253725 - Acetyl coa carboxylase inhibitors: t

20090253727 - Nociceptin analogs:

20090253726 - Tri-, tetra-substituted-3-aminopyrrolidine derivative: A quinolone synthetic antibacterial agent and a therapeutic agent for an infection which exhibit broad spectrum and strong antibacterial activity for both Gram positive and Gram negative bacteria, and which are also highly safe are provided. The compound provided is represented by formula (I):... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, P.C.

20090253729 - Analgesic agent: A pharmaceutical preparation useful for alleviating or treating a pain, e.g., a chronic pain (particularly, a neuropathic pain) is provided. The pharmaceutical preparation contains (a) a propionic acid-derived nonsteroidal anti-inflammatory agent (e.g., ibuprofen), (b) a non-pyrazolone antipyretic analgesic agent (e.g., acetaminophen), and (c) an opioid analgesic agent (e.g., codeine phosphate,... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090253730 - Method and composition for deterring abuse of opioid containing dosage forms: This invention relates to an abuse deterrent dosage form of opioid analgesics, wherein an analgesically effective amount of opioid analgesic is combined with a polymer to form a matrix.... Agent: Morgan, Lewis & Bockius LLP

20090253728 - Methods and compositions for treating nociceptive pain: The present invention provides methods and compositions useful for the treatment and prevention of pain.... Agent: Adamas Pharmaceuticals, Inc.

20090253731 - Method of identifying therapeutic agents: The present invention relates to a method of identifying agents suitable for use in treating epilepsy and other brain disorders, including but not limited to bipolar disorder, schizophrenia and depression. The invention further relates to methods of treatment based on the use of agents so identifiable.... Agent: Nixon & Vanderhye, PC

20090253732 - Production of polyketides and other natural products: The present invention relates to production of polyketides and other natural products and to libraries of compounds and individual novel compounds. Therefore in aspect the present invention provides 17-desmethylrapamycin and analogues thereof, methods for their production, including recombinant strains, and isolation and uses of the compounds of the invention. In... Agent: Wyeth Patent Law Group

20090253733 - Rapamycin carbonate esters: Certain embodiments include carbonate esters of rapamycin at position 42 that are synthesized by a lipase catalyzed regio-specific process. These compounds or a pharmaceutically acceptable salt thereof are useful in the treatment of organ and tissue transplant rejection, autoimmune disease, proliferative disorder, restenosis, cancer, or microbial infection.... Agent: Dardi & Associates, PLLC

20090253734 - Inhibitors of akt activity: The instant invention provides for substituted naphthyridine compounds that inhibit Akt activity. In particular, the compounds disclosed selectively inhibit one or two of the Akt isoforms. The invention also provides for compositions comprising such inhibitory compounds and methods of inhibiting Akt activity by administering the compound to a patient in... Agent: Merck And Co., Inc

20090253735 - 2-aryl-6-phenylimidazo[1,2-a]pyridine derivatives, preparation thereof and therapeutic use thereof: e

20090253736 - Azaindole derivatives as cftr modulators: The present invention relates to modulators of ATP-Binding Cassette (“ABC”) transporters or fragments thereof, including Cystic Fibrosis Transmembrane Conductance Regulator (“CFTR”), compositions thereof, and methods therewith. The present invention also relates to methods of treating ABC transporter mediated diseases using such modulators.... Agent: Vertex Pharmaceuticals Inc.

20090253737 - Certain chemical entities, compositions, and methods: Provided are certain chemical entities, and methods of use to modulate skeletal myosin, skeletal actin, skeletal tropomyosin, skeletal troponin C, skeletal troponin I, skeletal troponin T, and skeletal muscle, including fragments and isoforms thereof, as well as the skeletal sarcomere, and methods of use in the treatment of neuromuscular disorders,... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20090253738 - Triazolopyridinone derivatives for use as stearoyl coa desaturase inhibitors: o

20090253739 - Amine derivatives:

20090253741 - Alkene piperidine derivatives as antiviral agents: This disclosure provides compounds having drug and bio-affecting properties, their pharmaceutical compositions and method of use. In particular, the disclosure is concerned with alkene piperidine derivatives that possess unique antiviral activity. More particularly, the present disclosure relates to compounds useful for the treatment of HIV and AIDS.... Agent: Louis J. Wille Bristol-myers Squibb Company

20090253740 - Substituted n-bicyclicalkyl bicycliccarboxyamide compounds: This invention provides a compound of the formula (I): And their use for the treatment of disease conditions caused by overactivation of the VR1 receptor such as pain, or the like in mammal. This invention also provides a pharmaceutical composition comprising the above compound.... Agent: Pfizer Inc. Patent Department

20090253742 - Marasmius androsaceus l.es fr extract, piperidone derivative, and their use for the preparation of antihypertensives: The present invention relates to Marasmius androsaceus L.es Fr extract, a compound of formula I, or pharmaceutically acceptable salts thereof, and to methods for their preparation, pharmaceutical composition comprising the same as well as use of the extract or the compound in the preparation of a medicament for the prevention... Agent: Alston & Bird LLP

20090253743 - Compositions of tolperisone: The present disclosure is directed to methods for providing tolperisone having extremely low levels of 4-MMPPO (2-methyl-1-(4-methylphenyl)-propenone), as well as related compositions. The invention further relates to methods of treating a subject with tolperisone under conditions that limit exposure of the subject to tolerable levels of 4-MMPPO, among other features.... Agent: King & Spalding LLP

20090253744 - Acylated piperidine derivatives as melanocortin-4 receptor modulators: Certain novel N-acylated spiropiperidine derivatives are ligands of the human melanocortin receptor(s) and, in particular, are selective ligands of the human melanocortin-4 receptor (MC-4R). They are therefore useful for the treatment, control, or prevention of diseases and disorders responsive to the modulation of MC-4R, such as obesity, diabetes, nicotine addiction,... Agent: Merck And Co., Inc

20090253745 - Modulators of ocular oxidative stress: Described herein are compounds, compositions and methods directed to the treatment of ophthalmic conditions characterized by oxidative stress or damage in a subject by reducing the reactive oxygen species in the subject. Also described herein are methods for reducing ophthalmic photooxidative damage in a subject.... Agent: Wilson Sonsini Goodrich & Rosati

20090253746 - Synthesis and preparations of intermediates and new polymorphs thereof useful for the preparation of donepezil hydrochlcoride: The invention relates to an improved process for preparing 2-(1-benzylpiperidin-4-ylmethyliden)-5,6-dimethoxyin-dan-1-one (a key intermediate in the synthesis of donepezil hydrochloride), crystalline polymorph forms of this key intermediate and their use thereof for producing donepezil hydrochloride. In particular, the invention provides an improved method for producing the intermediate 2-(1-benzylpiperidin-4-ylmethyliden)-5,6-dimethoxyindan-1-one. The process includes... Agent: Hogan & Hartson LLPIPGroup, Columbia Square

20090253747 - Remedy for sleep disturbance: The present invention has been made based on the finding that a compound acting on the ORL-1 receptor as an agonist acts as a non-photic entrainment factor, and advances the circadian rhythm phase, and provides a novel therapeutic agent for a sleep disorder such as circadian rhythm sleep disorder, more... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090253748 - Process for the preparation of pleuromutilins: A process for the preparation of 14-O-[(N-(3-methyl-2-amino-butyryl-piperidinyl)sulfanyl) acetyl]mutilins of formula (I) feasible for large-scale production of high purity products, and wherein the carbon atom at the piperidine ring attached to the sulphur atom is either in the (S)-configuration or in the (R)-configuration, and a new crystalline form of 14-O-[(N-3-methyl-2-(R)-amino-butyryl-piperidine-3(S)-yl)sulfanyl)acetyl]mutilin-hydrochloride.... Agent: Workman Nydegger 1000 Eagle Gate Tower

20090253749 - Substituted enaminocarbonyl compounds: The present invention relates to novel substituted enaminocarbonyl compounds, to processes for their preparation and to their use for controlling animal pests, especially arthropods, in particular insects.... Agent: Baker Donelson Bearman, Caldwell & Berkowitz, PC

20090253750 - 3-indazolyl-4-pyridylisothiazoles: The present invention provides 3-indazoyl-4-pyridylisothiazoles or a pharmaceutically acceptable salt thereof, pharmaceutical compositions thereof, and methods of using the same, as well as processes for preparing the same, and intermediates thereof.... Agent: Eli Lilly & Company

20090253751 - Hydrazide compound and thrombopoietin receptor activator: e

20090253752 - Combination of dpp-iv inhibitor, ppar antidiabetic and metmorfin: for simultaneous, separate or sequential use, especially in the prevention, delay of progression or treatment of conditions mediated by dipeptidylpeptidase-IV (DPP-IV), in particular diabetes, more particular type 2 diabetes mellitus, conditions of impaired glucose tolerance (IGT), conditions of impaired fasting plasma glucose, metabolic acidosis, ketosis, arthritis, obesity and osteoporosis; the... Agent: Novartis Corporate Intellectual Property

20090253753 - Therapeutic use of acylaminothiazole derivatives: r

20090253754 - Fast dissolving films and coatings for controlled release of flavors, active pharmaceutical ingredients, food substances, and nicotine: A fast-dissolving film for use as a platform for the delivery of material to the oral cavity, comprising a film forming agent; a plasticizing agent; and a fast-dissolving, water-soluble agent; and methods for producing same.... Agent: Krieg Devault LLP

20090253755 - N-[(pyridin-2-yl) methoxy] benzamide derivatives and related compounds as fungicides: f

20090253756 - Indole amide derivatives as ep4 receptor antagonists: The invention is directed to indole amide derivatives as EP4 receptor antagonists useful for the treatment of EP4 mediated diseases or conditions, such as acute and chronic pain, osteoarthritis, rheumatoid arthritis and cancer. Pharmaceutical compositions and methods of use are also included.... Agent: Merck And Co., Inc

20090253757 - Plant protection agents: e

20090253758 - Selective androgen receptor modulators: This invention provides compounds of formulas I, Ia, Ib, Ic, Id, Ie, and or salts thereof, pharmaceutical compositions comprising a compound of formulas I, Ia, Ib, Ic, Id, Ie, and a pharmaceutically acceptable excipient, methods of modulating the androgen receptor, methods of treating diseases beneficially treated by an androgen receptor... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20090253761 - Benzocycloheptyl analogs having sphingosine 1-phosphate receptor activity: Benzocycloheptyl analogs that have agonist activity at one or more of the S1P receptors are provided. The compounds are sphingosine analogs, which, after phosphorylation, can behave as agonists at S1P receptors.... Agent: Iplm Group, P.A.

20090253760 - Hydrindane analogs having sphingosine 1-phosphate receptor agonist activity: Hydrindane analogs that have agonist activity at one or more of the S1P receptors are provided. The compounds are sphingosine analogs, which, after phosphorylation, can behave as agonists at S1P receptors.... Agent: Iplm Group, P.A.

20090253759 - Tetralin analogs having sphingosine 1-phosphate agonist activity: Tetralin analogs that have agonist activity at one or more of the S1P receptors are provided. The compounds are sphingosine analogs, which, after phosphorylation, can behave as agonists at S1P receptors.... Agent: Iplm Group, P.A.

20090253762 - Preparation and use of aryl alkyl acid derivatives for the treatment of obesity: This invention relates to certain aryl alkyl acid compounds, compositions, and methods for treating or preventing obesity and related diseases.... Agent: Edwards Angell Palmer & Dodge LLP

20090253763 - Ester compound and its use: i

20090253764 - Use of ampk-activating imidazole derivatives, preparation process therefor and pharmaceutical compositions comprising them:

20090253765 - Angiogenesis inhibitor containing amine derivative as active ingredient: An object of the present invention is to provide an angiogenesis inhibitor. The angiogenesis inhibitor according to the present invention contains a compound represented by the following general formula [I] or a salt thereof as an active ingredient. In the formula, the ring A represents a benzene ring or a... Agent: Frishauf, Holtz, Goodman & Chick, PC

20090253766 - Thiophene derivatives as factor xia inhibitors: or stereoisomers, tautomers, pharmaceutically acceptable salts, solvates, or prodrugs thereof, wherein the variables A, L1, R3, and R11 are as defined herein. The compounds of Formula (I) are useful as selective inhibitors of serine protease enzymes of the coagulation cascade and/or contact activation system; for example thrombin, factor Xa, factor... Agent: Louis J. Wille Bristol-myers Squibb Company

20090253767 - Aminoindazolylurea derivatives: Novel aminoindazolylurea derivatives of the formula I (I), in which R1, R2, R3, R4, R5, X and Y have the meanings indicated in Claim 1, are SGK inhibitors and can be used for the treatment of SGK-induced diseases and complaints, such as diabetes, obesity, metabolic syndrome (dyslipidaemia), systemic and pulmonary... Agent: Millen, White, Zelano & Branigan, P.C.

20090253768 - Therapeutic compounds for diseases and disorders: Pyrrole derivatives are disclosed as agents for the treatment and prevention of neuropathies and neurodegenerative diseases characterized by the presence of axonal blockages, impaired axonal transport or impaired trafficking of vesicles in neurons.... Agent: Myriad Pharmaceuticals, Inc. C/o Cpa Global

20090253781 - Therapeutic compositions: These compositions may be taken as nutritional aids, for example for athletes, or for the treatment of medical conditions, particularly those associated with poor cardiac efficiency, insulin resistance and neuronal damage. The invention further provides methods of treatment and novel esters and polymers for inclusion in the compositions of the... Agent: Nixon & Vanderhye, PC

20090253782 - Compounds for enhancing arginase activity and methods of use thereof: The present invention relates to a method for enhancing arginase activity in a damaged or injured cell. In other aspects, the invention provides a method for treating a disorder that can be treated by enhancing arginase activity in a human in need thereof, the method comprising administering to the human... Agent: Irving N. Feit Hoffmann & Baron, LLP

20090253783 - Production of delta 9 tetrahydrocannabinol: The present invention provides isolated, purified Δ9 THC. In another embodiment, the invention provides pharmaceutical compositions comprising isolated, purified Δ9 THC and a pharmaceutically acceptable carrier. In another embodiment, the invention provides methods of preparing pharmaceutical compositions comprising isolated, purified Δ9 THC and a pharmaceutically acceptable carrier.... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20090253784 - Use of 3-(2,4,6-trimethylphenyl)-4-neopentylcarbonyloxy-5,5-tetramethylene- delta3-dihydrofuran-2-one for controlling diptera from the cecidomyiidae family: The present application relates to the use of 3-(2,4,6-trimethylphenyl)-4-neopentylcarbonyloxy-5,5-tetramethylene-Δ3-dihydrofuran-2-one for controlling insects from the family Cecidomyiidae.... Agent: Baker Donelson Bearman, Caldwell & Berkowitz, PC

20090253785 - Bactericide composition: A bactericide composition kills Staphylococcus aureus (S. aureus), Escherichia coli (E. coli), Methicillin-resistant Staphylococcus aureus (MRSA) and Propionibacterium acnes (P. acnes) and comprises a solvent and L-ascorbic acid. The L-ascorbic acid is dissolved in the solvent in a range of 1 wt % to 40 wt %. Ascorbic acid (vitamin... Agent: Andrews Kurth LLP

20090253787 - Short-acting sedative hypnotic agents for anesthesia and sedation: The invention provides compounds compositions and methods useful for inducing or maintaining general anesthesia or sedation in mammals.... Agent: Pepper Hamilton LLP

20090253786 - Synthesis, anti-allergic, anti-asthmatic and anti-inflammatory activities of cee-1 and cee-2: “Enhydrazone esters of formula (I): wherein R is methyl or ethyl group have been synthesized. The compounds of formula (I) are potent inhibitors of degranulation of both mast cells and eosinophils. These compounds also suppress cytokines generation by leukocytes. These biological activities are relevant to the prevention and/or treatment of... Agent: Furr Law Firm

20090253788 - Combinations of adapalene and benzoyl peroxide for treating acne lesions: Adapalene or a pharmaceutically acceptable salt thereof formulated into a pharmaceutical composition is useful for reducing the number of acne lesions, via daily topical application, in combination or in association with benzoyl peroxide (BPO); such treatment may be via administration of a pharmaceutical composition combining adapalene and BPO or by... Agent: Buchanan, Ingersoll & Rooney PC

20090253790 - Dairy composition with probiotics and anti-microbial system: Dairy compositions are provided having a high pH, of about 4.8 to about 6.2, comprising desirable probiotic cultures as well as an anti-microbial system for inhibiting undesirable pathogenic and/or spoilage microbial growth without significantly reducing the beneficial effect of the probiotic cultures.... Agent: Fitch Even Tabin & Flannery

20090253789 - Preventive/remedy for arteriosclerotic disease and method of evaluating therapeutic procedure: There is provided an evaluation method of effect of a remedy or a therapeutic procedure for atherosclerosis directly or indirectly acting on a substance having a nature of exacerbating atherosclerosis (particularly, a protein) and being present in an atherosclerotic lesion to improve the atherosclerotic lesion, which comprises performing an evaluation... Agent: Edwards Angell Palmer & Dodge LLP

20090253791 - Compositions and methods for preventing or treating inflammatory bowel disease: Compositions comprising docosahexaenoic acid (DHA) and optionally one or more fatty acids selected from the group consisting of eicosapentaenoic acid (EPA), arachidonic acid (ARA), linoleic acid (LA), and α-linoleic acid (ALA) are administered to felines for preventing or treating feline inflammatory bowel disease (IBD).... Agent: Colgate-palmolive Company

20090253792 - Active agent delivery systems and methods for protecting and administering active agents: The present invention relates to active agent delivery systems and more specifically to compositions that comprise amino acids, as single amino acids or peptides, covalently attached to active agents and methods for administering conjugated active agent compositions.... Agent: Darby & Darby P.C.

20090253793 - Composition and method for binding acetaldehyde in stomach: This invention relates to a non-toxic composition which bind acetaldehyde present in the stomach, intestine and/or colon. The composition comprises one or more acetaldehyde-binding compound(s) comprising one or more free sulphhydryl and/or amino groups. The compound(s) are mixed with a non-toxic carrier that effects sustained release of said compound(s) in... Agent: Sughrue Mion, PLLC

20090253795 - Arthroscopic irrigation solution and method for peripheral vasoconstriction and inhibiton of pain and inflammation: A method and solution for perioperatively inhibiting a variety of pain and inflammation processes during arthroscopic procedures. The solution preferably includes a vasoconstrictor that demonstrates substantial agonist activity at alpha adrenergic receptors and that is selected for peripheral (local) vasoconstriction and one or more additional pain and inflammation inhibitory agents... Agent: Omeros Medical Systems, Inc.

20090253794 - Fibroblast activator, collagen production promoter, collagen contraction promoter, hyaluronic acid production promoter, atp production promoter, melanin formation inhibitor, and agent for external application to the skin: m

20090253796 - Method for treating vascular disease: A medicament for prophylactic and/or therapeutic treatment of a vascular disease such as vascular restenosis and/or reocclusion after percutaneous transluminal coronary angioplasty using an intravascular stent, which comprises as an active ingredient a substance selected from the group consisting of retinoids and agents for controlling actions of retinoids such as... Agent: Greenblum & Bernstein, P.L.C

20090253797 - Creatine oral supplementation using creatine hydrochloride salt: Creatine oral supplementation using creatine hydrochloride salt, that may be added to a liquid or other beverage, or may be also used as an additive to solid oral dosages, or as a supplement, and which may be consumed by the athlete, or other party looking for immediate supplementation of strength,... Agent: Hanify & King Professional Corporation

20090253798 - Colchicine solid complex; methods of making; and methods of use thereof: Disclosed are new colchicine solid complexes, methods of making the solid complexes as well as formulations prepared therefrom and uses thereof.... Agent: Cantor Colburn, LLP

20090253799 - Divalent hydrazide compound conjugates for inhibiting cystic fibrosis transmembrane conductance regulator: Provided herein are divalent hydrazide-polyethylene glycol conjugates that inhibit the ion transport activity of a cystic fibrosis transmembrane conductance regulator (CFTR). The conjugates described herein are useful for treating diseases, disorders, and sequelae of diseases, disorders, and conditions that are associated with aberrantly increased CFTR activity, for example, secretory diarrhea.... Agent: Seed Intellectual Property Law Group PLLC

20090253800 - Interaction control of cationic biocides using labile anionic polyelectrolytes: Methods of inhibiting the uptake of cationic biocides into medical devices such as contact lenses and implants are described. Methods of stabilizing emulsions containing cationic biocides are also described. In particular, the present invention provides for the use of polymers acting as labile anionic polyelectrolytes to reversibly bind cationic biocides.... Agent: Alcon

20090253801 - Novel antiarrhythmic drug formulations: The present invention provides a method of achieving a novel Propafenone formulation, which will have reduced number dosings and improved bioavailability. The present invention also applies to the salt and active metabolites of the parent and pro-drug. The novel compositions are designed to release Propafenone after oral intake in a... Agent: Clements Bernard PLLC

20090253802 - Therapeutic agent for treating liver disease containing 2-amino-1,3-propanediol derivative as active ingredient, and method for treating liver disease: It has been found that a diarylsulfide or diarylether derivative having 2-amino-1,3-propanediol structure, the compound that act as a sphingosine-1-phosphate receptor agonist, and a pharmaceutically acceptable salt and hydrate thereof are used as effective therapeutic agents for various diseases in organs, in particular liver diseases. The diarylsulfide or diarylether derivative... Agent: Wenderoth, Lind & Ponack, L.L.P.

20090253803 - Memantine protects inflammation-related degeneration of dopamine neurons through inhibition of over-activated microglia and release of neurotrophic factors from astroglia: This invention discloses that memantine (MMT) protects dopamine (DA) neurons damage through its potent anti-inflammatory effect by inhibiting microglial over-activation and the protection on DA neuron is a dose-dependent response under an effective amount of lower than 10 mg/kg. This invention also discloses that NADPH oxidase plays a critical role... Agent: Wpat, PC Intellectual Property Attorneys

20090253804 - Method for treating or preventing dry eye disorders using alkylamino-polyhydroxyalkanes: Method for the treatment or prophylaxis of dry eye disorders by the administration of alkylamino-polyhydroxyalkanes and compositions thereof.... Agent: Dann, Dorfman, Herrell & Skillman

20090253805 - Photocurable thiol-ene low gas permeability membranes: The present invention provides modified multifunctional thiol-ene monomers wherein one or more thiols are reacted with a Michael addition reactive double bond compound. The present invention further discloses photocurable thiol-ene formulations comprising thiol-ene monomers including the modified multifunctional thiols. The present invention further discloses photocurable thiol-ene formulations comprising thiol-ene monomers... Agent: Howrey LLP-hn

20090253806 - Polyanhydride polymers and their uses in biomedical devices: A biocompatible, bioerodable polyanhydride polymer having a Young's modulus between about 1.5 and 3 and a selected rate of surface degradation, and methods of forming and using the polymer, are disclosed. The polymer is formed of a polyester prepolymer having a preferred molecular weight of greater than 5 and less... Agent: King & Spalding LLP

20090253807 - Aqueous suspension preparations: Addition of polyvinylpyrrolidone and a water-soluble anionic macromolecular compound to an aqueous suspension of a hardly soluble drug allows to provide an aqueous suspension in which aggregation of drug particles, formation of macro crystals from suspended particles and formation of secondary particles from deposited particles are prevented, and adhesion and... Agent: Merchant & Gould PC

20090253808 - Tri-molecular complexes and their use in drug delivery systems: This invention relates to macromolecular complexes useful in drug delivery systems, specifically tri-molecular complexes made between a water-soluble polymer and an acid-insoluble polymer in presence of a bridging molecule. In one aspect, the invention relates to a tri-molecular complex comprising gelatin, acrylic acid/methacrylic acid copolymers, and arginine for use in... Agent: Leydig Voit & Mayer, Ltd

20090253809 - Bioabsorbable elastomeric polymer networks, cross-linkers and methods of use: The invention provides elastomeric polymer networks and semi-interpenetrating networks in which a linear PEA, PEUR or PEU polymer is crosslinked by ester or alpha-amino-acid containing cross-linkers that polymerize upon exposure to active species. Bioabsorbable elastomeric internal fixation devices fabricated using such polymer networks and semi-interpenetrating networks are useful for in... Agent: Dla Piper LLP (us)

20090253810 - Osteoinductive putties and methods of making and using such putties: The present disclosure relates to osteoinductive putties and other implantable compositions for repair of bone defects and other medical uses. Specifically, the technology pertains to carriers for use in implantable compositions, such as osteoinductive putties. The osteoinductive putties are made entirely from donor tissue such as demineralized bone matrix, and... Agent: Regeneration Technologies, Inc. C/o Mcandrews, Held & Malloy

20090253811 - Manufacture process of organic compounds: The present invention relates to a method of preparing N-substituted salicylamides or derivatives thereof, and their salts, hydrates and solvates. In particular, the present invention relates to a method of preparing N-(5-chlorosalicyloyl)-8-aminocaprylic acid (5-CNAC) and its corresponding disodium monohydrate.... Agent: Novartis Corporate Intellectual Property

20090253812 - Spider esters as delivery systems: The present invention is directed to the delivery of a variety of topically active materials from a class of compounds called spider esters, which are the topic of U.S. Pat. No. 7,437,707 incorporated herein by reference. According to this first aspect of the present invention, active ingredients are delivered more... Agent: Anthony O'lenick