| Drug, bio-affecting and body treating compositions patents - Monitor Patents |
|
|
|
USPTO Class 514 | Browse by Industry: Previous - Next | All Recent | 09: Oct | Sept | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | | 08: Dec | Nov | Oct | Sp | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | | 07: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | | 06: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Drug, bio-affecting and body treating compositions inventionsRecently published patent applications awaiting approval from the USPTO. Recent week's RSS XML file available below.Listing format for abstract view: USPTO application #, Title, Abstract excerpt,Patent Agent. Listing format for list view: USPTO National Class full category number, title of the patent application. 11/12/2009 > patent applications in patent subcategories. 11/05/2009 > patent applications in patent subcategories. 20090275496 - Effective quantitation of complex peptide mixtures in tissue samples and improved therapeutic methods: The instant invention provides methods for the detection and quantitation of complex peptide mixtures in tissue samples and functional readouts of the results of administration of such complex peptide mixtures. The instant invention further provides methods for administering complex peptide mixtures to a subject in need thereof, the dosage regimen... Agent: Ropes & Gray LLP 20090275495 - Methods and compositions relating to alzheimer's disease: Methods and compositions relating to Alzheimer's disease are provided, including proteins that are differentially expressed in Alzheimer's disease as compared to the normal state. Further provided are methods, particularly experimental paradigms, for the identification of differential expressed proteins that are potential molecular targets for compounds to treat or prevent Alzheimer's... Agent: Dann, Dorfman, Herrell & Skillman 20090275497 - Method for identifying modulators of the activity of ion-channels receptors: The present invention is directed to a method for selecting or identifying a compound capable of modulating the activity of an ion-channels receptor, such as GABA receptor, by measuring the calcium influx via the P2X receptor in presence of its agonist ATP when coupled to said ion-channels receptor in recombinant... Agent: Alston & Bird LLP 20090275499 - Nonstructural protein ns1 as a novel therapeutic target against flaviviruses: The secretion or biological activity of Flaviviruses, as well as the biological activity of NS1 protein from Flavivirus-infected cells, can be inhibited by contacting the cells or the protein with cholesterol inhibitors, sphingolipid inhibitors, glycosphingolipid inhibitors, or molecules comprising an amphipathic, amphiphilic, or hydrophobic region which interacts with NS1 protein.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20090275498 - Novel peptides: The invention relates to an isolated, synthetic or recombinant χ-conotoxin peptide having the ability to inhibit a neuronal amine transporter, nucleic acid molecules encoding all or part of such peptides, antibodies to such peptides and uses and methods of treatment involving them.... Agent: Frank S. Digiglio, Esq. Scully, Scott, Murphy & Presser, P.C. 20090275500 - Peptide-containing food intake regulator: A safe and widely-applicable food intake regulator can be provided by using at least one peptide selected from the group consisting of a fish or mammalian melanin-concentrating hormone (MCH) and enzymatic digests thereof, which have the activity to suppress food intake.... Agent: Cantor Colburn, LLP 20090275501 - Somatostatin-dopamine chimeric analogs: s 20090275515 - 2-hydroxy-2-phenylthiophenylpropionamides as androgen receptor modulators: Compounds of structural formula (I) are modulators of the androgen receptor (AR) in a tissue selective manner. These compounds are useful in the enhancement of weakened muscle tone and the treatment of conditions caused by androgen deficiency or which can be ameliorated by androgen administration, including osteoporosis, osteopenia, glucocorticoid-induced osteoporosis,... Agent: Merck And Co., Inc 20090275511 - Analogs of ghrelin substituted at the n-terminal: wherein the definitions of A1 to A28, R1 and R2 are provided for in the specification, with the exception that the N-terminal amino acid must be selected from the group consisting of Inp, 1-Apc and 4-Apc, the pharmaceutically acceptable salts thereof and pharmaceutical compositions comprising an effective amount of said... Agent: Alan F Feeney,esq Biomeasure, Incorporated 20090275513 - Composition and method for preparing plasminogen: Disclosed is both a method for preparing a plasminogen and a method for preparing a reversibly inactive acidified plasmin by activating the plasminogen. The prepared plasminogen is typically purified from a fraction obtained in the separation of immunoglobulin from Fraction II+III chromatographic process and eluted at a low pH. The... Agent: Womble Carlyle Sandridge & Rice, PLLC 20090275510 - Compositions and methods for inducing or inhibiting activities of selected human cells: Polynucleotides encoding a mutant human carboxylesterase enzyme and polypeptides encoded by the polynucleotides which are capable of metabolizing a prodrug and inactive metabolites thereof to active drug are provided. Compositions and methods for sensitizing cells to a prodrug agent, inhibiting cell growth, treating drug addiction, and facilitating the metabolism of... Agent: Licata & Tyrrell P.C. 20090275505 - Compositions and methods for preventing or treating feline chronic renal failure: The invention provides compositions for preventing chronic feline renal failure comprising from about 28 to about 35% protein and compositions for treating chronic renal failure in felines comprising from about 28 to about 30%, wherein the protein comprises at least about 75% vegetable protein and methods for using such compositions... Agent: Colgate-palmolive Company 20090275512 - Compositions and methods for treating cardiovascular disease and myocardial infarction with dipeptidyl peptidase inhibitors or b type natriuretic peptide analogues resistant to prolyl-specific dipeptidyl degradation: The present invention describes compositions and methods for treating cardiovascular disease and myocardial infarction using dipeptidyl peptidase inhibitors. Also provided are methods for increasing natriuretic peptide function by administering one or more analogues of B type natriuretic peptide that provide increased stability in the presence of prolyl-specific dipeptidyl peptide.... Agent: Wilson, Sonsini, Goodrich & Rosati 20090275516 - Compounds and method for modulating inflammatory reactions: The present invention relates to compounds and methods for modulating, reducing or inhibiting, inflammatory reactions in a patient. Particularly, inflammatory reactions that are targeted by the present invention are cell migration, secretion of toxic products and proteolysis at a site of inflammation. Reduction of inflammation manifestations and reactions occurs by... Agent: Ogilvy Renault LLP 20090275507 - Contraceptive composition: The present invention relates to a contraceptive composition including an effective amount of a dendrimer compound including one or more naphthyl disulphonic acid surface groups, or a pharmaceutically acceptable salt or solvate of the dendrimer compound; and a pharmaceutically acceptable carrier, excipient and/or diluent therefor. The contraceptive composition may also... Agent: Knobbe Martens Olson & Bear LLP 20090275503 - Diastereomeric peptides for modulating t cell immunity: The present invention provides diastereomeric peptides derived from the T Cell Receptor alpha Transmembrane Domain, and lipophilic conjugates thereof, which peptides and conjugates are effective in preventing or treating T cell mediated inflammatory diseases. The invention provides pharmaceutical compositions comprising these diastereomeric peptides and conjugates, and uses thereof for therapy... Agent: Fennemore Craig 20090275517 - G-csf polypeptides and uses thereof: The present invention relates to G-CSF polypeptides and their uses, particularly for therapeutic or prophylactic treatment in human subjects. The invention also relates to nucleic acids encoding said polypeptides, vectors comprising such nucleic acids and recombinant cells containing the same. The invention further discloses methods of producing such polypeptides, as... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association 20090275518 - G-csf polypeptides and uses thereof: The present invention relates to G-CSF polypeptides and their uses, particularly for therapeutic or prophylactic treatment in human subjects. The invention also relates to nucleic acids encoding said polypeptides, vectors comprising such nucleic acids and recombinant cells containing the same. The invention further discloses methods of producing such polypeptides, as... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association 20090275506 - Long lasting natriuretic peptide derivatives: This invention relates to long lasting natriuretic peptide (NP) derivatives. The NP derivative has a NP peptide and a reactive entity coupled to the NP peptide. The reactive entity is able to covalently bond with a functionality on a blood component. In particular, this invention relates to NP derivatives having... Agent: Lando & Anastasi, LLP 20090275509 - Method for stimulating angiogenesis using dkk2 and composition comprising the same: The present invention relates to a method for stimulating angiogenesis using by DKK2 and composition comprising the same. The DKK2 protein of the present invention showed stimulating activities of tube formation on HUVEC, promoting activity of the sprouting of arterial circle tissues and promoting activity of vascular development in the... Agent: Jhk Law 20090275502 - Methods and compositions for enhancing developmental potential of oocytes and preimplantation embryos: The invention relates to compositions and methods for enhancing the developmental potential of oocytes or preimplantation embryos by modulating mitochondrial-associated proteins and/or genomic integrity modifier proteins in the oocytes or preimplantation embryos. In one aspect of the invention, the levels of one or more mitochondrial-associated proteins and/or genomic integrity modifier... Agent: Howson & Howson LLP 20090275504 - Pcsk9 proteins, fragments thereof and methods of modulating pcsk9 phosphorylation and low density lipoprotein (ldlr) degradation: The present invention provide PCSK9 polypeptides, fragments thereof and methods of modulating PCSK9 phosphorylation and low density lipoprotein degradation.... Agent: Clark & Elbing LLP 20090275514 - Use of calmodulin kinase ii inhibitors to treat or prevent heart muscle inflammation: Provided are compositions and methods of treating inflammation of the heart of a subject diagnosed with inflammation of the heart, comprising administering to the subject an effective amount of an inhibitor of Calmodulin Kinase II, whereby the administration of the inhibitor treats inflammation of the heart in the subject. Also... Agent: Ballard Spahr Andrews & Ingersoll, LLP 20090275508 - Use of thymosin alpha 1, alone or in combination with ptx3 or ganciclovir, for the treatment of cytomegalovirus infection: It is described the use of thymosin alpha 1 in combination with long pentraxin PTX3 or Ganciclovir, for the preparation of a medicament for the prevention or treatment of viral diseases and/or for inhibiting virus activation.... Agent: Lucas & Mercanti, LLP 20090275520 - Mucin hypersecretion inhibitors and methods of use: Various methods of using peptides are provided where the peptides comprise less than 24 amino acids. The peptides have an amino acid sequence selected from the group consisting of: (a) an amino acid sequence having from 4 to 23 contiguous amino acids of a reference sequence PEPTIDE 1; (b) an... Agent: Cooley Godward Kronish LLP Attn: Patent Group 20090275519 - Therapeutic peptidomimetic macrocycles: The present invention provides biologically active peptidomimetic macrocycles for the treatment of cell proliferative disorders such as cancer and immunoproliferative disease.... Agent: Wilson, Sonsini, Goodrich & Rosati 20090275521 - Regulation of microphage migration inhibitory factor (mif) activity: The present invention relates to modulating, neutralizing, or inactivating the activity of migration inhibitory factor (MIF). In particularm, the present invention provides methods for modulating, neutralizing, or inactivating MIF activity by complexing MIF with other molecules, preferably a protein, that is capable of associating with MIF. These molecules can be... Agent: Blank Rome LLP 20090275522 - Novel compounds: The present invention relates to novel compounds, pharmaceutical compositions comprising the same, use of said compounds for the manufacture of a medicament for treatment of inter alia shock conditions as well as to a method for treatment of said conditions, wherein said compounds are administered. The compounds are represented by... Agent: Merchant & Gould PC 20090275523 - Spirocyclic nitriles as protease inhibitors: The invention relates to substituted carbo- and heterocyclic spiro compounds of the formula Ia which inhibit thiol proteases, to processes for their preparation and to the use thereof as medicaments.... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC 20090275524 - Novel hypocholesterolemic compounds: The present invention relates to novel hypocholesterolemic compounds of formula (I) useful in the treatment and prevention of atherosclerosis and for the reduction of cholesterol levels as well as to pharmaceutical compositions comprising said compounds alone or in combination with other active agents... Agent: The Webb Law Firm, P.C. 20090275526 - Mucoadhesive nanoparticles for cancer treatment: The present invention relates to a pharmaceutical composition which includes nanoparticles. The nanoparticles include a glyceryl monooleate or monolinoleate (or other mono fatty acid ester); a chitosan; and a cancer therapeutic agent, such as gemcitabine, taxanes, and hydrophobic cancer therapeutic agents). Also disclosed are methods for preparing such nanoparticles and... Agent: Valauskas & Pine LLC 20090275527 - Skin aging treatment comprising paeoniflorin: The present invention relates to a skin aging treatment comprising paeoniflorin as an active ingredient. Since paeoniflorin is effective in significantly inhibiting and improving intrinsic skin aging, significantly inhibiting and improving DNA impairment and skin wrinkling caused by UV and improving existing wrinkles, a cosmetic composition and a pharmaceutical composition... Agent: Sheridan Ross PC 20090275525 - Use of a lactose-derived c-glycoside compound as an agent for activating and regulating cutaneous immunity: The present invention relates to novel lactose-derived compounds of general formula (I) and to their use as agents for stimulating the immune system of the skin and/or as immunoregulators, and for preparing a composition containing a cosmetically or pharmaceutically acceptable medium, intended in particular to prevent and/or limit the appearance... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090275528 - Antituberculous composition comprising oxazole compounds: The present invention provides antituberculous therapeutic drugs with a higher potency. The present invention provides also antituberculous therapeutic drugs containing oxazole compounds represented by (I) general formula (1): [wherein R1 represents a hydrogen atom or C1-6 alkyl group, n represents an integer of 0-6, and R2 represents general formula (A)... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20090275634 - Antisense oligonucleotides against acetylcholinesterase for treating inflammatory diseases: The present invention relates to novel uses of antisense oligonucleotides targeted to the coding region of acetylcholinesterase (AChE) for treating inflammatory disorders other than inflammatory disorders of the central nervous system or the peripheral nervous system innervating voluntary muscles. More particularly, the present invention relates to uses of antisense oligodexoynucleotides... Agent: K&l Gates LLP 20090275638 - Compositions and methods for inhibiting expression of xbp-1 gene: The invention relates to a double-stranded ribonucleic acid (dsRNA) targeting X-Box Protein 1 (XBP-1), and methods of using the dsRNA to inhibit expression of XBP-1.... Agent: Alnylam/fenwick 20090275632 - Methods of diagnosis and treatment: A method of diagnosing a disease in which an miRNA is expressed at a lower level comprises, in a test sample obtained from a subject, determining the methylation status of at least one gene encoding the miRNA in the sample, wherein the presence of methylation is indicative of the presence... Agent: Foley And Lardner LLP Suite 500 20090275633 - Novel tumour suppressor: A method of diagnosing cancer includes the steps of, in a sample obtained from a subject, determining the level or activity of HDAC2. A reduced level or activity of HDAC2 is indicative of cancer. HDAC2 protein expression is preferably determined. Indirect determination of HDAC2 expression is also possible, preferably by... Agent: Foley And Lardner LLP Suite 500 20090275636 - Picornavirus and uses thereof: The invention is directed to a a clade of newly isolated and identified picornaviruses associated with respiratory infection, and isolated nucleic acids sequences and peptides thereof. The invention also relates to antibodies against antigens derived from the picornavirus. The invention also relates to iRNAs which target nucleic acid sequences of... Agent: Wilmerhale/columbia University 20090275637 - Protein tyrosine phosphatase inhibitors: The present invention provides compositions and methods for binding and/or modulating enzymatic activity of human protein tyrosine phosphatases such as PTP1B. Additionally, the invention provides methods of identifying and using such nucleic acid ligands.... Agent: Wilson, Sonsini, Goodrich & Rosati 20090275641 - Rnai-mediated inhibition of rho kinase for treatment of ocular disorders: RNA interference is provided for inhibition of Rho kinase mRNA expression for treating patients with ocular disorders, particularly for treating intraocular pressure, ocular hypertension and glaucoma. Rho kinase mRNA targets include mRNA for ROCK1 and ROCK2.... Agent: Alcon 20090275635 - Screening method: The invention provides a method of modulating Wnt signalling comprising modulating Trabid activity. Preferably modulating Trabid activity comprises inhibiting; Trabid activity. The invention also provides a method of reducing TCF transcription, said method comprising reducing Trabid activity. A method for identifying a-modulator of Trabid said method comprising; providing a Trabid... Agent: David S. Resnick 20090275640 - Sirna targeting inner centromere protein antigens (incenp): Efficient sequence specific gene silencing is possible through the use of siRNA technology. By selecting particular siRNAs by rational design, one can maximize the generation of an effective gene silencing reagent, as well as methods for silencing genes. Methods, compositions, and kits generated through rational design of siRNAs are disclosed... Agent: Kalow & Springut LLP 20090275631 - Therapeutic antisense oligonucleotide composition for the treatment of inflammatory bowel disease: Disclosed herein is a method for the sustained amelioration and/or treatment of ulcerative colitis comprising rectal administration of a compound comprising an antisense oligonucleotide having the sequence 5′-GCCCAAGCTGGCATCCGTCA-3′, ISIS 2302. The method results in a decrease in the indications of ulcerative colitis for an extended period (greater than 90 days)... Agent: Knobbe, Martens, Olson & Bear, LLP 20090275639 - Usp47 inhibtors and methods to induce apoptosis: The present invention relates to USP47 (ubiquitin specific protease 47) inhibitors and methods for inducing apoptosis or cell death in a target cell. In certain embodiments, the invention relates to methods and kits to screen for related agents that induce apoptosis. Additionally, the invention relates to assays for screening compounds... Agent: Darby & Darby P.C. 20090275642 - Dna composition for eliciting an immune response against tumor-associated macrophages: The present invention provides a DNA composition comprising a DNA minigene construct that encodes for a polypeptide comprising a plurality of immunogenic fragments of a cysteine endopeptidase that is expressed in tumor-associated cells. The immunogenic fragments are joined together serially by a linker peptide between each successive fragment in the... Agent: Olson & Cepuritis, Ltd. 20090275645 - Method to induce neovascular formation and tissue regeneration: The present invention relates, e.g., to a method for inducing arteriogenesis, lymphangiogenesis, vasculogenesis, or cardiomyogenesis, and/or for inducing mitosis or proliferation of a smooth muscle cell, a skeletal muscle cell, or a cardiomyocyte, comprising administering to a cell or tissue in need thereof a dose of a polynucleotide that encodes... Agent: Venable LLP 20090275644 - Novel adaptor protein that binds to mammalian toll-like receptor 3 and gene thereof: A novel adaptor protein and its gene are provided. The novel adaptor protein has a property of binding to mammalian Toll-like receptor 3, which controls type I interferon production that is effective for prevention/treatment of viral infectious disease such as hepatitis B, hepatitis C, and the like, treatment of tumors,... Agent: Nixon & Vanderhye, PC 20090275643 - Tryptophanyl-trna synthetase-derived polypeptides useful for the regulation of angiogenesis: The invention provides a method for inhibiting ocular neovascularization in a patient. The method comprises administering to a patient an ocular neovascularization inhibiting amount of a water-soluble polypeptide selected from the group consisting of SEQ ID NO: 12, SEQ ID NO: 7, and an ocular neovascularization inhibiting fragment thereof, which... Agent: Olson & Cepuritis, Ltd. 20090275529 - Method for improving cardiovascular risk profile of cox inhibitors: A method of reducing the increased risk of cardiovascular events attendant with the use of COX or selective COX-2 inhibitors including restoring disrupted cholesterol metabolic function engendered by the use of the COX or selective COX-2 inhibitors and reducing the production of foam cells caused thereby. The disrupted cholesterol metabolic... Agent: Ostrolenk Faber Gerb & Soffen 20090275530 - Gastric raft composition comprising preferably processed starches for inducing satiety: Provided are methods of inducing satiety in an individual using gastric raft compositions and compositions suitable for such methods. The gastric raft compositions may comprise processed starches such as dextrins. Also described are methods of treating diseases characterised by hypoglycaemia, such as glycogen storage disease (GSD), and diabetes.... Agent: Drinker Biddle & Reath Attn: Intellectual Property Group 20090275531 - Method for producing starch networks and initial products: The invention relates to a method for producing starch networks. The method may include preparing a basic starch and preparing a networking starch. The method may further include manufacturing an initial product including the basic starch and the networking starch, and processing the initial product to yield the starch networks,... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20090275532 - Cosmetic composition comprising an oil: The present invention relates to a cosmetic composition for making up or caring for the skin in the form of a water-in-oil emulsion comprising an aqueous phase and at least 15% by weight, relative to the total weight of the composition, of a fatty phase comprising at least one liquid... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20090275533 - Fused bicyclic pyrimidine compounds as aurora kinase inhibitors: e 20090275536 - Antibacterial agents: Described herein are antibacterial compounds, methods for making the compounds, pharmaceutical compositions containing the compounds and methods of treating bacterial infections utilizing the compounds and pharmaceutical composition.... Agent: Pfizer Inc. Patent Department 20090275535 - Antiviral phosphonate analogs: The invention is related to phosphorus substituted compounds with antiviral activity, compositions containing such compounds, and therapeutic methods that include the administration of such compounds, as well as to processes and intermediates useful for preparing such compounds.... Agent: Viksnins Harris & Padys Pllp 20090275534 - Novel pyridopyrazine derivatives, process of manufacturing and uses thereof: The invention relates to pyrido[2,3-b]pyrazine compounds of general formulae (Ia) and (Ib), to their preparation and use, for example, for the treatment of malignant disorders and other disorders based on pathological cell proliferations.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090275537 - Certain chemical entities, compositions, and methods: Chemical entities that modulate smooth muscle myosin and/or non-muscle myosin, pharmaceutical compositions and methods of treatment of diseases and conditions associated with smooth muscle myosin and/or non-muscle myosin are described.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20090275538 - Arylmethylidene heterocycles as novel analgesics: The present invention relates to Arylmethylidene heterocycles, compositions comprising an Arylmethylidene heterocycle, and methods useful for treating or preventing pain comprising administering an effective amount of an Arylmethylidene heterocycle. The compounds, compositions, and methods of the invention are also useful for treating or preventing inflammation.... Agent: Clark & Elbing LLP 20090275539 - Nuclear transcription factors regulators: The present invention relates to novel compounds that are nuclear transcription factors (NTF) regulators. The present invention also provides methods for treating, preventing and/or reducing inflammation associated diseases by regulating NTF in the cardiovascular, connective tissue, pulmonary, gastrointestinal, respiratory, urogenital, nervous, or cutaneous systems as well as tumoral and infective... Agent: Schneck & Schneck 20090275540 - Pre-compacted calcium-containing compositions: A pre-compacted materiel comprising one or more calcium-containing compounds and one or more sugar alcohols, wherein the calcium-containing compound having a polycrystallic porous structure. The pre-compacted material is preferably obtained by roller compaction and is suitable for use in the further processing of the pre-compacted material into composition like e.g.... Agent: Edwards Angell Palmer & Dodge LLP 20090275541 - Method for treating neurocognitive dysfunction: wherein: A is a bridge selected from the following radicals: —(CH2)m—, —CH═CH—, —(CH2)p—O—, —(CH2)p—S—, —(CH2)p—SO2—, —(CH2)p—NR1— and —SO2—NR2—, and wherein: m is an integer of from 1 to 3 inclusive; p is an integer selected from 1 and 2; R1 is selected from the group consisting of hydrogen and C1-C5... Agent: Karen Guerrero 20090275542 - Azaheterocyclyl derivatives of androstanes and androstenes as medicaments for cardiovascular disorders: Compounds of formula (I) wherein: the groups are as defined in the description, are useful for the preparation of medicaments for the treatment of cardiovascular disorders, in particular heart failure and hypertension. The compounds are inhibitors of the enzymatic activity of the Na+, K+-ATPase. They are useful for the preparation... Agent: Lucas & Mercanti, LLP 20090275543 - Modified glycosaminoglycans, pharmaceutical compositions and methods for oral delivery thereof: This invention provides a composition comprising a depolymerized glycosaminoglycan or derivative thereof covalently linked to a bile acid. This invention also provides a pharmaceutical composition comprising a depolymerized glycosaminoglycan or derivative thereof covalently linked to a bile acid and a pharmaceutically acceptable carrier. Finally, this invention provides a method for... Agent: Robert D. Katz Cooper & Dunham LLP 20090275545 - Medicinal targeted local lipolysis: Aqueous phospholipid systems comprising at least one phospholipid, at least one bile acid and water are suitable for producing medicaments for the treatment of adipose tissue disorders and lead to regression of the pathologically proliferated adipose tissue.... Agent: The Firm Of Hueschen And Sage 20090275544 - Method and kit for reducing the symptoms of peripheral vascular disease: A method for reducing the symptoms of peripheral vascular disease and for improving peripheral circulation wherein a progestin is administered to a subject in need thereof.... Agent: Howard Eisenberg, Esq. 20090275546 - Diagnostic tests and personalized treatment regimes for cancer stem cells: Provided are methods of identifying a metabolic target in a cancer stem cell that include using a microarray to identify intracellular signaling networks within a population of cancer stem cells that respond to a growth factor for the stem cell. Also provided are methods of determining a personalized therapeutic regime... Agent: Quine Intellectual Property Law Group, P.C. 20090275548 - Compounds and methods for activated therapy: Provided herein are compounds for detection, diagnosis and treatment of target tissues or target compositions, including hyperproliferative tissues such as tumors, using sonodynamic and/or photodynamic methods. In particular, photosensitizer and/or sonosensitizer compounds that collect in hyperproliferative tissue are provided.... Agent: Elmore Patent Law Group, PC 20090275547 - Metal complex phosphatidyl-inositol-3-kinase inhibitors: Provided are novel organometallic compounds that inhibit PI3K lipid kinase and phospho-AKT in human melanoma cells, and also inhibit the migration of melanoma cells. The present invention is also directed to methods for inhibiting cancer cell proliferation, migration or both comprising contacting a cancer cell with a disclosed organometallic kinase... Agent: Woodcock Washburn LLP 20090275549 - Use of picoplatin to treat colorectal cancer: The invention provides a method of treatment of colorectal cancer by administration of the anti-cancer platinum drug picoplatin in conjunction with 5-FU and leucovorin in a variety of treatment regimens.... Agent: Schwegman, Lundberg & Woessner, P.A. 20090275551 - Fluvastatin for the treatment of patients with a history of muscle related side effects with other statins: The present disclosure relates to method of using fluvastatin, alone or in combination with ezetimibe, be used to (1) lower cholesterol level, (2) treat hypercholesterolemia, (3) treat mixed dyslipidemia and/or (4) inhibit cholesterol biosynthesis in patients who experienced muscle-related side effects (MRSE). The present disclosure also relates to a pharmaceutical... Agent: Novartis Corporate Intellectual Property 20090275552 - Therapy for treating resistant bacterial infections: The invention relates to an improved therapy for treating resistant bacterial infections caused by extended-spectrum β-lactamase (ESBLs)-producing strains in a warm-blooded animal, adjuvant step down therapy, and pharmaceutical compositions for such therapies. The invention also relates to a method for inhibiting bacterial resistance in ESBLs-producing strains so as to have... Agent: Bio Intellectual Property Services (bio Ips) LLC 20090275553 - Dosage regimen of an s1p receptor agonist: S1P receptor modulators or agonists are administered following a dosage regimen whereby during the initial 3 to 6 days of treatment the daily dosage is raised so that in total the R-fold (R being the accumulation factor) standard daily dosage is administered and thereafter continued at the standard daily dosage... Agent: Novartis Corporate Intellectual Property 20090275554 - Aminocarboxylic acid derivative and medicinal use thereof: P 20090275556 - Aryl sulfonamides useful as inhibitors of chemokine receptor activity: 20090275555 - Substituted indole ligands for the orl-1 receptor: New ligands for the ORL-1 receptor are described, useful for antagonising the activity of said receptors in a patient in need thereof, and for preventing and treating illnesses dependent on the activation of this receptor. The new compounds conform to structural formula (I) wherein R1, R2, R3, R4 are further... Agent: Stetina Brunda Garred & Brucker 20090275550 - Pyridyl amide t-type calcium channel antagonists: The present invention is directed to pyridyl amide compounds which are antagonists of T-type calcium channels, and which are useful in the treatment or prevention of disorders and diseases in which T-type calcium channels are involved. The invention is also directed to pharmaceutical compositions comprising these compounds and the use... Agent: Merck And Co., Inc 20090275557 - Novel composition for treatment of diseases related to activated lymphocytes: The present invention relates to inhibiting proliferation and inducing apoptosis in activated lymphocytes, including T cells and B cells. The invention also provides compositions and methods for inhibiting proliferation and inducing apoptosis in activated lymphocytes, as well methods for treating diseases associated with activated lymphocytes by administering 5-HT receptor antagonists.... Agent: Drinker Biddle & Reath Attn: Intellectual Property Group 20090275558 - Substituted sulfonamide compounds: e 20090275559 - Chronotherapeutic formulations of modified-release calcium channel blocker anti-hypertensive drugs in combination with other anti-hypertensive drugs for 24-hour optimal treatment of hypertension, nocturnal hypertension, and/or hypertension with angina: The present invention relates to formulations of anti-hypertensive drugs. The present invention includes a modified-release formulation of diltiazem hydrochloride that is suitable for once-daily use and which provides delivery of drug either in the early morning hours, or overnight, so as to blunt the natural rise in blood pressure (BP)... Agent: William M. Brown 20090275560 - Organic compounds: The invention relates to organic compounds which have interesting pharmaceutical properties. In particular, the compounds are useful in the treatment and/or prevention of infections such as those caused by Plasmodium falciparum, Plasmodium vivax, Plasmodium malariae, Plasmodium ovale, Trypanosoma cruzi and parasites of the Leishmania genus such as, for example, Leishmania... Agent: Banner & Witcoff, Ltd. 20090275561 - Compounds for the treatment of hepatitis c: The invention encompasses compounds of formula I as well as compositions and methods of using the compounds. The compounds have activity against hepatitis C virus (HCV) and are useful in treating those infected with HCV.... Agent: Louis J. Wille Bristol-myers Squibb Company 20090275562 - Tolerability of mirtazapine and a second active by using them in combination: A reduction in the side effects of treating with an agent having combined 5HT2/5HT3 and alpha-2 antagonistic activity is obtained by administering an agent having selective norepinephrine reuptake inhibitory or histamine H1 agonist activity. In some embodiments, the invention provides synergistic combinations of 5HT2/5HT3 antagonist/alpha-2 antagonist and selective norepinephrine reuptake... Agent: Wilson, Sonsini, Goodrich & Rosati 20090275563 - Combination of 5-ht7 receptor antagonist and serotonin reuptake inhibitor therapy: Patients suffering from serotonin-mediated diseases or conditions, such as depression, may be treated by administering an effective combined amount of a 5-HT7 receptor antagonist and a serotonin reuptake inhibitor.... Agent: Philip S. Johnson Johnson & Johnson 20090275564 - Haloaryl substituted aminopurines, compositions thereof, and methods of treatment therewith: wherein R1, R2 and R3 are as defined herein, compositions comprising an effective amount of an Aminopurine Compound and methods for treating or preventing cancer, a cardiovascular disease, a renal disease, an autoimmune condition, an inflammatory condition, macular degeneration, ischemia-reperfusion injury, pain and related syndromes, disease-related wasting, an asbestos-related condition,... Agent: Jones Day 20090275565 - Substituted aralkyl derivatives: The present invention relates to novel substituted aralkyl derivatives of the general formula (I) and (IIIa), their derivatives, their analogs, their tautomeric forms, their pharmaceutically acceptable salts, their pharmaceutically acceptable solvates, pharmaceutical compositions containing them, use of these compounds in medicine and the intermediates involved in their preparation.... Agent: Nixon & Vanderhye, PC 20090275566 - Bace inhibitors: e 20090275567 - 2-heterocycloamino-4-imidazolylpyrimidines as agents for the inhibition of cell proliferation: 20090275568 - Fused quinoline derivative and use thereof: 20090275569 - Benzotriazine inhibitors of kinases: The invention provides benzotriazine compounds having formula (I). The benzotriazine compounds of the invention are capable of inhibiting kinases, such members of the Src kinase family, and various other specific receptor and non-receptor kinases.... Agent: Goodwin Procter LLP Patent Administrator 20090275572 - Fab i inhibitors: Compounds of the formula (I) are disclosed which are Fab I inhibitors and are useful in the treatment of bacterial infections.... Agent: Goodwin Procter LLP Patent Administrator 20090275573 - Imidazolidinone derivatives as 11b-hsd1 inhibitors: m 20090275571 - Morpholinyl and pyrrolidinyl analogs: The present invention relates to morpholinyl, and pyrrolidinyl analogs, pharmaceutical compositions containing them, and their use as antagonists of urotensin II.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20090275574 - Novel compounds-300: e 20090275570 - Substituted heterocycles and their use as chk1, pdk1 and pak inhibitors: The invention relates to novel compounds of Formula (I) and to their pharmaceutical compositions and to their methods of use. These novel compounds possess CHK1 kinase inhibitory activity, PDK1 inhibitory activity and Pak kinase inhibitory activity and are accordingly useful in the treatment and/or prophylaxis of cancer.... Agent: Astrazeneca R&d Boston 20090275575 - Benzophenone derivatives useful for inhibiting formation of microtubule: Disclosed herein are novel benzophenone derivatives represented by formula I, a pharmaceutically acceptable salt thereof, a hydrate thereof or a solvate thereof, a pharmacological composition containing the same, and a use of the composition as therapeutic drugs. The benzophenone derivatives have an inhibition activity of microtubule formation and can be... Agent: Lucas & Mercanti, LLP 20090275576 - 3-heteroaryl-3,5-dihydro-4-oxo-4h-pyridazino[4,5-b]indole-1-carboxamide derivatives, their preparation and therapeutic use: R1 represents a hydrogen atom or a (C1-C4)alkyl group; R2 and R3 each represent, independently of one another, a hydrogen atom or a (C1-C4)alkyl group or else R2 and R3 form, with the nitrogen atom which carries them, a pyrrolidinyl, piperidinyl, morpholinyl or 4-alkylpiperazinyl group; and Het represents a heteroaromatic... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC 20090275577 - Imidazopyridine and imidazopyrimidine derivatives as antibacterial agents: Compounds of formula I and methods for their preparation are disclosed. Further disclosed are methods of making biologically active compounds of formula I as well as pharmaceutically acceptable compositions comprising compounds of formula I. Compounds of formula I as disclosed herein can be used in a variety of applications including... Agent: Pfizer Inc. Patent Department 20090275579 - 3-spiroindolin-2-one derivatives, preparation and therapeutic use thereof: m 20090275580 - 3-spiroindolin-2-one derivatives, preparation and therapeutic use thereof: 20090275578 - Isoindolone compounds and their use as metabotropic glutamate receptor potentiators: wherein R1, R2, R3, R4, R5, R6, R7, R8, R9 and n are as defined for formula I in the description. The invention also relates to processes for the preparation of the compounds and to new intermediates employed in the preparation, pharmaceutical compositions containing the compounds, and to the use... Agent: Birch, Stewart, Kolasch & Birch, LLP 20090275581 - Renin inhibitors: e 20090275582 - Bi-aryl meta-pyrimidine inhibitors of kinases: The invention provides biaryl meta-pyrimidine compounds having the general structure (A). The pyrimidine compounds of the invention are capable of inhibiting kinases, such as members of the Jak kinase family, and various other specific receptor and non-receptor kinases.... Agent: Goodwin Procter LLP Patent Administrator 20090275583 - Antiviral compounds and use thereof: The invention relates to compounds, pharmaceutical compositions and methods useful for treating viral infection.... Agent: Myriad Genetics Inc. Intellecutal Property Department 20090275584 - Biocidal combinations comprising imazalil: The present invention relates to combinations of imazalil, or a salt thereof, and a biocidal compound which provide an improved biocidal effect. More particularly, the present invention relates to compositions comprising a combination of imazalil, or a salt thereof, together with one or more biocidal compounds selected from tolylfluanid, dichlofluanid,... Agent: Philip S. Johnson Johnson & Johnson 20090275585 - Novel compounds and therapeutic use thereof for protein kinase inhibition: e 20090275586 - Heterocyclic inhibitors of pde4: The present invention is directed to potent and selective heterocyclic compounds, useful as inhibitors of phosphodiesterase 4 (PDE4), compositions comprising the same, and their application as pharmaceuticals for the treatment of disease. Methods of inhibition of PDE4 activity are also provided, as well as methods for the treatment of inflammatory... Agent: Global Patent Group - Kal 20090275589 - Pyridazine compound and use thereof: e 20090275590 - (1-azinone)-substituted pyridoindoles: wherein R1 is H or optionally substituted alkyl; R2, R3, R4 are each independently selected from H, —O-alkyl, —S-alkyl, alkyl, halo, —CF3, and —CN; G is —CR12R13—NR5— or —NR5—CR12R13; R5; is H, optionally substituted alkyl, optionally substituted heterocycle, —C(═O)—R6, —C(═O)—O—R7, or —C(═O)—NR19R20; R6 and R7 are each optionally substituted alkyl... Agent: Heslin Rothenberg Farley & Mesiti PC 20090275591 - 1-heterocyclylsulfonyl, 2-aminomethyl, 5- (hetero-) aryl substituted 1-h-pyrrole derivatives as acid secretion inhibitor: The present invention provides a compound having a superior acid secretion inhibitory effect and showing an antiulcer activity and the like. The present invention provides a compound represented by the formula (I) wherein R1 is a nitrogen-containing monocyclic heterocyclic group optionally condensed with a benzene ring or a heterocycle, the... Agent: Edwards Angell Palmer & Dodge LLP 20090275592 - Heterocyclic modulators of pkb: e 20090275587 - Methods of treating ischemic related conditions: The present invention relates to methods of treating ischemia-related conditions by administering to a patient in need of such methods certain thiosemicarbazone compounds. Preferred embodiments of the present invention relates to methods of treating specific ischemia-related conditions, including but not limited to Alzheimer's disease, Parkinson's disease, Coronary artery bypass graft... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c. 20090275588 - Novel sulfonamide compounds: The invention relates to novel sulfonamide compounds and their use as orexin receptor antagonists.... Agent: Hoxie & Associates LLC 20090275593 - 3 substituted n-(aryl- or heteroaryl)-pyrazolo[1,5-a]pyrimidines as kinase inhibitors: The invention relates to 3-substituted N-(aryl- or heteroaryl)-pyrazolo[1,5-a]pyrimidine compounds, their use as kinase inhibitors, new pharmaceutical formulations comprising said compounds, said compounds for use in the diagnostic or therapeutic treatment of warm-blooded animals, especially humans, their use in the treatment of diseases or for the manufacture of pharmaceutical formulations useful... Agent: Novartis Institutes For Biomedical Research, Inc. 20090275594 - 3-hydrazone piperazinyl rifamycin derivatives useful as antimicrobial agents: The present invention is directed to novel 3-hydrazone piperazinyl rifamycin derivatives, pharmaceutical compositions containing them and the use of said derivatives and pharmaceutical compositions as antimicrobial agents against pathogenic microorganisms, particularly against resistant microbes.... Agent: Philip S. Johnson Johnson & Johnson 20090275595 - Method for reduction, stabilization and prevention of rupture of lipid rich plaque: There is to provide is an agent for reduction of a lipid rich plaque, stabilization of a lipid rich plaque and/or prevention of rupture of a lipid rich plaque in an atherosclerotic lesion comprising an effective amount of 2-[4-[2-(benzimidazole-2-ylthio)ethyl]piperazin-1-yl]-N-[2,4-bis(methylthio)-6-methyl-3-pyridyl]acetamide (hereinafter, referred to as compound 1), its pharmaceutically acceptable salt or... Agent: Westerman, Hattori, Daniels & Adrian, LLP 20090275597 - Methods of treating cns disorders: The present invention relates to methods of treating various CNS disorders, e.g., mania, bipolar disorder and schizophrenia, by administering NMDA receptor antagonists, alone or in combination with dopamine receptor antagonists.... Agent: Forest Laboratories, Inc. Attn: Charles S. Ryan 20090275596 - Treatment of neurodegenerative disorders with thiourea compounds: e 20090275598 - Conformationally constrained 3-(4-hydroxy-phenyl)-substituted-propanoic acids useful for treating metabolic disorders: 20090275599 - Therapeutic or prophylactic agent for multiple sclerosis: A therapeutic or prophylactic agent for multiple sclerosis is disclosed. The therapeutic or prophylactic agent comprises as an effective ingredient a glycine derivative having a specific structure or a pharmaceutically acceptable salt thereof, for example, the below-described compound [(E)-2-(2,6-dichlorobenzamido)-5-[4-(isopropyl-pyrimidin-2-ylamino)phenyl]pent-4-enoic acid]. The therapeutic or prophylactic agent for multiple sclerosis according to... Agent: Darby & Darby P.C. 20090275600 - Modified pyrimidine glucocorticoid receptor modulators: The present invention provides a novel class of modified pyrimidine compounds and compositions and methods of using the compounds as glucocorticoid receptor modulators.... Agent: Townsend And Townsend And Crew, LLP 20090275601 - Novel pyriproxyfen compositions: New pesticidal compositions comprising pyriproxyfen and methyl esters of C16-C18 fatty acids and having low volatile organic compound (VOC) content are provided. Methods of use and ready-to-use products are also provided.... Agent: Wood, Phillips, Katz, Clark & Mortimer 20090275602 - Substituted hydroxyethyl amine compounds as beta-secretase modulators and methods of use: wherein R1a, R1b, R1c, B, R3, R4, R5 and W of Formula I, and R1a, R1b, R1c, R2, R2a, R3, R4, R5, A1, A2, A3, A4, W, X, Z, m and n of Formula II are defined herein. The invention also provides compounds of Formula III, sub-Formulas II-A-II-D, sub-Formulas III-A-III-D... Agent: Amgen Inc. 20090275603 - Nf- kb inhibitors and uses thereof: A new class of imidazolines as 4-position esters with very potent anti-inflammatory as well as antimicrobial activity is described. The synthesis of these imidazolines includes a multicomponent reaction applicable to a combinatorial synthetic approach. The combination of these two key characteristics provides an effective therapeutic drug in the treatment of... Agent: Peter G. Carroll Medlen & Carroll, LLP 20090275604 - M3 muscarinic acetylcholine receptor antagonists: Muscarinic Acetylcholine receptor antagonists and methods of using them are provided.... Agent: Glaxosmithkline Corporate Intellectual Property - Uw2220 20090275605 - 3,11 b-cis-dihydrotetrabenazine for the treatment of a proliferative disease or an inflammatory disease: The invention provides the use of a compound for the manufacture of a medicament for the prophylaxis or treatment of a proliferative disease or an inflammatory disease, the compound being 3,11b-cis-dihydrotetrabenazine or a pharmaceutically acceptable salt thereof.... Agent: Schwegman, Lundberg & Woessner, P.A. 20090275606 - Heterocyclic compounds as mek inhibitors: e 20090275609 - Carboxamide compounds and methods for using the same: 20090275608 - Methods of diagnosing and treating parp-mediated diseases: Disclosed are methods of identifying a disease treatable with modulators of differentially expressed genes in a disease, including at least PARP modulators, by identifying the level of expression of differentially expressed genes, including at least PARP, in a plurality of samples from a population, making a decision regarding identifying the... Agent: Bipar Sciences Inc. C/o Mofo 20090275607 - Tetrahydro isoquinoline derivatives, preparation methods and medicinal uses thereof: A kind of tetrahydro isoquinoline derivatives (I), their preparation methods, medicine compositions and medicinal uses thereof, especially their uses as κ-opioid receptor excitant in pain relieving, which belongs to the medicine chemistry. The substituents R1, R2, R3, R4 of general formula (I) are defined as the description.... Agent: Christie, Parker & Hale, LLP 20090275610 - Tricyclic opioid modulators: The invention is directed to compounds of Formula (I) useful as delta and mu opioid receptor modulators. Pharmaceutical and veterinary compositions and methods of treating mild to severe pain and various diseases using compounds of the invention are also described.... Agent: Philip S. Johnson Johnson & Johnson 20090275611 - Compounds which modulate the cb2 receptor: Compounds are provided which bind to and are agonist, antagonists or inverse agonists of the CB2 receptor, the compounds having the general formula (I) wherein R1, R2, R3, X and Ar have the meanings given in the specification, and the preparation and use thereof. The compounds are valuable CB2 receptor... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation 20090275612 - Compound with antimalarial activity and antimalarial drug containing the same as active ingredient: Compounds with high antimalarial activity; and antimalarial drugs containing the same as an active ingredient. There are provided compounds with antimalarial activity represented by the chemical formula: (wherein R1 is H, Cl or OCH3; R2 is H or CH3; R3 is CH, CH2, C(CH3), CH(CH3) or C(CH3)2; Ar is imidazole,... Agent: Edwards Angell Palmer & Dodge LLP 20090275613 - Inhibitors of 11-beta-hydroxysteroid dehydrogenase 1: The present invention discloses novel compounds of Formula I: (I) possessing 11β-HSD type 1 antagonist activity, as well as methods for preparing such compounds. In another embodiment, the invention discloses pharmaceutical compositions comprising compounds of Formula I, as well as methods of using the compounds and compositions to treat diabetes,... Agent: Eli Lilly & Company 20090275614 - Methylphenidate derivatives and uses of them: e 20090275615 - Method of treating thermoregulatory disfunction with paroxetine: The present invention relates to a method for treating a patient suffering from a thermoregulatory dysfunction, especially hot flashes and flushes associated with hormonal changes due to naturally occurring menopause (whether male or female) or due to chemically or surgically induced menopause. The method is also applicable to treating the... Agent: Foley And Lardner LLP Suite 500 20090275616 - Straightforward entry to 7-azabicyclo[2.2.1]heptane-1-carbonitriles and subsequent synthesis of epibatidine analogues: The present invention relates to a group of substituted-7-azabicyclo-[2.2.1]heptyl derivatives with biological activity. The present invention also relates to synthetic methods for producing said substituted-7-azabicyclo-[2.2.1]heptyl derivatives. The present invention also relates to certain intermediates for producing such substituted-7-azabicyclo-[2.2.1]heptyl derivatives, as well as a synthetic method for producing such intermediates. The... Agent: Clark & Elbing LLP 20090275617 - Aryl-substituted nitrogen-containing heterocyclic compounds: [in the formula, A1, A2 and A3 independently represent a carbon atom or a nitrogen atom, and one or two of A1, A2 and A3 represent a carbon atom; R1 represents a lower alkyl group or the like; R2 represents a phenyl group which may be substituted with a halogen... Agent: Merck And Co., Inc 20090275618 - 1, 5-diphenyl-3-benzylamino-1, 5-dihydropyrrolidin-2-one as cb1 receptor modulators: Compounds and pharmaceutical compositions of Formula (I) by blockade of the CB1 receptors via an inverse agonism mechanism which are useful for reducing body weight in mammals, cognitive impairment associated with schizophrenia, mitigating treatment emergent weight gain observed during treatment with antipsychotics and have increased bioavailability.... Agent: Eli Lilly & Company 20090275619 - Amide substituted indazole and benzotriazole derivatives as poly(adp-ribose)polymerase (parp) inhibitors: The present invention relates to compounds of formula (I) and pharmaceutically acceptable salts or tautomers thereof which are inhibitors of poly (ADP-ribose) polymerase (PARP) and thus useful for the treatment of cancer, inflammatory diseases, reperfusion injuries, ischemic conditions, stroke, renal failure, cardiovascular diseases, vascular diseases other than cardiovascular diseases, diabetes,... Agent: Merck And Co., Inc 20090275621 - 1, 3, 4-oxadiazol-2-ones as ppar delta modulators and their use thereof: e 20090275622 - Nizatidine formulations: Pharmaceutical formulations comprising nizatidine or salts thereof. Further the invention relates to liquid pharmaceutical formulations comprising nizatidine or salts thereof.... Agent: Dr. Reddy''s Laboratories, Inc. 20090275623 - Alpha-amino acid derivatives and medicaments containing the same as an active ingredient: (wherein, R1, R2, R3, R4, X and Y are as defined in the claims) or pharmaceutically acceptable salts, prodrugs or solvates thereof. The derivatives of formula (1) have βARK1 inhibitory activity and are useful for preventing or treating heart failure. Moreover, the derivatives of formula (1) also have antitumor activity,... Agent: Birch Stewart Kolasch & Birch 20090275624 - Inhibitors of cdc phosphatases: A subject of the present invention is novel compounds comprising 2 or 3 benzothiazole-4,7-dione- or benzooxazole-4,7-dione-type units, which inhibit the cdc25 phosphatases, in particular cdc25-C phosphatase. These compounds can in particular be used in the treatment of cancer.... Agent: Hunton & Williams LLP Intellectual Property Department 20090275625 - Novel thiazolidin 4-one derivatives: The invention relates to pharmaceutical compositions containing at least one thiazolidin-4-one derivative to prevent or treat disorders associated with an activated immune system. Furthermore, the invention relates to novel thiazolidin-4-one derivatives notably for use as pharmaceutically active compounds. Said compounds particularly act also as immunosuppressive agents.... Agent: Hoxie & Associates LLC 20090275626 - Pharmaceutical composition for prevention or treatment of neurogenic pain: The purpose of the present invention is to provide agents useful for the prevention or treatment of a neuropathic pain. That is, the present invention provides agents for the prevention or treatment of neuropathic pain such as painful diabetic neuropathy, postherpetic neuralgia, trigeminal neuralgia, or postoperative or posttraumatic chronic pain... Agent: Westerman, Hattori, Daniels & Adrian, LLP 20090275627 - Alpha2b and alpha2c agonists: Described herein are compounds that can be useful as bioactive agents. More specifically, the compounds described herein can be useful as both α2B and α2C adrenergic agonists. Methods of synthesis and administration of the compounds are also disclosed.... Agent: Allergan, Inc. 20090275628 - Substituted spiro-compounds and the use thereof for producing medicaments: The present invention relates to substituted spiro compounds, to processes for preparing them, to medicaments comprising these compounds and to the use of these compounds for producing medicaments.... Agent: Crowell & Moring LLP Intellectual Property Group 20090275629 - Therapy for the treatment of disease: Disclosed herein are pharmaceutical compositions comprising various combinations of an antimuscarinic or an anticholinergic agent, a compound that causes stimulation of salivary glands, and a compound that relieves constipation. Also disclosed are methods of treating a patient suffering from overactive bladder comprising administering to the patient the above pharmaceutical composition.... Agent: Techlaw LLP 20090275630 - Cosmetic composition comprising an imidopercarboxylic acid derivative and a n-acylated amino acid ester: Composition containing, in a physiologically acceptable medium, at least one imidopercarboxylic acid compound and at least one N-acylated amino acid ester of formula (A) as described herein.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090275646 - Therapeutic compounds: m 20090275647 - Taxane derivative composition: A stable, absolutely ethanol free composition of docetaxel that prevents alcoholic intoxication or anaphylactic shock. The composition can be in the form of a stable injectable composition that includes a taxane derivative, wherein the composition includes a mixture of docetaxel, one or more stabilizer, one or more surfactant, or more... Agent: Hamre, Schumann, Mueller & Larson, P.C. 20090275649 - Compositions and methods for identifying modulars of trpv2: It has now been discovered that certain cannabinoids specifically activate TRPV2 channel activity. Based on the discovery, novel compositions and methods for screening, identifying and characterizing compounds that increase or decrease the biological activity of a TRPV2.... Agent: Philip S. Johnson Johnson & Johnson 20090275648 - Macrocyclic ghrelin receptor antagonists and inverse agonists and methods of using the same: The present invention provides novel conformationally-defined macrocyclic compounds that have been demonstrated to be selective modulators of the ghrelin receptor (growth hormone secretagogue receptor, GHS-R1a and subtypes, isoforms and/or variants thereof). Methods of synthesizing the novel compounds are also described herein. These compounds are useful as antagonists or inverse agonists... Agent: Myers Bigel Sibley & Sajovec 20090275650 - 3-acyl coumarins, thiochromones and quinolones and therapeutic uses thereof: e 20090275651 - Alcanoic acid amides substituted by saturated o-heterocycles: Compounds of the general formula (formula I) in which the meanings of the substituents R1 to R6 are as indicated in claim 1, have renin-inhibiting properties and can be used as medicines.... Agent: Wenderoth, Lind & Ponack, L.L.P. 20090275652 - Biofilm formation inhibitor composition: A drug and a composition for inhibiting biofilm formation are provided. A biofilm formation inhibitor composition containing the following component (A): (A) at least one or more selected from compounds represented by Formula (1) to Formula (4): wherein R1 to R5 each represent an alkyl group or the like; EO... Agent: Birch Stewart Kolasch & Birch 20090275653 - Polymorphic forms of ladostigil tartrate: The invention provides for solid state chemistry of ladostigil tartrate, particularly polymorphic forms of ladostigil tartrate, and processes for the preparation thereof.... Agent: Winston & Strawn LLP Patent Department 20090275654 - Pharmaceutical gallium compositions and methods: The present invention provides novel pharmaceutical gallium compositions, as well as methods for their preparation and methods for treating conditions and diseases such as cancer, hypercalcemia, osteoporosis, osteopenia, and Paget's disease.... Agent: Diehl Servilla LLC 20090275655 - Pharmaceutical gallium compositions and methods: The present invention provides novel pharmaceutical gallium compositions, as well as methods for their preparation and methods for treating conditions and diseases such as cancer, hypercalcemia, osteoporosis, osteopenia, Paget's disease, and infections.... Agent: Diehl Servilla LLC 20090275656 - Medicinal compositions of salts, chelates and/or free acids of alpha hydroxyl organic acids and related processes and methods: Processes are described for the production of an isolated medicinal composition for administration to mammals which comprises an effective amount of a free acid, salt or chelate of at least one naturally occurring form of an alpha hydroxyl organic acid comprising combining at least one naturally occurring form of an... Agent: Fox Rothschild LLP Princeton Pike Corporate Center 20090275657 - Fatty acid antimicrobial: The novel antimicrobial composition is disclosed including from about 60 to 95% of a lipophilic polar solvent such as propylene glycol, ethylene glycol, or isopropanol and from about 0.5 to 5% of a mixture of C8 to C14 fatty acids. Other constituents of the present invention may include water, an... Agent: Smith Law Office 20090275658 - Method for producing a raw oil from mixtures of micro-organisms and plants, oil produced according to said method and specific uses of the thus produced oil and, optionally, additional refined oil: The invention relates to a method for producing a raw oil from micro-organisms and plants, oil produced according to said method and specific uses of the thus produced oil and, optionally, additional refined oil in foodstuffs, in food supplements, or in cosmetic or pharmaceutical compositions.... Agent: Hammer & Associates, P.C. 20090275659 - Phenyl acetic acid derivatives as inflammation modulators: Compounds, pharmaceutical compositions and methods are provided that are useful in the treatment of inflammatory and immune-related diseases and conditions. In particular, the invention provides compounds which modulate the function and/or expression of proteins involved in atopic diseases, inflammatory conditions and cancer. The subject compounds are carboxylic acid derivatives.... Agent: Amgen Inc. 20090275660 - Stable parenteral formulations of tigecycline: The present invention relates to stable parenteral formulations of tigecycline and process of preparation thereof, wherein the formulation comprises of an edetate, a pH modifying agent or an antioxidant, such that the formulation remains stable for at least 45 hours.... Agent: Ranbaxy Inc. Intellectual Property Dept. 20090275661 - Preparation of the formaurindicarboxylic acid base and its derivations and use: A pharmaceutical composition comprising at least 0.1 μmol of formaurindicarboxylic acid or its derivatives in 1 kg of pharmaceutically acceptable carrier. The pharmaceutical composition of claim 1 wherein the composition is in the form of solution prepared using aqueous alcali or water.... Agent: Ostrolenk Faber Gerb & Soffen 20090275662 - Injectable veterinary composition: Injectable veterinary composition comprising a fluorinated chloramphenicol or thiamphenicol derivative and a solvent system comprising an ether of 1,2-ethanediol oligo- or polymers, and a pyrrolidone solvent.... Agent: Intervet/schering-plough Animal Health 20090275663 - Method for producing a disinfecting agent: The invention relates to medicine, in particular to sanitary and hygiene, more specifically to methods for producing a disinfecting agent for decontaminating different types of water, including drinking water. The inventive disinfecting agent producing method by dissolving quaternary ammonium compounds in water in the presence of an active additive in... Agent: Collard & Roe, P.C. 20090275664 - Novel polyamine analog conjugates and quinone conjugates as therapies for cancers and prostate diseases: Peptide conjugates in which cytocidal and cytostatic agents, such as polyamine analogs or naphthoquinones, are conjugated to a polypeptide recognized and cleaved by enzymes such as prostate-specific antigen (PSA) and cathepsin B are provided, as well as compositions comprising these conjugates. Methods of using these conjugates in the treatment of... Agent: Morrison & Foerster LLP 20090275665 - Enhanced biological potential of greater than 99% pure form of 1, 7-bis(4-hydroxy-3-methoxyphenyl)-3,5-heptanedione over corresponding 95% pure form-therapeutic and agricultural applications thereof: Disclosed are novel and enhanced anti-fungal properties of greater than 99% pure form of 1,7-Bis(4-hydroxy-3-methoxyphenyl)-3,5-heptanedione in comparison with the corresponding 95% pure form, said greater than 99% pure form of 1,7-Bis(4-hydroxy-3-methoxyphenyl)-3,5-heptanedione being devoid of 5-Hydroxy-1,7-bis(4-hydroxy-3-methoxyphenyl)-3-heptanone and 3,5-Dihydroxy-1,7-bis(4-hydroxy-3-methoxyphenyl)-heptane. The inventors disclose the uses of greater than 99% pure form of 1,7-Bis(4-hydroxy-3-methoxyphenyl)-3,5-heptanedione... Agent: Sabinsa Corporation 20090275666 - Condensation products, method for their production and use thereof in medicaments, as disinfectants or as a tannin: s 20090275667 - Use of allicin as preservative, as disinfectant, as antimicrobial or as biocidal agent: The present invention provides the use of allicin in (i) the treatment of leishmanimis; (b) as a disinfectant or biocidal treatment of aquatic species; (iii) as an antimicrobial agent for animal feed; (iv) as a preservative agent in foodstuffs; (v) as a water disinfectant or biocide; (vi) as an antiparasitic... Agent: Connolly Bove Lodge & Hutz LLP 20090275668 - Sprayable gel-type skin/mucosa-adhesive preparation and administration system using the preparation: The present invention provides a sprayable gel-type skin/mucosa-adhesive preparation comprising a gel formulation which contains an active pharmaceutical ingredient in a gel base material comprising a skin/mucosa-adhesive agent and an administration system comprising the preparation.... Agent: Hamre, Schumann, Mueller & Larson, P.C. 20090275669 - Flavor and fragrance composition: A flavor and fragrance composition with a cooling sensation effect comprising 1-(2-hydroxy-4-methylcyclohexyl)ethanone represented by the formula (1). The flavor and fragrance composition is added to a beverage or food product, a fragrance or cosmetic product, a daily utensil product, an oral composition, or a pharmaceutical product in the range of... Agent: Mcdermott Will & Emery LLP 20090275670 - Dog pheromone formulation and delivery system: The present invention is directed to a dog behavioral control system comprising a low melting point polymer or copolymer, an unsaturated long chain fatty alcohol, and a dog-appeasing pheromone to produce a solid slow release generator of the pheromone. The system is useful for making animal collars and the like.... Agent: Jacqueline S Larson 20090275671 - Two component bone cement composition for vertebroplasty: The invention is directed to an intrinsically radio-opaque two component bone cement, comprising a first component which contains at least one acrylate monomer and a second component which contains at least one initiator for the polymerisation of said acrylate monomer, wherein the at least one iodine containing radio-opacity providing polymer... Agent: Banner & Witcoff, Ltd. 20090275672 - Sustained-release tablet production process: A process is provided for efficiently producing sustained-release tablets having superior sustained-release properties capable of inhibiting the initial elution of a drug and allowing the drug to be completely eluted after a prescribed amount of time has elapsed. A process for producing sustained-release tablets comprising: dry granulating a mixture composed... Agent: Kenyon & Kenyon LLP 10/29/2009 > patent applications in patent subcategories.20090270308 - Controlled release implantable dispensing device and method: A dispensing device having a polymer which is combined with a therapeutic agent in the form of a microparticle or nanoparticle which is “hyper-compressed” to form a controlled release dispensing device and methods of locally administering a therapeutic agent using said microparticles.... Agent: Hedman & Costigan P.C. 20090270309 - Use of lactoferrin fragments and hydrolysates: The present invention relates to use of at least one lactoferrin fragment or a lactoferrin hydrolysate or a mixture thereof for stimulating skeletal growth, inhibiting bone resorption, stimulating chondrocyte proliferation, stimulating osteoblast proliferation, inhibiting osteoclast development or treating or preventing a skeletal, joint or cartilage disorder.... Agent: Fish & Richardson PC 20090270310 - Process for the preparation of a nutrient formulation: The present invention relates to a process for increasing the efficacy and/or bioavailability of a nutrient formulation or composition for the treatment and/or prevention of inflammatory processes associated with airway diseases such as asthma. In particular, the invention relates to a method of treating an airway disease in a subject... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw 20090270311 - Treatment of insulin resistance by modulating somatostatin using somatostatin receptor antagonists: The present invention provides the use of somatostatin antagonists for treating and preventing HISS-dependent insulin resistance and hemorrhage induced insulin resistance. The present further provides pharmaceutical compositions comprising a somatostatin antagonist and a pharmaceutically acceptable liver targeting compound.... Agent: Merchant & Gould PC 20090270326 - Cell death inhibitor: The present invention relates to an antioxidant response element (ARE) activator comprising a macrophage migration inhibitory factor (MIF) or a modified form thereof, an ARE activator comprising a combination of MIF or a modified form thereof and a substance capable of binding to MIF, and so on. These ARE activators... Agent: Edwards Angell Palmer & Dodge LLP 20090270324 - Complement depletion using recombinant human c-3 derivatives: The invention provides isolated polypeptides having complement-modulating activity. Specifically, the invention resides in the provision of isolated polypeptides having complement depleting properties, i.e. that effect an efficient consumption of complement in human serum. The current invention thus provides human C3 derivatives that are capable of forming C3 convertases exerting an... Agent: Morrison & Foerster LLP 20090270322 - G protein coupled receptor antagonists and methods of activating and inhibiting g protein coupled receptors using the same: The invention relates generally to G protein coupled receptors and in particular to agonists and antagonists of G protein receptors and methods of using the same.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c 20090270325 - Growth factor: We describe a chimeric protein comprising a growth hormone polypeptide linked to a polypeptide comprising the extracellular binding domain of growth hormone receptor; its use in enhancing the growth and metabolism of non-human animals and homodimers comprising said chimeric protein.... Agent: Morgan, Lewis & Bockius LLP (sf) 20090270316 - Her-2 binding antagonists: There is disclosed a pharmaceutical composition for treating solid tumors that overexpress HER-2, comprising an agent selected from the group consisting of (a) an isolated polypeptide having from about 50 to 79 amino acids taken from the sequence of SEQ ID NO:1, wherein the polypeptide binds to the extracellular domain... Agent: Davis Wright Tremaine, LLP/seattle 20090270318 - High-affinity antagonists of elr-cxc chemokines: The present invention provides novel polypeptide sequences, methods for production thereof and uses thereof for novel ELR-CXC chemokine receptor agonists and antagonists.... Agent: Ade & Company Inc. 20090270312 - Hiv-i gp41 fusion peptides for immunomodulaltion: The present invention provides pharmaceutical compositions and methods for prevention or treatment of autoimmune diseases and other T cell mediated inflammatory diseases and conditions, which comprise as an active ingredient an effective quantity of a peptide derived from HIV gp41 fusion peptide domain or fragments, analogs, homologs and derivatives thereof.... Agent: Fennemore Craig 20090270327 - Lepidopteran-active bacillus thuringiensis delta-endotoxin compositions and methods of use: Disclosed are Bacillus thuringiensis strains comprising novel crystal proteins which exhibit insecticidal activity against lepidopteran insects. Also disclosed are novel B. thuringiensis genes and their encoded crystal proteins, as well as methods of making and using transgenic cells comprising the novel nucleic acid sequences of the invention.... Agent: Howrey LLP 20090270315 - Method of inhibiting angiogenesis by using ephrin b2: The compositions of the present invention include an effective amount of an ephrinB2, while the methods of the present invention include a step of administering an effective amount of an ephrinB2. The compositions and methods of the present invention is useful in treatment of a disease or disorder related to... Agent: Osha Liang L.L.P. 20090270313 - Method of treatment for ischemic heart disease: The present invention provides a method of treatment for ischemic heart disease administering a scar formation accelerator containing at least one selected from SFRP2, SFRP4, Midkine, Pleiotrophin and Thymosin beta-10 as an effective ingredient to promote scar formation less fibrosis and retaining elasticity, and thereby improving cardiac function.... Agent: Edwards Angell Palmer & Dodge LLP 20090270323 - Methods for treatment of insulin-like growth factor-1 (igf-1) deficiency: The present invention provides methods and compositions for increasing the growth rates, alleviating the symptoms, or improving the metabolism of human patients having insulin-like growth factor-I deficiency (IGFD). The invention relates to methods comprising administering insulin-like growth factor-I to a patient having a height which, at the time of treatment... Agent: Bozicevic, Field & Francis LLP 20090270329 - Methods of administering porcine b-domainless fviii: The present invention provides a method of administering porcine B-domainless factor VIII (OBI-1) to a patient having factor VIII deficiency to provide more rapid and effective protection against bleeding episodes, compared to formerly available methods, or to provide more effective protection to such patients during non-bleeding periods. This invention is... Agent: Greenlee Winner And Sullivan P C 20090270328 - Methods of increasing cerebral blood flow: Methods of increasing blood flow in a mammalian brain blood vessel characterized by, or otherwise experiencing, decreased blood flow due to an ischemic or other hypoxic event, vasoconstriction or vasospasm following hemorrhagic stroke; due to chronic high blood pressure; and/or due to idiopathic causes are provided. The method for increasing... Agent: King & Spalding LLP 20090270331 - Multi-domain amphipathic helical peptides and methods of their use: Disclosed herein are peptides or peptide analogs with multiple amphipathic α-helical domains that promote lipid efflux from cells via an ABCA1-dependent pathway. Also provided herein are methods of using multi-domain amphipathic α-helical peptides or peptide analogs to treat or inhibit dyslipidemic disorders. Methods for identifying non-cytotoxic peptides that promote ABCA1-dependent... Agent: Klarquist Sparkman, LLP 20090270321 - Over-expression of mps-1 gene or its gene product(s) results in reduction in size of a variety of malignancies: Elevation of MPS-1 in HNSCC samples and its structure/function as a ribosomal ZFP have led us to conclude that MPS-1 might be a subject of interest for malignant tumor therapy. Our data reveal that enhanced expression of MPS-1 protein can strongly suppress tumor cell proliferation. MPS-1 and significantly inhibits tumor... Agent: Brendan C. Stack, Jr., Md 20090270317 - Pharmaceutical compositions comprising bioelastomer fusion proteins: Bioelastomers are disclosed for use in methods of binding compounds including immunoassay methods, in biosensors and methods or regenerating biosensors, and in methods for targeting the delivery of a compound to a particular location within an animal subjects. In general, the bioelastomer is conjugated to a binding compound, which is... Agent: Cooley Godward Kronish LLP Attn: Patent Group 20090270319 - Pharmaceutical use of protein molecules immunologically correlated to diptheria toxin: Protein molecules immunologically correlated to diphtheria toxin are proposed for the treatment of atherosclerosis and further correlated pathologies.... Agent: Alston & Bird LLP 20090270314 - Polypeptide having anti-angiogenic activity: The present inventors found out four kinds of fragments (42 kD, 36 kD, 32 kD, 27 kD) by forcibly expressing vasohibin in a vascular endothelial cell. The present inventors analyzed those fragments and, as a result, found out low molecular weight vasohibin which has an anti-angiogenic activity. The low molecular... Agent: Birch Stewart Kolasch & Birch 20090270330 - Purified arabinogalactan-protein (agp) composition useful in the treatment psoriasis and other disorders: A purified Arabinogalactan-Protein (AGP) composition isolated through a selective method from the leaves and/or stems of Argemone mexicana plant is described. Also described is a purified Arabinogalactan-Protein (AGP) composition isolated from the leaves and/or stems of Argemone mexicana plant, which has one or more of the following effects: immunosuppression, lymphoproliferation... Agent: Ladas & Parry LLP 20090270320 - Use of galectin-7 to promote the re-epithelialization of wounds: Methods for the therapeutic treatment of epithelial wounds in mammals comprising administering to a mammal afflicted with an epithelial wound a therapeutically effective amount of a galectin-3 protein and/or a galectin-7 protein are provided. Pharmaceutical compositions comprising a pharmaceutically suitable carrier or diluent and as an active agent a galectin-3... Agent: Lawson & Weitzen, LLP 20090270332 - Genetic polymorphisms associated with venous thrombosis, methods of detection and uses thereof: The present invention is based on the discovery of genetic polymorphisms that are associated with venous thrombosis. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods... Agent: Celera Corporation 20090270333 - Methods of using motilin homologs: The present invention is directed to polynucleotides, polypeptides and peptide fragments thereof, and uses thereof for a novel cDNA sequence which has homology to motilin. Tissue distribution of the mRNA for the novel polypeptide is specific to the stomach, small intestine and pancreas. The present invention further includes agonists, antagonists,... Agent: Amgen Inc. Law Department 20090270334 - Neuronal differentiation inhibitor peptide and use thereof: Disclosed is a neuronal differentiation inhibitor which comprises at least one peptide capable of inhibiting or controlling the neuronal differentiation of at least one cell capable of being differentiated into a neuronal cell. The peptide is an artificially synthesized peptide which comprises a BC-box derived amino acid sequence comprising at... Agent: Turocy & Watson, LLP 20090270335 - Collyrium for dry eye: A composition for treating dry eye includes eledoisin formulated in an ester form and a phospholipid formulated in a micellar form.... Agent: Patrick R. Scanlon Preti Flaherty Beliveau & Pachios LLP 20090270337 - Composition comprising carbohydrates and peptides which comprise tryptophan: An edible composition comprising peptides rich in tryptophan, which edible composition further comprises a rapidly available glucose composition and a slowly available glucose composition.... Agent: Unilever Patent Group 20090270336 - Piperazine derivatives: This invention relates to novel compounds that are piperazine derivatives, and pharmaceutically acceptable salts thereof. More specifically, the invention relates to novel piperazine compounds that are derivatives of the chemokine CCR5 receptor antagonist, vicriviroc. This invention also provides pyrogen-free compositions comprising one or more compounds of the invention and a... Agent: Hamilton, Brook, Smith & Reynolds, P.C. 20090270338 - Diaryl-cyclylalkyl derivatives as calcium channel blockers: Methods and compounds effective in ameliorating conditions characterized by unwanted calcium channel activity, particularly unwanted N-type and/or T-type calcium channel activity are disclosed. Specifically, a series of compounds of substituted or unsubstituted N-cyclylalkyl-diphenylpropanamide derivatives as shown in formula (1).... Agent: Morrison & Foerster LLP 20090270339 - Unit dose form of glufosfamide: A lyophilized unit dose form containing about 2 g of glufosfamide is useful in treatment of cancer and other hyper-proliferative diseases.... Agent: Townsend And Townsend And Crew, LLP 20090270479 - Genetic and epigenetic alterations in the diagnosis and treatment of cancer: Methylation of DNA in regions involved in transcriptional regulation can induce the binding of ICBP90 and the subsequent formation of multiprotein complexes which alter gene transcription. DNA methylation in tumor suppressor genes, or in other genes which are involved in mitigating tumorigenesis, can induce binding of ICBP90 to those genes.... Agent: William J Mcnichol Jr Reed Smith 20090270480 - Markers and methods for assessing and treating psoriasis and related disorders: A method for prognostic or diagnostic assessment of a skin-related disorder, such as psoriasis, in a subject correlates the presence, absence, and/or magnitude of a gene in a sample with a reference standard to determine the presence and/or severity of the disorder, and/or the response to treatment for the disorder.... Agent: Philip S. Johnson Johnson & Johnson 20090270481 - Modified sirna molecules and uses thereof: The present invention provides chemically modified siRNA molecules and methods of using such siRNA molecules to silence target gene expression. Advantageously, the modified siRNA of the present invention is less immunostimulatory than its corresponding unmodified siRNA sequence and retains RNAi activity against the target sequence. The present invention also provides... Agent: Townsend And Townsend And Crew, LLP 20090270482 - Analysis of methylated nucleic acid: The present invention provides a method for analysis methylation patterns in DNA and identifying aberrantly methylated genes in disease tissue. The invention also provides a method of identifying novel targets for therapeutic intervention and disease markers. Novel cancer targets are provided.... Agent: Novartis Corporate Intellectual Property 20090270485 - Cell specific replication-competent viral vectors comprising a self processing peptide cleavage site: Cell specific replication-competent viral vectors comprising a self processing peptide cleavage sequence are provided. The targeted replication-competent viral vectors include two or more co-transcribed genes under transcriptional control of the same heterologous transcriptional regulatory element (TRE), wherein at least a second gene is under translational control of a self processing... Agent: Ropes & Gray LLP 20090270487 - Compositions and methods for inhibiting the synthesis or expression of mmp-1: The present invention relates to the specific inhibition of matrix metalloproteinase 1 (MMP-1) using agents which inhibit the synthesis or expression of MMP-1. Such agents are useful for suppressing invasion or metastasis of a tumor cell and in the treatment, prevention and management of cancer.... Agent: Licata & Tyrrell P.C. 20090270486 - Human rnase iii and compositions and uses thereof: The present invention provides polynucleotides encoding human RNase III and polypeptides encoded thereby. Methods of using said polynucleotides and polypeptides are also provided.... Agent: Isis Pharmaceuticals Inc 20090270489 - Long-acting polypeptides and methods of producing same: A polypeptide and polynucleotides encoding same comprising at least two carboxy-terminal peptides (CTP) of chorionic gonadotrophin attached to a peptide-of-interest are disclosed. Pharmaceutical compositions comprising the polypeptide and polynucleotides of the invention and methods of using same are also disclosed.... Agent: Pearl Cohen Zedek Latzer, LLP 20090270490 - Methods involving aldose reductase inhibition: Embodiments of the invention include methods and compositions involving aldose reductase inhibitors for the treatment of inflammation, including inflammatory bowel disease, macular degeneration, or posterior capsule opacification.... Agent: Fulbright & Jaworski L.L.P. 20090270491 - Modulation of tudor-sn expression: Compounds, compositions and methods are provided for modulating the expression of Tudor-SN. The compositions comprise oligonucleotides, targeted to nucleic acid encoding Tudor-SN. Methods of using these compounds for modulation of Tudor-SN expression and for diagnosis and treatment of diseases and conditions associated with expression of Tudor-SN are provided.... Agent: Knobbe, Martens, Olson & Bear, LLP 20090270483 - Pancreatic cancer genes: The present invention provides the art with the DNA coding sequences of polynucleotides that are up-or-down-regulated in cancer and dysplasia. These polynucleotides and encoded proteins or polypeptides can be used in the diagnosis or identification of cancer and dysplasia. Inhibitors of the up-regulated polynucleotides and proteins can decrease the abnormality... Agent: Novartis Vaccines And Diagnostics, Inc. Corporate Intellectual Property-r338 20090270488 - Process for the selection of hiv-1 subtype c isolates, selected hiv-1 subtype isolates, their genes and modifications and derivatives thereof: Embodiments of the invention provide processes for the selection of HIV-1 subtype (clade) C isolates, selected HIV-1 subtype C isolates, their genes and modifications and derivatives thereof for use in prophylactic and therapeutic vaccines to produce proteins and polypeptides for the purpose of eliciting protection against HIV infection or disease.... Agent: Kilpatrick Stockton LLP 20090270484 - Wwox vectors and uses in treatment of cancer: The present invention provides novel methods and compositions for the diagnosis, prognosis and treatment of cancer in a subject, by administering to the subject a polynucleotide encoding a functional WWOX gene product.... Agent: Macmillan Sobanski & Todd, LLC 20090270340 - Methods of administering antitumor agent comprising deoxycytidine derivative: Antitumor treatment regimens comprising: administering, to a patient diagnosed with cancer, an antitumor agent comprising 4-amino-1-(2-cyano-2-deoxy-β-D-arabinofuranosyl)-2(1H)-pyrimidinone, or a salt thereof, by way of continuous intravenous infusion, in an amount of 2.0 to 4.0 mg per m2 total body surface area of the patient, of 4-amino-1-(2-cyano-2-deoxy-β-D-arabinofuranosyl)-2(1H)-pyrimidinone equivalent, per day, for a... Agent: Greenblum & Bernstein, P.L.C 20090270341 - Product comprising a transduction inhibitor of heterotrimeric g protein signals combined with another anti-cancer agent for therapeutic use in the treatment of cancer: A composition for treating cancer comprising an anti-tumorally effective amount of a product comprising at least one transduction inhibitor of heterotrimeric G protein signals and at least one other anti-cancer agent selected from the group consisting of prenyltransferase inhibitors, taxol and its analogues, gemcitabine and camptothecin and its analogues, administered... Agent: Hunton & Williams LLP Intellectual Property Department 20090270342 - Immunoregulatory agent: An object of the present invention is to provide an immunoregulatory agent, which can be continuously ingested on daily diet and has no fear of causing side effects, and a method for regulating immunity. The present invention solves the above object by providing an immunoregulatory agent comprising lactosucrose as an... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw 20090270345 - Polymeric artificial tear system: The present invention relates to artificial tear formulations and ophthalmic formulations suitable for drug delivery. The formulations comprise galactomannans such as guar or hydroxypropyl guar and a borate source such as boric acid. The formulations further comprise a cis-diol such as sorbitol that interferes with the cross-linking of galactomannan and... Agent: Alcon 20090270343 - Polysaccharide extract of lentinus and pharmaceutical, cosmetic or nutraceutical compositions comprising such an extract: The present invention relates to a polysaccharide extract derived from a mushroom of the Lentinus genus and also to the method for preparing such an extract. This polysaccharide-rich extract can be used as a nutraceutical, cosmetic or pharmaceutical preparation.... Agent: Fulbright & Jaworski L.L.P. 20090270344 - Structure and bioactivity of the polysaccharides and oligomers in medicinal plant dendrobium huoshanense: Compositions and methods are disclosed relating to use of fractions, polysaccharides, and oligosaccharides of Dendrobium huoshanense. The fractions, polysaccharides, and oligosaccharides are able to effect an increase in beneficial cytokines and chemokines.... Agent: Luce, Forward, Hamilton & Scripps LLP 20090270347 - Methods of producing microparticles: Methods of producing microparticles, and especially chitin microparticles (CMP), are disclosed that involve reducing the size of (larger) particles using a (high shear) microfluidising instrument.... Agent: Frommer Lawrence & Haug 20090270346 - Protective gel based on chitosan and oxidized polysaccharide: Bodily tissue and structures may be protected using a fluid layer containing a mixture of chitosan and oxidized polysaccharide. The mixture forms a protective gel layer via in situ crosslinking. Compared to crosslinking using a low molecular weight aldehyde such as glutaraldehyde or genipin, oxidized polysaccharides appear to provide faster... Agent: Iplm Group, P.A. 20090270349 - Physical mode of action pesticide: A physical mode of action pesticide for application on plants and in soils, and methods of manufacture and application, comprising an active ingredient in the form of a polymer in a concentration of less than 0.1% wt., a surfactant, a co-solvent and a diluent in a hydrocolloid suspension. The suspension... Agent: Hedman & Costigan P.C. 20090270348 - Sulfoalkyl ether cyclodextrin compositions: SAE-CD compositions are provided, along with methods of making and using the same. The SAE-CD composition comprises a sulfoalkyl ether cyclodextrin and less than 100 ppm of a phosphate, wherein the SAE-CD composition has an absorption of less than 0.5 A.U. due to a drug-degrading agent, as determined by UV/vis... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c. 20090270350 - Pyridinone pyrazole urea and pyrimidinone pyrazole urea derivatives: This invention is directed generally to substituted pyridinone and pyrimidinone compounds that generally inhibit p38 kinase, TNF, and/or cyclooxygeπase activity. Such substituted pyridinone and pyrimidinone compounds include compounds generally corresponding in structure to the following formula: wherein Z, n, R1, R2a, R2b, R2c, R2d, R2e, R3a, R3b, R3c, R3d, R4,... Agent: Pfizer Inc. 20090270351 - Phosphorus derivatives as histone deacetylase inhibitors: The present invention relates to a novel class of phosphorus derivatives. The phosphorus compounds can be used to treat cancer. The phosphorus compounds can also inhibit histone deacetylase and are suitable for use in selectively inducing terminal differentiation, and arresting cell growth and/or apoptosis of neoplastic cells, thereby inhibiting proliferation... Agent: Merck And Co., Inc 20090270352 - Tenofovir disoproxil hemi-fumaric acid co-crystal: The present invention provides a novel crystalline form of Tenofovir disoproxil fumarate (Tenofovir DF), designated Co-crystal TDFA 2:1, methods for the preparation thereof and its use in pharmaceutical applications, in particular in anti-HIV medicaments. The crystalline form TDFA 2:1 can be used in combination with other anti-HIV medicaments such as... Agent: Hoffmann & Baron, LLP 20090270353 - Compounds for the treatment of proliferative disorders: e 20090270354 - Method of removing ticks from the skin and reducing the risk of bites: Compositions and method of using the same for the removal of ticks embedded in the skin or tissue of a human or animal host and for preventing ticks from attaching themselves to and biting humans or other animals.... Agent: Edward S. Wright 20090270355 - Compounds: m 20090270356 - Compositions and treatments of heart failure in non-human mammal animals: The invention relates to new compositions comprising an aldosterone antagonist according to a particular posology for the treatment of heart failure in non-human mammal animals.... Agent: Law Offices Of Albert Wai-kit Chan, PLLC 20090270357 - Method and use of nanoparticles to bind biocides in paints: This invention relates to the use of a combination of selected substances in paint to prevent the settlement and growth of different biofouling organisms with a reduced negative effect on the ecosystems compared to present methods.... Agent: Lynn E Barber 20090270358 - Pharmaceutical formulation of clavulanic acid: The present invention generally relates to stable pharmaceutical compositions, and methods of making and administering such compositions. In one aspect, the invention features stabilized pharmaceutical compositions that include pharmaceutically active ingredients such as potassium clavulanate or Clavitesse™, preferably in an immediate-release solid dosage form or an extended-release solid dosage form.... Agent: Venable LLP 20090270360 - Dicarboxamide derivatives: e 20090270359 - Substituted pyrazole derivatives: wherein R1 is a hydrogen atom, a group via a carbon atom, a group via a nitrogen atom, a group via an oxygen atom, or a group via a sulfur atom; R2 is a phenyl group having cyano (the phenyl group may further have substituent(s) other than cyano); R3 is... Agent: Edwards Angell Palmer & Dodge LLP 20090270361 - Substituted pyrazole derivatives and use thereof: e 20090270363 - 2-aryl- and 2-heteroarylthiazolyl compounds, methods for their preparation and use thereof: The present invention discloses fused bicyclic 2-aryl- or 2-heteroarylthiazolyl compounds and their pharmaceutically acceptable salts and esters thereof, which are useful for inhibiting the growth of cancerous cells, inhibiting human breast carcinoma tumor growth in particular and to treat diseases or disorders associated with securin, including elevated securin levels.... Agent: Wyeth Patent Law Group 20090270362 - Bicyclic mglur5 positive allosteric modulators and methods of making and using same: In one aspect, the invention relates to bicyclic MGluR5 positive allosteric modulators, for example 6-(phenylethynyl)-3,4-dihydroisoquinolin-1(2H)-one, derivatives thereof, and related compounds, which are useful as positive allosteric modulators of the metabotropic glutamate receptor subtype 5 (mGluR5); synthetic methods for making the compounds; pharmaceutical compositions comprising the compounds; and methods of treating... Agent: Ballard Spahr Andrews & Ingersoll, LLP 20090270364 - Substituted pyrimidine derivatives: 20090270365 - Benzamide derivative or salt thereof: A benzamide derivative or a salt thereof wherein a benzene ring is attached to a D ring (a monocyclic or bicyclic hydrocarbon ring or a monocyclic or bicyclic heteroaromatic ring) through an amide bond, the benzene ring is directly bonded to an E ring (a monocyclic or bicyclic hydrocarbon ring... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090270366 - Benzoimidazole compounds: Benzoimidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson 20090270367 - Substituted hydroxyethylamine aspartyl protease inhibitors: The invention relates to novel compounds and also to methods of treating at least one disease, disorder, or condition associated with amyloidosis using such compounds. Amyloidosis refers to a collection of diseases, disorders, and conditions associated with abnormal deposition of A-beta protein.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20090270368 - Angiogenesis inhibition by cephalotaxine alkaloids, derivatives, compositions and uses thereof: The invention relates to compositions and methods useful in treating or preventing angiogenic disease. The invention provides for compositions comprising cephalotaxine alkaloids as antiangiogenic agents for treatment of a host with an angiogenic disease or for prophylactic treatment of a host to inhibit the onset or progression of an angiogenic... Agent: Morgan, Lewis & Bockius, LLP 20090270369 - Bicycloamine derivatives: e 20090270370 - Fused heterocyclic compounds: Certain fused pyrrole- and pyrazole-containing heterocyclic compounds are serotonin modulators useful in the treatment of serotonin-mediated diseases.... Agent: Philip S. Johnson Johnson & Johnson 20090270371 - Quinoline derivatives useful in the treatment of mglur5 receptor-mediated disorders: Compounds of formula (I): and/or enantiomers and/or racemates and/or diastereomers and/or pharmaceutically acceptable salts thereof formed with acids or bases, to the process for their preparation, to the intermediates of the preparation process, to the pharmaceutical formulations containing these compounds and to their use in the prevention and/or treatment of... Agent: Fish & Richardson P.C. 20090270372 - Novel derivatives of benzimidazole and imidazo-pyridine and their use as medicaments: A subject of the present Application is novel derivatives of benzimidazole and imidazopyridine which have a good affinity for certain sub-types of melanocortin receptors, in particular the MC4 receptors. They are particularly useful for treating pathological conditions and diseases in which one or more melanocortin receptors are involved. The invention... Agent: Hunton & Williams LLP Intellectual Property Department 20090270373 - Treatment of down syndrom with benzodiazepine receptor antagonists: Pharmaceutical compositions and methods of treating Down Syndrome, mental retardation or both are provided. The pharmaceutical compositions comprise one or more benzodiazepine receptor antagonists, such as flumazenil.... Agent: Wilson, Sonsini, Goodrich & Rosati 20090270374 - Derivatives and analogs of n-ethylquinolones and n-ethylazaquinolones: Bicyclic nitrogen containing compounds and their use as antibacterials.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20090270375 - Spiro antibiotic derivatives: The invention relates to compounds of formula (I) wherein R1 represents H, alkyl, alkoxy, cyano or halogen; one of U and X represents CH or N and the other represents CH, or, in the case of U, may also represent CRa and, in the case of X, may also represent... Agent: Hunton & Williams LLP Intellectual Property Department 20090270376 - Heterocyclic janus kinase 3 inhibitors: The present invention provides a compound of formula (I) having an excellent JAK3 inhibition activity and being useful as an active ingredient of an agent for treating and/or preventing various immune diseases including autoimmune diseases inflammatory diseases, and allergic diseases. The compound according to the present invention has an inhibition... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090270377 - Combination cancer chemotherapy: Provided is a method for improving treatment of a neoplastic condition by combining a therapeutically effective amount of a polyADP-ribose polymerase inhibitor with a therapeutically effective amount of a compound which triggers the release of nucleolin from the G-quadruplexes in rDNA. As specifically exemplified, the compound which increases nucleolin binding... Agent: Greenlee Winner And Sullivan P C 20090270378 - Novel tetrahydropyridothiophenes: Compounds of a certain formula (I), in which Ra and Rb have the meanings indicated in the description, are novel effective compounds with anti-proliferative and/or apoptosis inducing activity.... Agent: Millen, White, Zelano & Branigan, P.C. 20090270379 - Quinolone derivatives useful as antibacterial agents: The present invention is directed to quinolone derivatives, useful as antimicrobial compounds, pharmaceutical compositions comprising said derivatives and the use of said derivatives and pharmaceutical compositions as antimicrobial agents against pathogenic microorganisms, particularly against resistant microbes... Agent: Philip S. Johnson Johnson & Johnson 20090270380 - 3,4,5-substituted piperidines as renin inhibitors: The application relates to novel substituted piperidines of the general formula (II) in which R1, R2′, R2″, R4′, X, Z, m and n have the meanings defined in the description, to a process for the preparation thereof and to the use of these compounds as medicines, especially as renin inhibitors.... Agent: Wenderoth, Lind & Ponack, L.L.P. 20090270381 - Non-steroidal progesterone receptor modulators: e 20090270383 - Novel oxabispidine compounds and their use in the treatment of cardiac arrhythmias: There is provided compounds of formula (I), wherein R1, R2, R3, R4, R41 to R46, A, B and G have meanings given in the description, which are useful in the prophylaxis and in the treatment of arrhythmias, in particular atrial and ventricular arrhythmias.... Agent: Pepper Hamilton LLP 20090270382 - Soluble epoxide hydrolase inhibitors: Disclosed are amide, thioamide, urea and thiourea compounds and compositions that inhibit soluble epoxide hydrolase (sEH), methods for preparing the compounds and compositions, and methods for treating patients with such compounds and compositions. The compounds, compositions, and methods are useful for treating a variety of sEH mediated diseases, including hypertensive,... Agent: Foley & Lardner LLP 20090270384 - Morpholine dopamine agonists: s 20090270385 - Substituted arylcyclopentenes as therapeutic agents: 20090270387 - Substituted arylcyclopentenes as therapeutic agents: 20090270386 - Therapeutic compounds: 20090270388 - Fused azole-pyrimidine derivatives: 20090270389 - Pyrimidinyl pyridone inhibitors of kinases: are defined as described herein, which inhibit JNK. The compounds disclosed herein are useful to modulate the activity of JNK and treat diseases associated with excessive JNK activity. The compounds are useful to treat autoimmune, inflammatory, metabolic, and neurological diseases as well as cancer. Also disclosed are compositions comprising the... Agent: Roche Palo Alto LLC Patent Law Dept. M/s A2-250 20090270390 - Pyrimidine derivatives: The invention concerns pyrimidine derivatives of Formula (I) wherein each of p, R1, R2, q, R3, r, R4, X1 and Q1 have any of the meanings defined in the description; processes for their preparation, pharmaceutical compositions containing them and their use in a method for producing an anti-proliferative effect in... Agent: Astrazeneca R&d Boston 20090270391 - Thienopyridine derivative, or quinoline derivative, or quinazoline derivative, having c-met autophosphorylation inhibiting potency: wherein R1 represents H or a substitutable unsaturated five- or six-membered heterocyclic ring; R2 represents H; X represents CH or N; Z represents O or S; E is absent or represents halogen, alkyl, or alkoxy; J represents S or O; and T represents phenyl, an unsaturated five- or six-membered heterocyclic... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090270394 - Cyclylamine derivatives as calcium channel blockers: Methods and compounds effective in ameliorating conditions characterized by unwanted calcium channel activity, particularly unwanted N-type and/or T-type calcium channel activity are disclosed. Specifically, a series of compounds of substituted or unsubstituted cyclylamine derivatives as shown in formulas (1).... Agent: Morrison & Foerster LLP 20090270393 - Iminopyridine derivatives and use thereof: t 20090270392 - Substituted gamma lactams as therapeutic agents: Therapeutic compounds, compositions, medicaments, and methods are disclosed herein.... Agent: Allergan, Inc. 20090270395 - Ep4 receptor agonist, compositions and methods thereof: This invention relates to potent selective agonists of the EP4 subtype of prostaglandin E2 receptors, their use or a formulation thereof in the treatment of glaucoma and other conditions, which are related to elevated intraocular pressure in the eye of a patient. This invention further relates to the use of... Agent: Merck And Co., Inc 20090270396 - Therapeutic compounds: i 20090270397 - Methods and compositions for the treatment of cancers, such as melanomas and gliomas: A method of potentiating the efficacy of an antineoplastic agent such as temozolomide, comprises the administration of an antifolate agent as defined herein. Also disclosed are compositions, including pharmaceutical compositions, comprising the antineoplastic agent and an antifolate agent, and the use of such compounds and compositions thereof to treat a... Agent: Klauber & Jackson 20090270398 - Compounds, compositions and methods comprising pyridazine derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP 20090270399 - Novel pyridazine derivatives and medicines containing the same as effective ingredients: wherein R1 represents a (substituted) aryl group, R2 represents a phenyl group substituted at 4-position by a lower alkoxyl, group or a lower alkylthio group, R3 represents a lower alkoxyl group, a halogenated lower alkyl group, a lower cycloalkyl group, a (substituted) aryl group, a (substituted) aryloxy group, a (substituted)... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090270403 - Novel 1,4-diaza-bicyclo[3.2.2]nonyl pyrimidinyl derivative and its medical use: Due to its pharmacological profile the compound of the invention may be useful for the treatment of diseases or disorders as diverse as those related to the cholinergic system of the central nervous system (CNS), the peripheral nervous system (PNS), diseases or disorders related to smooth muscle contraction, endocrine diseases... Agent: Birch Stewart Kolasch & Birch 20090270402 - Novel triazolopyridazines: e 20090270404 - Oxymethylene aryl compounds and uses thereof: Use of oxymethylene aryl GPR119 agonists and DPP IV inhibitors for the treatment of diabetic diseases, including Type II diabetes and other diseases associated with poor glycemic control are provided.... Agent: Metabolex, Inc. 20090270400 - Painkilling association comprising a dihydroimidazopyrazine derivative: The invention relates to a product comprising (1R)-1-[(({2R)-2-amino-3-[(8S)-8-(cyclohexylmethyl) -2-phenyl-5,6-dihydroimidazo [1,2-a]pyrazin-7(8H)-yl]-3-oxopropyl}dithio)methyl]-2-[(8S)-8-(cyclohexylmethyl) -2-phenyl-5,6-dihydrolmidazo[1,2-a]pyrazin-7(8H)-yl]-2-oxoethylamine in association with an analgesic agent selected from morphine, the similar or a morphine derivative, sodium channel inhibitors, non-steroidal antiflammatory agents (AINS), glutamatergic system inhibitors, tricycle antidepressants and gabaergic derivatives for simultaneous therapeutic use which is separated or out... Agent: Hunton & Williams LLP Intellectual Property Department 20090270405 - Quinuclidine compounds as alpha-7 nicotinic acetylcholine receptor ligands: The disclosure provides compounds of formula I, including their salts, as well as compositions and methods of using the compounds. The compounds are ligands for the nicotinic α7 receptor and may be useful for the treatment of various disorders of the central nervous system, especially affective and neurodegenerative disorders.... Agent: Louis J. Wille Bristol-myers Squibb Company 20090270401 - Use of a dihydroimidazopyrazoine derivative for treating or preventing pain: The invention relates to the use of (1R)-1-[({(2R)-2-amino-3-[(8S)-8-(cyclohexylmethyl)-2-phenyl-5,6-dihydroimidazo[1,2-a]pyrazine-7(8H)-yl]-3-oxopropyl}dithio)methyl]-2-[(8S)-8-(cyclohexylmethyl)-2-phenyl-5,6-dihydroimidazo[1,2-a]pyrazine-7(8H)-yl]-2-oxoethylamine or an pharmaceutically acceptable salt thereof for preparing a drug for preventing or treating pain.... Agent: Hunton & Williams LLP Intellectual Property Department 20090270406 - Combination therapy for the treatment of urinary frequency, urinary urgency and urinary incontinence: This invention concerns compositions for the treatment of urinary frequency, urinary urgency and urinary incontinence comprising (R)-N-[4-[2-[[2-hydroxy-2-(pyridin-3-yl)ethyl]amino]ethyl]phenyl]-4-[4-(4-tri-fluoromethylphenyl)thiazol-2-yl]benzenesulfonamide and pharmaceutically acceptable salts thereof. In another aspect, this invention concerns combination therapy for urinary frequency, urinary urgency and urinary incontinence wherein one of the active agents is (R)-N-[4-[2-[[2-hydroxy-2-(pyridin-3-yl)ethyl]amino]ethyl]phenyl]-4-[4-(4-tri-fluoromethylphenyl)thiazol-2-yl]benzenesulfonamide and pharmaceutically acceptable salts... Agent: Merck And Co., Inc 20090270407 - Fungicidal isoxazolidines: Also disclosed are compositions containing the compounds of Formula 1 and methods for controlling plant disease caused by a fungal pathogen comprising applying an effective amount of a compound or a composition of the invention.... Agent: E I Du Pont De Nemours And Company Legal Patent Records Center 20090270408 - Amide derivatives as positive allosteric modulators and methods of use thereof: The invention relates to novel amide derivatives that are PAMs of neuronal nicotinic receptors, compositions comprising the same, processes for preparing such compounds, and methods for using such compounds and compositions.... Agent: Paul D. Yasger Abbott Laboratories 20090270409 - Compounds and compositions as modulators of gpr119 activity: The invention provides compounds, pharmaceutical compositions comprising such compounds and methods of using such compounds to treat or prevent diseases or disorders associated with the activity of GPR119.... Agent: Genomics Institute Of The Novartis Research Foundation 20090270410 - Benzazole analogues and uses thereof: e 20090270411 - Phenanthridine derivatives as bradykinin antagonists: The present invention relates to new phenanthridine derivatives of formula (I), wherein the variables are as defined in the specification, to processes for producing the same, to pharmacological compositions containing the same and to their use in therapy or prevention of painful and inflammatory processes.... Agent: Fish & Richardson P.C. 20090270412 - Pyrido[3,4-b]indoles and methods of use: This disclosure relates to new heterocyclic compounds that may be used to modulate a histamine receptor in an individual. Pyrido[3,4-b]indoles are described, as are pharmaceutical compositions comprising the compounds and methods of using the compounds in a variety of therapeutic applications, including the treatment of a cognitive disorder, psychotic disorder,... Agent: Morrison & Foerster LLP 20090270413 - Di-t-butylphenyl piperazines as calcium channel blockers: Methods and compounds effective in ameliorating conditions characterized by unwanted calcium channel activity, particularly unwanted N-type and/or T-type calcium channel activity are disclosed. Specifically, a series of compounds containing di-t-butyl phenyl piperazine derivatives of the general formula (1).... Agent: Morrison & Foerster LLP 20090270414 - 2,3,4,9- tetrahydro-1h-carbazole derivatives as crth2 receptor antagonists: The invention relates to novel tetrahydro-1H-carbazole derivatives and their use as active ingredients in the preparation of pharmaceutical compositions. The invention also concerns related aspects including processes for the preparation of the compounds, pharmaceutical compositions containing one or more of those compounds and methods of treatment comprising administration of said... Agent: Hunton & Williams LLP Intellectual Property Department 20090270419 - Combinations of class-i specific histone deacetylase inhibitors with proteasome inhibitors: The present invention is concerned with combinations of a proteasome inhibitor and a class-I specific histone deacetylase inhibitor for inhibiting the growth of tumor cells, useful in the treatment of cancer.... Agent: Philip S. Johnson Johnson & Johnson 20090270415 - Compounds that inhibit protease cathepsin s and hcv replication: The present invention is directed to compounds that have the dual property of acting as cathepsin S inhibitors and of inhibiting HCV replication. Such compounds are therefore useful in treating disease states that include hepatitis C, Alzheimer's disease, and autoimmune disorders. The present invention is also directed to pharmaceutical compositions... Agent: Townsend And Townsend And Crew, LLP 20090270416 - N-oxides of diarylurea derivatives and their use as chk1 inhibitors for the treatment of cancer: The invention provides a Chk-1 kinase inhibiting compound of the formula (I) or a salt, solvate or tautomer thereof, wherein: G is CH2, O, NH, NHCO or CONH; A is a group (CH2)n where n is 1 to 4 provided that when G is O or NH, n is at... Agent: Heslin Rothenberg Farley & Mesiti PC 20090270417 - Organic compounds: Novel 3,4-di-, 3,3,4-di-, 3,4,4,-tri- and 3,3,4,4-tetra-substituted pyrrolidine compounds, these compounds for use in the diagnostic and therapeutic treatment of a warm-blooded animal, especially for the treatment of a disease (=disorder) that depends on inappropriate activity of renin; the use of a compound of that class for the preparation of a... Agent: Novartis Institutes For Biomedical Research, Inc. 20090270418 - Pyrazole pyrazine amine compounds as kinase inhibitors, compositions thereof and methods of treatment therewith: Wherein Q and R1-R3 are as defined herein, compositions comprising an effective amount of a Pyrazole Pyrazine Amine Compound and methods for treating or preventing inflammatory conditions, immunological conditions, cancer, neurodegenerative diseases, age-related diseases, cardiovascular diseases and metabolic conditions, or conditions treatable or preventable by inhibition of an IKK, or... Agent: Jones Day 20090270421 - Inhibitors of fatty acid amide hydrolase: Potent inhibitors of fatty acid amide hydrolase (FAAH) are constructed having Ki's below 200 pM and activities 102-103 times more potent than the corresponding trifluoromethyl ketones. The potent inhibitors combine several features, viz.: 1.) an α-keto heterocylic head group; 2.) a hydrocarbon linkage unit employing an optimal C12-C8 chain length;... Agent: Schwegman, Lundberg & Woessner, P.A. 20090270420 - Methods for inhibiting cardiac pai-1: The invention relates to methods of inhibiting cardiac PAI-1 by administering a PAI-1 antagonist.... Agent: Hunton & Williams LLP Intellectual Property Department 20090270423 - Antibacterial small molecules and methods for their synthesis: The present invention relates generally to compounds providing antibacterial therapeutic agents and preparations, and related methods of using and making antibacterial compounds. Antibacterial compounds of the present invention include chalcone, alkylpyrimidine, aminopyrimidine and cyanopyridine compounds and derivatives thereof exhibiting minimum inhibitory concentrations (MIC) similar to or less than conventional antibacterial... Agent: Greenlee Winner And Sullivan P C 20090270422 - Gpr119 receptor agonists in methods of increasing bone mass and of treating osteoporosis and other conditions characterized by low bone mass, and combination therapy relating thereto: The present invention relates to the use of GPR119 receptor agonists for treating or preventing a condition characterized by low bone mass, such as osteoporosis, and for increasing bone mass in an individual. The present invention further relates to the use of a GPR119 receptor agonist in combination with a... Agent: Fish & Richardson P.C. 20090270424 - Antibacterial small molecules and methods for their synthesis: A crystalline N-(4-(4-aminothieno[2,3-d]pyrimidin-5-yl)phenyl)-N′-[2-fluoro-5-(trifluoromethyl)phenyl)urea hydrochloride, ways to make it, compositions comprising it, and methods of treatment using it are disclosed.... Agent: Paul D. Yasger Abbott Laboratories 20090270425 - 3-(dihydro-1h-pyrazolo[4,3-d]pyrimidin-5-yl)-4-propoxybenzenesulfonamide derivatives and methods of use: This invention relates to novel 3-(dihydro-1H-pyrazolo[4,3-d]pyrimidin-5-yl)-4-propoxybenzenesulfonamide compounds, their derivatives, pharmaceutically acceptable salts, solvates, and hydrates thereof. This invention also provides compositions comprising a compound of this invention and the use of such compositions in methods of treating diseases and conditions that are beneficially treated by administering inhibitors of cyclic guanosine... Agent: Edwards Angell Palmer & Dodge LLP 20090270426 - P13 kinase antagonists: The present invention provides novel PI3-Kinase antagonists and methods of use thereof.... Agent: Townsend And Townsend And Crew, LLP 20090270427 - Purine derivatives: e 20090270429 - Antiviral formulation: A topical antiviral composition comprising acyclovir, penciclovir and/or omaciclovir in a glucocorticoid-free pharmaceutical carrier comprising 15 to 25 weight % propylene glycol and 10 to 25 weight % isopropyl C12-C22 alkanoic ester. The compositions have utility in the treatment or prophylaxis of herpesvirus infections. Clinical results demonstrate that treatment commencing... Agent: Birch Stewart Kolasch & Birch 20090270428 - Cyclopropanecarboxylate esters of acyclovir: The present invention provides compounds of Formula (I), pharmaceutical compositions thereof, methods of using the same, processes for preparing the same, and intermediates thereof.... Agent: Eli Lilly & Company 20090270430 - Pyridopyrimidinone inhibitors of pl3kalpha: e 20090270431 - Cyclopentenol nucleoside compounds intermediates for their synthesis and methods of treating viral infections: The present invention relates to compounds according to the structure (I), Where B is formula (Ia), formula (Ib) or formula (Ic); A is H, OR2 or halogen (F, Cl, Br, I, preferably F or Br, more preferably F); A′ is H, OR2 or halogen (F, Cl, Br, I, preferably F... Agent: Coleman Sudol Sapone, P.C. 20090270432 - 7-[2-[4-(6-fluoro-3-methyl-1,2-benzisoxazol-5-yl)-1-piperazinyl]ethyl]-2-(1-propynyl)-7h-pyrazolo-[4,3-e]-[1,2,4]-triazolo-[1,5-c]-pyrimidin-5-amine: e 20090270433 - 2,3-dihydro-iminoisoindole derivatives: 20090270434 - Azacycloalkane derivatives as inhibitors of stearoyl-coenzyme a delta-9 desaturase: Azacycloalkane derivatives of structural formula I are selective inhibitors of stearoyl-coenzyme A delta-9 desaturase (SCD1) relative to other known stearoyl-coenzyme A desaturases. The compounds of the present invention are useful for the prevention and treatment of conditions related to abnormal lipid synthesis and metabolism, including cardiovascular disease, such as atherosclerosis;... Agent: Merck And Co., Inc 20090270436 - Spirochromanon derivatives: The invention relates to a compound of a general formula (I): wherein Ar1 represents a group formed from an aromatic ring selected from a group consisting of benzene, pyrazole, isoxazole, pyridine, indole, 1H-indazole, 1H-furo[2,3-c]pyrazole, 1H-thieno[2,3-c]pyrazole, benzimidazole, 1,2-benzisoxazole, imidazo[1,2-a]pyridine, imidazo[1,5-a]pyridine and 1H-pyrazolo[3,4-b]pyridine, having Ar2, and optionally having one or two or... Agent: Merck And Co., Inc 20090270435 - Spiroketone acetyl-coa carboxylase inhibitors: The invention provides compounds of Formula (1) or a pharmaceutically acceptable salt of said compound, wherein R1, R2, R3, R4, R5, R6, R7, R8 and R9 are as described herein; pharmaceutical compositions thereof; and the use thereof in treating mammals suffering from the condition of being overweight.... Agent: Pfizer Inc. Patent Department 20090270437 - Use of buprenorphine or n-alkylated derivatives thereof for wound healing: This invention relates to opioid compounds such as burenorphine or N-alkylated derivatives thereof for wound healing.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association 20090270438 - Novel compositions and formulations: There is provided according to the invention a non-pressurised pharmaceutical liquid solution spray composition comprising: (i) buprenorphine; and a solvent comprising ethanol which composition is substantially free of chloride. There is also provided according to the invention a non-pressurised pharmaceutical liquid solution spray formulation comprising: (i) buprenorphine; (ii) a solvent... Agent: Klauber & Jackson 20090270439 - Prophylactic/therapeutic agent for alzheimer's disease: A medicament effective for inhibiting onset of Alzheimer disease via intracellular aggregation mechanism is provided. A medicament for prophylaxis and treatment of Alzheimer disease comprising as an active ingredient apomorphine hydrochloride wherein cell death dependent upon intracellularly accumulated amyloid β proteins and/or p53 is inhibited; and/or wherein a level of... Agent: Wenderoth, Lind & Ponack, L.L.P. 20090270440 - Bioavailability of active substances having an amidine function in medicaments: The invention relates to the use of N,N′-dihydroxyamidine (I), N,N′-dihydroxyamidine ether (II), N,N′-dihydroxyamidine diether (III), N,N′-dihydroxyamidine ester (IV), N,N′-dihydroxyamidine diester (V) or 4-hydroxy-1,2,4-oxadiazoline (VI) of the formulae cited above, wherein R represents hydrogen, an alkyl and/or aryl radical, as a substitute for an amidine function of a medicament for improving... Agent: Darby & Darby P.C. 20090270441 - Macrolides: The invention relates to the stabilization of poly-ene macrolides and to a particular macrolide obtained in crystalline form.... Agent: Novartis Corporate Intellectual Property 20090270443 - 1-amino imidazo-containing compounds and methods: Imidazo-containing compounds (e.g., imidazonaphthyridines, imidazopyridines) with an amino substituent at the 1-position, pharmaceutical compositions containing the compounds and methods of use of these compounds as immunomodulators, for inducing cytokine biosynthesis in animals and in the treatment of diseases including viral and neoplastic diseases are disclosed.... Agent: Wolf Greenfield & Sacks, P.C. 20090270444 - 1,7-naphthyridines: i 20090270447 - 2-aryl-and 2-heteroarylthiazolyl compounds, methods for their preparation and use thereof: The present invention discloses fused heterobicyclic 2-aryl- and 2-heteroarylthiazolyl compounds and their pharmaceutically acceptable salts and esters thereof, which are useful for inhibiting the growth of cancerous cells, inhibiting human breast carcinoma tumor growth in particular and to treat diseases or disorders associated with securin.... Agent: Wyeth Patent Law Group 20090270446 - Diamine derivatives: The present invention relates to diamine compounds which inhibit activated blood coagulation factor X and exhibit an anticoagulant effect and there uses for treating various diseases based on thromboembolism.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, P.C. 20090270448 - Pharmaceutical formulations comprising clopidogrel: Melt granulate in the form of a solid state dispersion of the drug in a pharmaceutically acceptable carrier, wherein said melt granulate comprises a pharmaceutically active compound, preferably clopidogrel, at least one carrier material, and optionally pharmaceutically acceptable excipients and method of making said melt granulate.... Agent: Birch Stewart Kolasch & Birch 20090270445 - Thiazole compounds and methods of use: The invention relates to methods of using thiazole compounds of Formula I and Formula II and compositions thereof for treating diseases mediated by protein kinase B (PKB) such as cancer and other proliferative disorders where the variables have the definitions provided herein.... Agent: Amgen Inc. 20090270449 - Aminophenyl derivatives as selective androgen receptor modulators: e 20090270450 - Chemical compounds: or pharmaceutically acceptable salts thereof which possess CSF-1R kinase inhibitory activity and are accordingly useful for their anti-cancer activity and thus in methods of treatment of the human or animal body. The invention also relates to processes for the manufacture of said chemical compounds, to pharmaceutical compositions containing them and... Agent: Astrazeneca R&d Boston 20090270451 - Piperdine glycine transporter inhibitors: The present invention is directed to piperidine compounds that inhibit the glycine transporter GlyT1 and which are useful in the treatment of neurological and psychiatric disorders associated with glycinergic or glutamatergic neurotransmission dysfunction and diseases in which the glycine transporter GlyT1 is involved.... Agent: Merck And Co., Inc 20090270452 - Use of soluble epoxide hydrolase inhibitors in the treatment of smooth muscle disorders: Disclosed herein are compounds, compositions, and methods for enhancing smooth muscle function in a subject by administration of soluble epoxide hydrolase inhibitors and for treating subjects with smooth muscle disorders including erectile dysfunction, overactive bladder, uterine contractions and irritable bowel syndrome.... Agent: Foley & Lardner LLP 20090270453 - Anti-manic effective doses of sertindole: The present invention relates to uses of an anti-manic effective dose sertindole in the preparation of a pharmaceutical composition for the treatment of mania, and to methods of treating mania comprising administering said effective dose of sertindole. In separate aspects of the invention, said uses and methods are directed to... Agent: Lundbeck Research Usa, Inc. Attention: Stephen G. Kalinchak, Legal 20090270454 - Sulfonamide containing compounds for treatment of inflammatory disorders: X and Y are independently selected from —CH2— or —CH2—CH2—; Z is selected from S(O)m or Se(O)m and m is 0, 1 or 2; R1 is optionally substituted heteroaryl or heterocyclic; R2 is selected from the group consisting of hydrogen, C1-C6 straight alkyl, and C1-C6 branched alkyl, wherein all may... Agent: King & Spalding 20090270455 - Therapeutic agent for intestinal diseases and visceral pain: The present invention relates to a therapeutic agent for irritable bowel syndrome of diarrhea type, ulcerative colitis, visceral pain or abdominal pain, which contains a compound of the following formula and which has 5-HT7 receptor antagonistic effect or an analogue thereof; and this therapeutic agent has an excellent therapeutic effect... Agent: The Nath Law Group 20090270456 - Novel chemical compounds: This invention relates to newly identified compounds for inhibiting hYAK3 and/or CK2 proteins and methods for treating diseases associated with the imbalance or inappropriate activity of hYAK3 and/or CK2 proteins.... Agent: Glaxosmithkline Corporate Intellectual Property Uw2220 20090270457 - 6,11-bicyclolides: bridged biaryl macrolide derivatives: which exhibit antibacterial properties. The present invention further relates to pharmaceutical compositions comprising the aforementioned compounds for administration to a subject in need of antibiotic treatment. The invention also relates to methods of treating a bacterial infection in a subject by administering a pharmaceutical composition comprising the compounds of the... Agent: Elmore Patent Law Group, PC 20090270459 - Flea control agent containing n-substituted indole derivative: Conventional control agents against fleas parasitic on animals do not have sufficient selective toxicity and are hence not safe for the animals to which the control agents are applied. The control agents are not always satisfactory also in control effect and quick-acting properties. Intensive studies were made on the insecticidal... Agent: Nields, Lemack & Frame, LLC 20090270458 - Method of treating of demyelinating diseases or conditions: N-(Pyridinyl)-1H-indol-1-amines of formula I provide a unique combination of blocking properties for both the potassium and sodium channels. These compounds are useful for the treatment of Demyelinating Diseases and Conditions such as Multiple Sclerosis, Spinal Cord Injury, Traumatic Brain Injury and Stroke. The compounds are also useful for Stroke Rehabilitation,... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC 20090270462 - 2-sulfanyl-substituted imidazole derivatives and their use as cytokine inhibitors: The invention relates to 2-thio-substituted imidazole derivatives of the Formula I, and to methods of use thereof.... Agent: Edwards Angell Palmer & Dodge LLP 20090270461 - Fungicide n-cycloalkyl-carboxamide, thiocarboxamide and n-substituted-carboximidamide derivatives: The present invention relates to N-cycloalkyl-carboxamide, N-cycloalkyl-thiocarboxamide and N-cycloalkyl-N-substituted carboximidamide derivatives of formula (I) wherein A represents carbo-linked, 5-membered heterocyclyl groups, T represents O, S, NRc, N—ORd, N—NRcRd or N—CN, Z1 represents cycloalkyl groups and Z2 and Z3, W1 to W5 represent various substituents; their process of preparation, their use... Agent: Ostrolenk Faber Gerb & Soffen 20090270460 - Fxr agonists: Compounds of formula wherein variables are as defined herein and their pharmaceutical compositions and methods of use are disclosed as useful for treating dyslipidemia and related diseases.... Agent: Eli Lilly & Company 20090270463 - Amido derivatives-contained pharmaceutical composition: The present invention relates to a pharmaceutical composition containing a solid dispersion comprising an amide derivative or a salt thereof and a water-soluble polymer, wherein the pharmaceutical composition is not prepared by a melting method. The pharmaceutical composition contains the solid dispersion having an improved oral absorption, properties suitable for... Agent: Townsend And Townsend And Crew, LLP 20090270464 - Benzimidazole derivative and use as a ii receptor antagonist: wherein R2, R3, R4, R5, R6, R7 and R8 are each independently a hydrogen atom or a C1-6 alkyl, or a salt thereof. The compound of the present invention is useful as an agent for the prophylaxis or treatment of circulatory diseases such as hypertension and the like and metabolic... Agent: Foley And Lardner LLP Suite 500 20090270466 - Epothilones c, d, e, and f, preparation and compositions: The present invention relates to epothilones C, D, E, and F, their preparation and their use for the production of therapeutic compositions and compositions for plant protection.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20090270465 - Use of epothilone d in treating tau-associated diseases including alzheimer's disease: Methods of treating Tau-associated diseases, preferably tauopathies, are described using epothilone D that exhibit good brain penetration, long half-life, and high selective retention in brain, and provides effective therapies in treating tauopathies including Alzheimer's disease.... Agent: Louis J. Wille Bristol-myers Squibb Company 20090270467 - Aminocyclohexanes as dipeptidyl peptidase-iv inhibitors for the treatment or prevention of diabetes: The present invention is directed to novel substituted aminocyclohexanes of structural formula (I) which are inhibitors of the dipeptidyl peptidase-IV enzyme and which are useful in the treatment or prevention of diseases in which the dipeptidyl peptidase-IV enzyme is involved, such as diabetes and particularly Type 2 diabetes. The invention... Agent: Merck And Co., Inc 20090270468 - Preparation and use of aryl alkyl acid derivatives for the treatment of obesity: This invention relates to certain aryl alkyl acid compounds, compositions, and methods for treating or preventing obesity and related diseases.... Agent: Edwards Angell Palmer & Dodge LLP 20090270469 - Substituted oxazolidinones: The present invention relates to new oxazolidinone modulators of skeletal muscle function and tone, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx 20090270470 - Compounds i: e 20090270471 - Method for inhibiting mycotoxin production: The present invention provides a method for prominently inhibiting the production in fungi of mycotoxin, which has serious effects on health of humans and other animals, and provides a mycotoxin production inhibitor. Mycotoxin content such as deoxinivalenol (DON) in harvested crops can be reduced without a correlation with the control... Agent: Kenyon & Kenyon LLP 20090270472 - Method to use oxymetazoline to interrupt the development of the common cold syndrome: This invention describes a new manner of treating the common cold. It claims that treatment with Oxymetazoline nasal spray at the time of onset of first cold symptom(s) can interrupt the development of the common cold syndrome and result in cure of the cold.... Agent: Kenneth Gould M.d. 20090270473 - Dual-acting antihypertensive agents: wherein: Q, W, Y, Z, r, and Ar are as defined in the specification, and pharmaceutically acceptable salts thereof. These compounds have AT1 receptor antagonist activity and neprilysin inhibition activity. The invention is also directed to pharmaceutical compositions comprising such compounds; methods of using such compounds; and process and intermediates... Agent: Theravance, Inc. 20090270474 - Therapeutic agent for keratoconjunctival disorder: An object of the present invention is to discover a new use of eprosartan or a salt thereof. Eprosartan or a salt thereof exhibits an excellent improving effect in a corneal disorder model, and therefore is useful as a therapeutic agent for a keratoconjunctival disorder such as dry eyes, corneal... Agent: Frishauf, Holtz, Goodman & Chick, PC 20090270475 - Inhibition of bacterial biofilms with imidazole-phenyl derivatives: Disclosure is provided for imidazole-phenyl derivative compounds that prevent, remove and/or inhibit the formation of biofilms, compositions comprising these compounds, devices comprising these compounds, and methods of using the same.... Agent: Myers Bigel Sibley & Sajovec 20090270476 - Pharmaceutical composition for treatment or prevention of nephritis and manufacturing method thereof: s 20090270477 - Polymorphs of a hydroisoindoline tachykinin receptor antagonist: This application is directed to a novel polymorph of a hydroisoindoline tachykinin receptor antagonist having the following structural formula A.... Agent: Merck And Co., Inc 20090270478 - Ion channel modulating activity ii: Methods, compositions, dosing regimes, and routes of administration for the treatment or prevention of arrhythmias. In these methods, arrythmias (e.g., atrial fibrillation, atrial flutter, early afterdepolarizations and prolongation of QT interval) may be reduced or eliminated by administering ion channel modulating compounds to a subject in need thereof. The ion... Agent: Seed Intellectual Property Law Group PLLC 20090270492 - Bryostatin analogues, synthetic methods and uses: Biologically active compounds related to the bryostatin family of compounds, including methods of utilizing the same.... Agent: King & Spalding LLP 20090270493 - Cyclic 1-(acyloxy)-alkyl prodrugs of gaba analogs, compositions and uses thereof: The present invention provides cyclic 1-(acyloxy)-alkyl prodrugs of GABA analogs, methods of making cyclic 1-(acyloxy)-alkyl prodrugs of GABA analogs and compositions of cyclic 1-(acyloxy)-alkyl prodrugs of GABA analogs. The present invention also provides methods of using cyclic 1-(acyloxy)-alkyl prodrugs of GABA analogs and compositions of cyclic 1-(acyloxy)-alkyl prodrugs of GABA... Agent: Xenoport, Inc. 20090270494 - Salts of dihydroxyanthraquinone carboxylic acids and their therapeutic use: A compound of general formula (I): wherein Xi is H or COR1 and X2 is H or COR2 but X1 and X2 are not both H; R1 and R2 are the same or different and are each C1-4 alkyl substituted with R3, or a four to seven-membered ring which can... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association 20090270495 - Inhibitors of phosphodiesterase types 1 to 5 based on dioclein, floranol, and analogs thereof: We disclose substances and a process of developing such substances as potent and selective inhibitors of isoforms of phosphodiesterases of types 1 to 5 (PDE1, PDE2, PDE3, PDE4, PDE5) based on two flavonoids: dioclein, floranol and natural or synthetic analogs thereof. They may be associated with cyclodextrins in inclusion complexes... Agent: Nixon & Vanderhye, PC 20090270496 - Antifungal compounds: Antifungal compounds having a benzofuran structure. Antifungals exhibit much less toxicity to human cells than amiodarone. These compounds are useful alone or in combination with other compounds having antifungal activity. Compounds of this invention exhibit synergistic antifungal activity in combination with antifungal amiodarone compounds. The invention provides pharmaceutical compositions useful... Agent: Greenlee Winner And Sullivan P C 20090270497 - Treatment of non-localized inflammation with pan-hdac inhibitors: Described herein are compositions and methods for treating a subject suffering from a non-localized inflammatory condition (or any symptoms associated with such inflammation), including systemic inflammation, and inflammatory conditions affecting the large portions of or the whole body, or sepsis by administering to the subject a pharmaceutical composition comprising a... Agent: Wilson, Sonsini, Goodrich & Rosati 20090270498 - Lipoxin compounds and their use in treating cell proliferative disorders: Compounds having the active site of natural lipoxins, but a longer tissue half-life are disclosed. In particular, 15-epi-lipoxins and their use in ameliorating undesired cell proliferation, which characterizes diseases such as cancer, are also disclosed.... Agent: Fulbright & Jaworski L.L.P. Attn: MnIPDocket 20090270499 - Process for synthesizing atazanavir: This invention relates to a process for synthesizing Atazanvir, including novel intermediates and novel steps to various intermediates along the synthetic pathway.... Agent: Fish & Richardson P.C. 20090270500 - 4-trimethylammonio-butyrates as cpt2 inhibitors: i 20090270501 - Composition and method for increasing the anabolic state of muscle cells: A nutritional supplement comprising at least a therapeutically effective amount of ethyl pyruvate and a therapeutically effective amount of at least one α-hydroxy branched-chain amino acid metabolite is provided by the present invention. The ingredients of the present nutritional supplement substantially simultaneously act to induce a anabolically-favorable state for muscle... Agent: Iovate Health Science Research Inc. 20090270502 - method for lowering risk of cardiovascular diseases: The present invention relates to a method for lowering risk of cardiovascular diseases in human, particularly for lowering low density lipoprotein cholesterol (LDL-C) concentration and oxidative stress level while maintaining sufficient high density lipoprotein cholesterol (HDL-C) concentration in human, and to a dietary formulation and a fat or fat blend... Agent: Birch Stewart Kolasch & Birch 20090270503 - Nutritional supplements: The present disclosure relates to novel nutritional methods and compositions containing essential fatty acids which optimize embryonic, fetal and child neurological development and provides improved nutritional support for women prior to and during lactation. Further the methods and compositions improve gestational length and birth weight. The nutritional methods and compositions... Agent: Kv Pharmaceutical Company 20090270504 - Treatment of huntington's disease with epa: Analysis of the huntington gene provides a method for identifying patients likely to respond to treatment of Huntington's disease with eicosapentaenoic acid, EPA.... Agent: Buchanan, Ingersoll & Rooney PC 20090270505 - 4-dimethylaminobutyric acid derivatives: wherein A1, A2, R1, m and n are as defined in the description and in the claims, as well as pharmaceutically acceptable salts thereof. These compounds inhibit carnitine palmitoyl transferase (CPT) activity, in particular CPT2 activity, and can be used as medicaments in methods for the treatment of diseases modulated... Agent: Hoffmann-la Roche Inc. Patent Law Department 20090270507 - Concentrated liquid thyroid hormone composition: This invention is directed generally to a liquid pharmaceutical composition comprising at least one thyroid hormone (particularly a composition further comprising at least one cyclodextrin compound), a process for making such a composition and a method of using such a composition to treat a condition associated with impaired thyroid hormone... Agent: Intervet/schering-plough Animal Health 20090270506 - Crystalline structure of oxidosqualene synthase: The present invention relates to crystal forms of mammalian OSC and the crystal structure information obtained from them, to methods of preparing such crystal forms, and to their use for the identification and/or design of inhibitors of OSC activity. A further subject matter of the invention are methods for the... Agent: Hoffmann-la Roche Inc. Patent Law Department 20090270508 - Glur2 receptor modulators: The present invention provides for compositions and methods for modulating the GluR2 receptor. It is based, at least in part, on the discovery, by X-ray crystallography, that a known GluR2 agonist binds to the receptor in two different orientations, thereby diminishing its potency. The present invention provides for structural alternatives... Agent: Kevin C. Hooper 20090270509 - Nitric oxide-releasing molecules: This invention relates to compositions comprising carbon-based diazeniumdiolates that release nitric oxide (NO). The carbon-based diazeniumdiolated molecules release NO spontaneously under physiological conditions without subsequent nitrosamine formation. The present invention also relates to methods of preparing the carbon-based diazeniumdiolated molecules, compositions comprising such molecules, methods of using such compositions, and... Agent: Pillsbury Winthrop Shaw Pittman, LLP 20090270510 - Glycine transport inhibitors: The present invention relates to compounds of formula (I), or salts or solvates thereof, their use in the manufacture of medicaments for treating neurological and neuropsychiatric disorders, in particular psychoses, dementia or attention deficit disorder. The invention further comprises processes to make these compounds and pharmaceutical formulations thereof.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20090270512 - Pan-antagonists for the androgen receptor and androgen receptor mutants associated with anti-androgen withdrawal: Disclosed herein are novel antagonists of the androgen receptor and androgen receptor mutations associated with clinical failure of currently prescribed anti-androgens and use of said antagonists in the treatment of conditions associated with inappropriate activation of the androgen receptor.... Agent: Potter Anderson & Corroon LLP Attn: Janet E. Reed, Ph.d. 20090270511 - Prodrugs of inhibitors of cathepsin s: The present invention provides compounds of formula (I) which are prodrugs of inhibitors of cathepsin S and as such are useful in the prevention and treatment of cathepsin S dependent diseases and conditions including, but not limited to, chronic obstructive pulmonary disease (COPD) and pain.... Agent: Merck And Co., Inc 20090270513 - 3,5-dihydroxy-2,4-cyclohexadienones and their derivatives, dietary compositions and fortified food containing them and their uses: The present invention refers especially to 3,5-dihydroxy-2,4-cyclohexadienones of the general formula (I) wherein R1 and R2 are independently from each other C1-6-alkyl, C2-6-alkenyl or x-oxo-Cx-alkyl with x being an integer from 1 to 6, preferably R1 and R2 are independently from each other C2-6-alkenyl or y-oxo-Cy-alkyl with y being an... Agent: Nixon & Vanderhye, PC 20090270515 - Active ingredient containing stabilised solid medicinal forms and method for the production thereof: The invention relates to solid medicinal forms containing at least one active ingredient and at least one pharmaceutically compatible, water soluble drying agent which is selected from the group consisting of trimagnesium dicitrate and/or calcium chloride, the solid medicinal form having a drying loss of at most 6% and a... Agent: Smith Patent Consulting, LLC 20090270514 - Methods for regulating gelation of polysaccharide solutions and uses thereof: The present invention provides a method for preparing chito san solutions to allow regulating the conditions in which the chitosan solution will gel. The present invention also provides methods for using chitosan solutions as compositions and for using chitosan solutions in vitro and in vivo.... Agent: University Of Virginia Patent Foundation 20090270516 - Process for producing optically active theaspirane: A simplified production method of stereoisomer of theaspiran having high optical purity has been desired. An alcohol compound having a specific skeleton is enantioselectively esterified with an enzyme, or an ester compound having a specific skeleton is enantioselectively hydrolyzed with an enzyme. The resultant optically active ester or optically active... Agent: Edwards Angell Palmer & Dodge LLP 10/22/2009 > patent applications in patent subcategories.20090264337 - Cellular gprs-communication linked glucometer - pedometer: The Cellular GPRS system includes a cellular-based Glucometer (CBG) for blood glucose monitoring, a pedometer for exertion measurement, combined with user-entered dietary or other diabetes-relevant information. Data from all inputs is transmitted over a cellular network, using a GPRS or other wireless link. The data is preferably stored in the... Agent: Eric P. Mirabel 20090264336 - Heteroaryl benzamide derivatives for use as glk activators in the treatment of diabetes: e 20090264338 - Inhibitor of insulin multimer formation: An insulin preparation having an ultra-rapid onset of action is provided by adding a substance that interacts with the insulin dimer formation surface or the hexamer formation surface to an insulin solution. The substance exerts its effect by inhibiting insulin dimer formation and/or hexamer formation.... Agent: Cermak Kenealy Vaidya & Nakajima LLP Acs LLC 20090264340 - Compositions and methods for increasing the oral absorption of antimicrobials: The present invention provides compositions and methods for increasing absorption of antibacterial agents, particularly third generation cephalosporin antibacterial agents, in oral dosage solid and/or suspension forms. Specifically, the composition is comprised of a biopolymer that is preferably swellable and/or mucoadhesive, a antimicrobial agent, and a cationic binding agent contained within... Agent: Fish & Richardson, P.C. 20090264339 - Heterocyclic compounds: This invention relates to heterocyclic compounds of the formulas shown in the specification. It also relates to methods for treating inflammatory diseases or immune diseases, developmental or degenerative diseases, and tissue injuries with one of the heterocyclic compounds.... Agent: Occhiuti Rohlicek & Tsao, LLP 20090264341 - Purified arabinogalactan-protein (agp) composition useful in the treatment psoriasis and other disorders: A purified Arabinogalactan-Protein (AGP) composition isolated through a selective method from the leaves and/or stems of Argemone mexicana plant is described. Also described is a purified Arabinogalactan-Protein (AGP) composition isolated from the leaves and/or stems of Argemone mexicana plant, which has one or more of the following effects: immunosuppression, lymphoproliferation... Agent: Ladas & Parry LLP 20090264342 - Compositions and methods for antibiotic potentiation and drug discovery: The present invention provides methods for identifying target genes whose partial or complete functional inactivation potentiates the activity of an antibiotic agent, e.g., a quinolone antibiotic. The invention further provides methods for identifying agents that modulate expression of target genes or that modulate activity of expression products of target genes.... Agent: Choate, Hall & Stewart LLP 20090264343 - Method of producing fr901228: Depsipeptides and congeners thereof are disclosed having structure (I), wherein m, n, p, q, X, R1, R2 and R3 are as defined herein. These compounds, including FR901228, have activity as, for example, immunosuppressants, as well as for the prevention or treatment of patients suffering or at risk of suffering from... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090264346 - Macrocyclic peptides active against the hepatitis c virus: p 20090264345 - Macrocyclic peptides and methods for making and using them: The invention provides novel macrocyclic peptides and methods for their preparation. The invention also provides pharmaceutical compositions and methods to treat, prevent or ameliorate a cell proliferative disease or conditions. e.g., a cancer. in a subject in need thereof, including but not limited to a colon cancer, such as MSS... Agent: Morrison & Foerster LLP 20090264344 - Retrocyclins: antiviral and antimicrobial peptides: Retrocyclin peptides are small antimicrobial agents with potent activity against bacteria and viruses. The peptides are nonhemolytic, and exhibit minimal in vitro cytotoxicity. A pharmaceutical composition comprising retrocyclin as an active agent is administered therapeutically to a patient suffering from a bacterial and/or viral infection, or to an individual facing... Agent: Bozicevic, Field & Francis LLP 20090264348 - Treatment with cyclosporin a: Disclosed herein is a method comprising administering cyclosporin A topically to an eye of a person for the purpose of treating or preventing loss of vision from keratoconus.... Agent: Allergan, Inc. 20090264347 - Use of blood coagulation factor xiii for treating hemophilia a: A patient having hemophilia A is treated by administering factor XIII generally in conjunction with factor VIII or desmopressin.... Agent: Novo Nordisk, Inc. Intellectual Property Department 20090264367 - 5-cnac as oral delivery agent for parathyroid hormone fragments: Pharmaceutical compositions for the effective oral delivery of a parathyroid hormone, PTH, as well as methods for administration of the compositions are provided. Additionally, methods for stimulating new bone formation and treating and/or preventing osteoporosis are also provided.... Agent: Novartis Corporate Intellectual Property 20090264356 - Adenovirus 36 e4 orf 1 gene and protein and their uses: Expression of the E4 orf 1 gene of Ad-36 alone has been discovered to be responsible for the increased insulin sensitivity observed in Ad-36 infected animals, including increased adipogenesis. Ad-36 E4 orf 1 protein can be used to increase insulin sensitivity and ameliorate diabetes. Additionally, drugs that mimic the action... Agent: Patent Department Taylor, Porter, Brooks & Phillips, L.l.p 20090264351 - Antifungal polypeptides: Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from microbial fermentation broths. Nucleic acid molecules comprising nucleotide sequences that encode the antipathogenic polypeptides of the... Agent: Alston & Bird LLP Pioneer Hi-bred International, Inc. 20090264349 - Cd30 ligand: There is disclosed a polypeptide (CD30-L) and DNA sequences, vectors and transformed host cells useful in providing CD30-L polypeptides. The CD30-L polypeptide binds to the receptor known as CD30, which is expressed on a number of cell types, among which are Hodgkin's Disease tumor cells, large cell anaplastic lymphoma cells,... Agent: Immunex Corporation Law Department 20090264360 - Cloning and expression of gonadotropin-releasing hormone (gnrh) receptors: An isolated and purified GnRH protein receptor protein including an amino acid sequence selected from the group and an isolated and purified DNA which comprises a nucleotide sequence coding for the GnRH protein receptor protein. Also, a vector comprising the DNA of the GnRH protein receptor protein, a transformant carrying... Agent: Devine, Millimet & Branch, P.A. 20090264368 - Compositions for delivering parathyroid hormone and calcitonin: The present invention relates to a composition comprising a delivery agent, parathyroid hormone, and calcitonin. This composition exhibits increased delivery of parathyroid hormone and/or calcitonin and is useful for the treatment of osteoporosis. The composition also permits simultaneous oral delivery of parathyroid hormone and calcitonin. The composition of the present... Agent: Emisphere Technologies, Inc. C/o Darby & Darby P.C. 20090264365 - Conformationally constrained parathyroid hormone (pth) analogs: The present invention relates to conformationally constrained parathyroid hormone (PTH) analogs, and methods of preparing and using the PTH analogs. The invention provides novel PTH polypeptide derivatives containing amino acid substitutions at selected positions in the polypeptides. The invention provides derivatives of PTH(1-34), PTH(1-21), PTH(1-20), PTH(1-19), PTH(1-18), PTH(1-17), PTH(1-16), PTH(1-15),... Agent: Clark & Elbing LLP 20090264359 - Fplr-1 inhibitors for use in diseases involving amyloid-induced inflammatory events (flipr and flipr-like) and immunecomplex-mediated diseases: The present invention relates to a FPLR-1 inhibitor selected from the group consisting of FLIPr having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGG FLIPr-like having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERADKLIKEADEKNEHYKGKTVEDLYVIAKKMGKGNTIAVVKIKDGGK fragments of a) or b) having FPLR-1 inhibitory activity; homologues of a), b) or c) having FPLR-1 inhibitory activity; or derivatives of... Agent: Bozicevic, Field & Francis LLP 20090264364 - Genes implicated in the regulation of angiogenesis, pharmaceutical preparations containing them and their applications: Therapeutic compositions used in the field of angiogenesis include nucleotide sequences of genes, the involvement of the genes in the angiogenesis mechanism having been demonstrated by the Applicant, and including the complementary sequences thereof, the antisense sequences of same, polypeptide sequences coded by the coding parts of the aforementioned genes... Agent: Ip Group Of Dla Piper LLP (us) 20090264361 - Identification of a family of secreted proteins in vascular endothelium: The invention relates to SCUBE molecules and generally to gene expression in vascular endothelial cells. The invention specifically relates to the discovery of a novel gene family containing the genes and proteins referred to herein as SCUBE1, SCUBE2 and SCUBE3 which can be expressed in endothelial cells. SCUBE proteins may... Agent: Millennium Pharmaceuticals, Inc. 20090264362 - Influenza virus inhibiting peptides: The present invention provides a pharmaceutical composition for the treatment or prevention of an influenza infection. The composition comprises an isolated polypeptide including a sequence of at least 8 contiguous amino acid residues of the fusion initiation region (FIR) of an influenza hemagglutinin 2 protein or a peptide analog of... Agent: Olson & Cepuritis, Ltd. 20090264350 - Kallikrein inhibitors and anti-thrombolytic agents and uses thereof: Methods, kits and compositions are described that include a non-naturally occurring kallikrein inhibitor and an anti-thrombolytic agent, e.g., an anti-fibrinolytic agent, for preventing or reducing blood loss and/or ischemia, e.g., ischemia associated with perioperative blood loss and cerebral ischemia, the onset of systemic inflammatory response, and/or reperfusion injury, e.g., reperfusion... Agent: Lando & Anastasi, LLP 20090264363 - Leucine-rich peptide compositions and methods for isolation: Disclosed are compositions comprising isolated peptides having a leucine content of from about 12 to about 40 weight percent. Also disclosed is a method for isolating leucine-rich peptides from protein sources such as bovine whey and methods of use for these peptides to provide beneficial effects in a human and/or... Agent: Donna J. Russell 20090264355 - Methods to treat alzheimer's disease or other disorders mediated by amyloid-beta accumulation in a subject: The invention provides methods of delaying the onset, slowing the progression, preventing, or treating Alzheimers disease in a subject. In particular, the invention provides methods of modulating transport of Aβ across the blood brain barrier of the subject.... Agent: Polsinelli Shughart PC 20090264357 - Novel agent that inhibits angiogenesis and metastasis targeting mtor signaling pathway: The present invention relates to a novel function of Msx1 protein for inhibiting tumor angiogenesis and metastasis by targeting mTOR (mammalian target of rapamycin) signaling pathway, and for treating a cancer in a subject. Particularly, Msx1 suppresses mTOR through a direct interaction with mTOR, resulting in the inhibition of angiogenesis.... Agent: LexyoumeIPGroup, LLC 20090264354 - Penumbra nucleic acid molecules, proteins and uses thereof: The present invention relates to murine and human Penumbra (for proerythroblast nu[new] Membrane) nucleic acid molecules, proteins and the uses thereof. The invention further relates to the use of Penumbra molecules for the detection of 7q31q32-related deletions, including such deletions associated with myeloid malignancies, particularly detection by hybridization using Penumbra-based... Agent: The Mccallum Law Firm, P. C. 20090264353 - Splice switching oligomers for tnf superfamily receptors and their use in treatment of disease: The present invention relates to compositions and methods for preparing splice variants of TNFalpha receptor (TNFR) in vivo or in vitro, and the resulting TNFR protein variants. Such variants may be prepared by controlling the splicing of pre-mRNA molecules and regulating protein expression with splice switching oligonucleotides or splice switching... Agent: Fish & Richardson PC 20090264366 - Transglutaminase mediated conjugation of peptides: Methods for conjugating peptides are provided comprising i) reacting a peptide with a first compound comprising a functional group in the presence of a transglutaminase capable of incorporating said compound into the peptide to form a transaminated peptide, and ii) reacting said transaminated peptide with e.g. a functionalized polymer capable... Agent: Novo Nordisk, Inc. Intellectual Property Department 20090264352 - Use of glp-1 and agonists thereof to prevent cardiac myocyte apoptosis: The present invention relates generally to the novel use of GLP-1, including analogs, and agonists, to prevent cardiac myocyte apoptosis. The present invention relates to methods for using GLP-1 for the treatment of conditions associated with cardiac myocyte apoptosis. The present invention further relates to improving the efficiency of cardiac... Agent: Intellectual Property Department Amylin Pharmaceuticals, Inc. 20090264358 - Vegf receptor fusion proteins, their pharmaceutical compositions and therapeutic applications for the eye diseases: Vascular endothelial growth factor (VEGF) receptor fusion protein comprising Ig domain 2 of Flt-1 and Ig domains 3, or Ig domain 2 of Flt-1 and Ig domain 3 and 4 of KDR, the gene encoding the fusion protein, the pharmaceutical composition containing the fusion protein and the pharmaceutical use of... Agent: Edwards Angell Palmer & Dodge LLP 20090264369 - Methods for reducing cd36 expression: The invention provides a method for reducing CD36 expression in a cell. The method comprises contacting the cell with an effective amount of an aromatic-cationic peptide having at least one net positive charge; a minimum of four amino acids; a maximum of about twenty amino acids; a relationship between the... Agent: Foley & Lardner LLP 20090264370 - Polypeptides homologous to vegf and bmp1: The present invention involves the identification and preparation of vascular endothelial growth factor-E (VEGF-E). VEGF-E is a novel polypeptide related to vascular endothelial growth factor (VEGF) and bone morphogenetic protein 1. VEGF-E has homology to VEGF including conservation of the amino acids required for activity of VEGF. VEGF-E can be... Agent: Genentech, Inc. 20090264371 - Antiproliferative peptides and antibodies for their detection: The present invention relates to developmental peptides and peptidomimetics thereof, which may be used therapeutically to inhibit abnormal cell proliferation of damaged cells, including cancer cells or virally infected cells. In one embodiment, a seven to eleven amino acid developmental peptide and methods of using the same is provided.... Agent: Pepper Hamilton LLP 20090264372 - Utilization of peptides as active ingredients for slimming: A method of using proteins of the SIRT family or of polypeptide or peptide fragments of SIRT proteins as an active ingredient for slimming, alone or in combination with at least one other active agent, in a cosmetic composition or for the preparation of a pharmaceutical and/or dermatological composition. The... Agent: Young & Thompson 20090264373 - Synthetic peptide amides and dimers thereof: Pharmaceutical compositions containing these compounds are useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. Such treatable pain includes visceral pain, neuropathic pain and hyperalgesia. Inflammation associated with conditions such as IBD and IBS, ocular and otic inflammation, other disorders and... Agent: Pillsbury Winthrop Shaw Pittman LLP 20090264375 - Intraocular irrigating solutions and methods for treating corneal edema: One aspect of the present invention relates to methods of treating corneal edema comprising contacting a cornea with an ophthalmic irrigating composition comprising histidine. In certain embodiments, the ophthalmic irrigating compositions contact the corneal endothelium. Another aspect of the present invention relates to ophthalmic irrigating compositions for treating corneal edema... Agent: Alcon 20090264374 - Utilization of anti-neuropathic pain effect of d-allose and d-psicose: [MEANS FOR SOLVING PROBLEMS] Disclosed is a composition for elimination, relief or reduction of neuropathic pain comprising, as an active ingredient, at least one substance selected from the group consisting of D-allose, a derivative of D-allose, D-psicose and a derivative of D-psicose preferably in an amount of 0.01 to 90%... Agent: Westerman, Hattori, Daniels & Adrian, LLP 20090264377 - Anti-neoplastic compositions comprising extracts of black cohosh: A method is provided for treating, preventing or ameliorating neoplasia in a subject. This method includes administering to the subject an amount of actein or an amount of an extract of black cohosh that contains a triterpene glycoside, which amount of the actein or black cohosh is effective to treat,... Agent: Kevin C. Hooper Bryan Cave LLP 20090264376 - Hoodia plant extract with improved flavor: Extracts of Hoodia plant containing steroidal glycosides which have improved flavor, by virtue of reduced levels of discovered negative flavor compounds. Food compositions containing steroidal glycosides with reduced amounts of discovered negative flavor components are also included.... Agent: Unilever Patent Group 20090264378 - Avermectin compounds and treatment of dermatological disorders in humans therewith: Compounds of the avermectin family or derivatives thereof, notably emamectins are formulated into pharmaceutical compositions useful for the treatment of dermatological conditions in humans, in particular rosacea.... Agent: Buchanan, Ingersoll & Rooney PC 20090264379 - Stable aqueous solution of a polyene fungicide: The invention provides an aqueous composition comprising a dissolved polyene fungicide and a solubilizer, wherein at least 100 ppm of polyene fungicide is present as dissolved polyene fungicide. The aqueous compositions of the invention may further comprise a chelating and/or antioxidation agent. The compositions of the invention provide dissolved polyene... Agent: Nixon & Vanderhye, PC 20090264380 - 6,11-bridged biaryl macrolides: which exhibit antibacterial properties. The present invention further relates to pharmaceutical compositions comprising the aforementioned compounds for administration to a subject in need of antibiotic treatment. The invention also relates to methods of treating a bacterial infection in a subject by administering a pharmaceutical composition comprising the compounds of the... Agent: Elmore Patent Law Group, PC 20090264381 - Nucleic acid and corresponding protein entitled 151p3d4 useful in treatment and detection of cancer: A novel gene (designated 151P3D4) and its encoded protein, and variants thereof, are described wherein 151P3D4 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 151P3D4 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 151P3D4 gene... Agent: Agensys C/o Morrison & Foerster LLP 20090264502 - Compositions and their uses directed to hsp27: Disclosed herein are compounds, compositions and methods for modulating the expression of HSP27 in a cell, tissue or animal. Also provided are uses of disclosed compounds and compositions in the manufacture of a medicament for treatment of diseases and disorders.... Agent: Bozicevic, Field & Francis LLP 20090264506 - Delivery of polynucleotide agents to the central nervous system: The present invention provides a method for delivering polynucleotide agents, particularly oligonucleotides, to the CNS of a mammal by way of a neural pathway originating in the nasal cavity or through a neural pathway originating in an extranasal tissue that is innervated by the trigeminal nerve.... Agent: Weaver Austin Villeneuve & Sampson LLP 20090264505 - Methods and compositions for rnai mediated inhibition of gene expression in mammals: Methods and compositions are provided for modulating, e.g., reducing, expression of a target sequence in mammals and mammalian cells. In the subject methods, an effective amount of an RNAi agent, e.g., an interfering ribonucleic acid (such as an siRNA or shRNA) or a transcription template thereof, e.g., a DNA encoding... Agent: King & Spalding LLP 20090264501 - Methods and compositions to inhibit p2x7 receptor expression: Methods and compositions for the downregulation of P2X7 receptor expression or activity are disclosed. Preferred compositions comprise siNA. The methods and compositions are useful in the treatment of diseases characterised by increased 112X7 receptor activity, such as neuronal degeneration, Alzheimer's disease, inflammatory diseases, and some cancers.... Agent: Fish & Richardson PC 20090264504 - Rna interference mediated inhibition of human immunodeficiency virus (hiv) gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating human immunodeficiency virus (HIV) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways of human immunodeficiency virus... Agent: Sirna Therapeutics, Inc. 20090264503 - Short interference ribonucleic acids for treating allergic diseases: Provided herein are compounds, methods and compositions for treating allergic diseases. In particular, an isolated double stranded short interfering ribonucleic acid (siRNA) with a ribonucleotide sequence complementary to at least a portion of a target gene RNA such as an airway inflammation related-gene RNA, thereby resulting in the cleavage of... Agent: Chih Feng Yeh Brian M. Mcinnis 20090264509 - Adenoviral vector-based foot-and-mouth disease vaccine: The invention is directed to an adenoviral vector comprising at least one nucleic acid sequence encoding an aphthovirus antigen and/or a cytokine operably linked to a promoter. The adenoviral vector is replication-deficient and requires at most complementation of both the E1 region and the E4 region of the adenoviral genome... Agent: Leydig Voit & Mayer, Ltd 20090264511 - Compositions and methods for inhibiting expression of factor vii gene: The invention relates to a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of the Factor VII gene.... Agent: Lando & Anastasi, LLP 20090264510 - Double helical oligonucleotides interfering with mrna used as effective anticancer agents: The present invention relates to the application of double-helical oligonucleotides (siRNA) interfering with the mRNA of gene involved in carcinogenesis, particularly the Wnt1, Wnt2 or Her3 genes. Such oligonucleotides may be modified chemically, used in conjunction with viral and non-viral vectors such as lipid complexes. Such oligonucleotides exhibit unusual anti-proliferative... Agent: Paul G. Lunn, Esq. 20090264513 - Expression vector: A conventional shuttle vector constructed by fusing an E. coli-derived plasmid and a transformant-derived plasmid functions in both E. coli and the transformant bacterium, and there exists no expression vector that functions only in a non-E. coli transformant. The present invention provides an plasmid expression vector comprising (1) a plasmid... Agent: Jones Day 20090264508 - Focused libraries, functional profiling, laser selex, and deselex: Focused aptamer libraries are constructed in accordance with a proteome (i.e., complex mixture of native biomolecules). The libraries may be screened to identify one or more candidate aptamers with desired biological activities other than specific binding to a target. Aptamers which are selected or derivatives thereof may be used for... Agent: Nixon & Vanderhye, PC 20090264507 - Method of diagnosing gum disease-wound healing using single nucleotide polymorphism profiles: The present invention provides methods for diagnosing and providing a prognosis for wound healing in a patient by characterizing and analyzing the single nucleotide polymorphism (SNP) of a wound healing associated gene wit3.0. In particular, the invention provides a method of diagnosis and prognosis of oral disease-wound healing, including gingival... Agent: Townsend And Townsend And Crew, LLP 20090264512 - Nucleic acid ligands capable of binding to internalin b or internalin a: The present disclosure relates to the isolation of a novel reagent selected for its binding characteristics to the proteins internalin B or internalin A. InIB is a surface-localized protein of Listeria monocytogenes that binds and activates the receptor tyrosine kinase Met. InIB promotes invasion of a number of cells including... Agent: Knobbe Martens Olson & Bear LLP 20090264515 - Polynucleotide therapy: This invention provides a method of treating or preventing a disease in an animal associated with one or more self-protein(s), -polypeptide(s), or -peptide(s) that is present or involved in a non-physiologic process in the animal comprising administering to the animal a self-vector comprising a polynucleotide encoding the self-protein(s), -polypeptide(s) or... Agent: Townsend And Townsend And Crew, LLP 20090264514 - Sphingomyelin synthase 2 (sms2) deficiency attenuates nfkb activation, a potential anti-atherogenic property: The present invention is directed to a method of screening for NFκB inhibiting agents, the method including the steps of administering a biologically effective amount of a candidate SMS2 inhibitor to at least one cell; and determining whether the candidate SMS2 inhibitor inhibits NFκB.... Agent: Hoffmann & Baron, LLP 20090264382 - Methods for treating hematopoietic neoplasms: This invention relates to methods for treating, preventing and/or managing hematopoietic neoplasm in a subject by administering to the subject combretastatin A-4 phosphate, or a pharmaceutically acceptable salt thereof. The method may further comprise co-administering a chemotherapeutic agent.... Agent: Oxigene, Inc. C/o Law Offices Of Karen E. Flick 20090264383 - Inhibitor of adenylyl cyclase for treating a disorder of the circadian rhythm: The invention relates to use of a composition comprising an inhibitor of adenylyl cyclase in the elongation of circadian rhythm, a method of extending the period of circadian rhythm in a subject, said method comprising administering to said subject an inhibitor of adenylyl cyclase, and to adenylyl cyclase inhibitor for... Agent: Mcandrews Held & Malloy, Ltd 20090264384 - Indole, benzimidazole, and benzolactam boronic acid compounds, analogs thereof and methods of use thereof: Benzimidazole, indole and benzolactam boronic acid compounds, analogs thereof, and pharmaceutical formulations are described, along with methods of use thereof for inhibiting inflammatory cytokines such as tumor necrosis factor alpha (TNF-α) in a subject in need thereof.... Agent: Alston & Bird LLP 20090264385 - Stabilized compositions containing alkaline labile drugs: A stabilized bioadhesive composition containing an alkaline labile drug and a method for its preparation are provided. In one aspect, the composition is a hot-melt extruded (HME) composition comprising a preformed excipient mixture comprising an acidic component and an alkaline thermoplastic matrix-forming material, e.g. polymer. The excipient mixture is formed... Agent: Ratnerprestia 20090264386 - Mesalamine suppository: The present invention relates to a mesalamine rectal suppository designed to provide improved comfort of use. One embodiment of the invention is a mesalamine rectal suppository comprising mesalamine and one or more pharmaceutically acceptable excipients, wherein the drug load of the suppository ranges from 35% to 50%. Another embodiment of... Agent: Darby & Darby P.C. 20090264387 - Estra-1,3,5(10)-triene derivatives for contraception: e 20090264388 - Compounds and methods of treating disorders associated with activation of metachromatic cells: The present invention relates to neurokinin-1 (NK-1) receptor antagonists in combination with an inhibitor of metachromatic cell activation, such as an anti-inflammatory agent, an immunosuppressor, or a kinase inhibitor, and use of such combinations in the treatment of disorders associated with activation of metachromatic cells. Disorders associated with the activation... Agent: Clark & Elbing LLP 20090264389 - Method of preparing dry powder inhalation compositions: The invention provides a method of preparing a dry powder inhalation composition comprising a pharmaceutically acceptable particulate carrier, a first particulate inhalant medicament and a second particulate inhalant medicament. Also provided are dry powder compositions and methods of using them with a dry powder inhalation device.... Agent: Lerner, David, Littenberg, Krumholz & Mentlik 20090264390 - Topical personal care compositions and methods of use: Topical personal care compositions comprising an anti-inflammatory agent, a surfactant, a bodifier/humectant, and water and methods of use are disclosed.... Agent: Fox Rothschild LLP Princeton Pike Corporate Center 20090264391 - Fluocinolone implants to protect against undesirable bone and cartilage destruction: Effective treatments for protecting against undesirable macrophage activity are provided. Through the administration of an effective amount of fluocinolone at or near a target site, one can reduce or prevent macrophage activity. In various embodiments, fluocinolone formulations may be provided within biodegradable polymers to prevent transplant rejection for at least... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department 20090264393 - Nitrooxy derivatives of glucocorticoids: The invention relates to new steroids nitrooxyderivatives, to topical pharmaceutical formulations thereof, and their use for treating skin or mucosal membrane diseases or disorders. These new steroids nitrooxyderivatives have an improved pharmacological activity and enhanced local tolerability.... Agent: Arent Fox LLP 20090264394 - Nitrooxy derivatives of glucocorticoids: The invention relates to new steroids nitrooxyderivatives, to topical pharmaceutical formulations thereof, and their use for treating skin or mucosal membrane diseases or disorders. These new steroids nitrooxyderivatives have an improved pharmacological activity and enhanced local tolerability.... Agent: Arent Fox LLP 20090264392 - Treating eosinophilic esophagitis: This document provides methods and compositions suitable for treating eosinophilic esophogitis. For example, this document provides methods that involve administering a steroid and mucoadherent to a mammal (e.g., a human). Kits comprising compositions containing a steroid in combination with a mucoadherent also are provided.... Agent: Wilson, Sonsini, Goodrich & Rosati 20090264395 - Progesterone for the treatment or prevention of spontaneous preterm birth: A method for treating or preventing spontaneous preterm birth in pregnant women and improving neonatal morbidity and mortality. The method includes administering to a pregnant woman in need thereof an effective amount of progesterone sufficient to prolong gestation by minimizing the shortening or effacing of her cervix. Treatment and prophylaxis... Agent: Winston & Strawn LLP Patent Department 20090264396 - 17alpha, 21-dihydroxypregnene esters as antiandrogenic agents: 17α,21-Dihydroxypregna-4,9-diene-3,20-dione and 17α,21-dihydroxypregna-4-ene-3,20-dione 17 and/or 21 esters of having remarkable antiandrogenic activity, and the processes for the preparation thereof.... Agent: Nixon & Vanderhye, PC 20090264397 - Highly fluorinated oils and surfactants and methods of making and using same: In one aspect, the compounds exhibit maximum symmetric branching. Also disclosed are bilayers, micelles, coatings, and nanoparticles comprising the disclosed compounds. Also disclosed are processes for the preparation of the disclosed compounds and methods of using the disclosed compounds. Also disclosed are highly fluorinated dendrons and methods for making same.... Agent: Ballard Spahr Andrews & Ingersoll, LLP 20090264398 - Method for inducing tumor apoptosis by increasing nitric oxide levels: According to the present invention inhibitors of the nitric oxide dioxygenase or arginase can be used for the manufacture of a medicament for the treatment of cancer. The present invention further provides a method for identifying compounds which can be used for the treatment of cancer, wherein the method allows... Agent: Smith Patent Consulting, LLC 20090264399 - Heterocyclic janus kinase 3 inhibitors: The invention relates to compound of the formula (I) or its salt, wherein —R1, —R2, —R3, —R4, —R5, -M-, —X— and —Y═ are as defined in the description, their use of as, medicament, the process for their preparation and use for the treatment of JAK3 mediated diseases.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090264402 - Novel diphenylazetidinone substituted by piperazine-1-sulfonic acid and having improved pharmacological properties: e 20090264403 - Novel azacyclyl-substituted aryldihydroisoquinolinones, process for their preparation and their use as medicaments: The invention relates to azacyclyl-substituted aryldihydroisoquinolinones and their derivatives, and their physiologically tolerated salts and physiologically functional derivatives, their preparation, medicaments comprising at least one azacyclyl-substituted aryldihydroisoquinolinone of the invention or its derivative, and the use of the azacyclyl-substituted aryidihydroisoquinolinones of the invention and their derivatives as MCH antagonists.... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC 20090264405 - Cetp inhibitors: Compounds of Formula I, including pharmaceutically acceptable salts of the compounds, are CETP inhibitors, and are useful for raising HDL-cholesterol, reducing LDL-cholesterol, and for treating or preventing atherosclerosis.... Agent: Merck And Co., Inc 20090264404 - Derivatives of 4-piperazin-1-yl-4-benzo[b]thiophene suitable for the treatment of cns disorders: A heterocyclic compound or a salt thereof represented by the formula (1): where R2 represents a hydrogen atom or a lower alkyl group; A represents a lower alkylene group or lower alkenylene group; and R1 represents an aromatic group or a heterocyclic group. The compound of the present invention has... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20090264401 - Substituted pyrimidin-5-carboxamides 281: h 20090264400 - Substituted sulfonamide compounds: 20090264406 - 3-methyl-imidazo[1,2-b]pyridazine derivatives: wherein the substituents are as defined in the specification, the application of a compound of formula (I) in a process for the treatment of the human or animal body, in particular with regard to C-Met tyrosine kinase mediated disease; the use of a compound of formula (I) for manufacturing a... Agent: Novartis Institutes For Biomedical Research, Inc. 20090264407 - Substituted sulfonamide compounds: e 20090264408 - Extended release dosage forms of quetiapine: The present invention relates to an extended release dosage form of quetiapine wherein the dosage form comprises quetiapine and rate-controlling polymer selected from polyethylene oxide, sodium alginate and natural gum and combinations thereof. The dosage form may additionally comprise at least one water-insoluble polymer.... Agent: Ranbaxy Inc. Intellectual Property Dept. 20090264409 - Bicyclic heterocyclic p-38 kinase inhibitors: Provided are bicyclic heterocycle-based p38 kinase, including p38α and p38β kinase, inhibitors. Pharmaceutical compositions containing the compounds are also provided. Methods of use of the compounds and compositions are also provided, including methods of treatment, prevention, or amelioration of one or more symptoms of p38 kinase mediated diseases and disorders,... Agent: Novartis Institutes For Biomedical Research, Inc. 20090264410 - Therapeutic compounds and uses thereof: o 20090264411 - Fused thiophene derivatives as mek inhibitors: A series of 4,5,6,7-tetrahydrothieno[2,3-c]azepin-8-one derivatives, and analogues thereof, which are substituted in the 2-position by a substituted anilino moiety, being selective inhibitors of human MEK (MAPKK) enzymes, are accordingly of benefit in medicine, for example in the treatment of inflammatory, autoimmune, cardiovascular, proliferative (including oncological) and nociceptive conditions.... Agent: Feldmangale, P.A. 20090264412 - Combination therapy using an 11beta-hydroxysteroid dehydrogenase type 1 inhibitor and a glucocorticoid receptor agonist to minimize the side effects associated with glucocorticoid receptor agonist therapy: Combination therapy comprising the administration of an 11β-hydroxysteroid dehydrogenase type 1 inhibitor and a glucocorticoid receptor agonist for treating some forms of cancer, diseases and disorders having inflammation as a component, and to minimize the side effects associated with glucorticoid receptor agonist therapy.... Agent: High Point Pharmaceuticals, Inc. 20090264413 - Compositions and methods for treating female sexual dysfunction: This invention relates to methods, pharmaceutical compositions and kits useful in treating female sexual dysfunction and the use of an estrogen agonist/antagonist for the manufacture of a medicament for the treatment of female sexual dysfunction. The compositions are comprised of an estrogen agonist/antagonist as a first active ingredient and a... Agent: Pfizer Inc. Patent Department 20090264414 - Amide derivatives and pharmaceutical use thereof: The use of substituted amides for modulating the activity of 11β-hydroxysteroid dehydrogenase type 1 (11βHSD1) and the use of these compounds as pharmaceutical compositions, are described. Also a novel class of substituted amides, their use in therapy, pharmaceutical compositions comprising the compounds, as well as their use in the manufacture... Agent: High Point Pharmaceuticals, Inc. 20090264418 - 5-amido-indole-2-carboxamide derivatives: e 20090264416 - N-benzyl,n'-arylcarbonylpiperazine derivatives: 20090264417 - Sulfonyl-substituted bicyclic compounds as modulators of ppar: Compounds as modulators of peroxisome proliferator activated receptors, pharmaceutical compositions comprising the same, and methods of treating disease using the same are disclosed.... Agent: Global Patent Group - Kal Attn: Ms Lavern Hall 20090264415 - Pyrido(3,2-d)pyrimidines and pharmaceutical compositions useful for medical treatment: This invention relates to substituted pyrido(3,2-d)pyrimidine derivatives, their pharmaceutically acceptable salts, N-oxides, solvates, pro-drugs and enantiomers, possessing unexpectedly desirable pharmaceutical properties, in particular which are highly active immunosuppressive agents, and as such are useful in the treatment in transplant rejection and/or in the treatment of certain inflammatory diseases. These derivatives... Agent: Clark & Elbing LLP 20090264419 - Cyclic malonamides as inhibitors of abeta protein production: to their pharmaceutical compositions and to their methods of use. These novel compounds inhibit the processing of amyloid precursor protein and, more specifically, inhibit the production of Aβ-peptide, thereby acting to prevent the formation of neurological deposits of amyloid protein. More particularly, the present invention relates to the treatment of... Agent: Kelley Drye & Warren LLP 20090264420 - Organic compounds: said compound is inhibitor of aldosterone synthase, and/or 11 beta-hydroxylase (CYPL11B1), and/or aromatase, and thus can be employed for the treatment of a disorder or disease mediated by aldosterone synthase, aromatase, or CYPL11B1. Accordingly, the compound of formula I can be used in treatment of hypokalemia, hypertension, congestive heart failure,... Agent: Novartis Institutes For Biomedical Research, Inc. 20090264421 - Methods and compositions for treating cancer: Compositions and methods for treating cancer, including hematologic cancers such as multiple myeloma, are disclosed. In some embodiments, chaetocin, chaetomin, or gliotoxin can be used to treat or ameliorate one or more symptoms or disorders associated with multiple myeloma.... Agent: Fish & Richardson P.C. 20090264422 - Method of treating disease states using substituted pyrazole compounds: Disclosed are protein kinase inhibitors, compositions comprising such inhibitors, and methods of use thereof. More particularly, disclosed are inhibitors of Aurora A (Aurora-2) protein kinase. Also disclosed are methods of treating diseases associated with protein kinases, especially diseases associated with Aurora-2, such as cancer.... Agent: King & Spalding 20090264423 - Serine-threonine protein kinase and parp modulators: The invention relates in part to molecules having certain biological activities that include, but are not limited to, inhibiting cell proliferation, modulating protein kinase activity and modulating polymerase activity. Molecules of the invention can modulate casein kinase (CK) activity and/or poly(ADP-ribose)polymerase (PARP) activity. The invention also relates in part to... Agent: Morrison & Foerster LLP 20090264424 - Vanilloid receptor ligands and their use in treatments: and compositions containing them, for the treatment of acute, inflammatory and neuropathic pain, dental pain, general headache, migraine, cluster headache, mixed-vascular and non-vascular syndromes, tension headache, general inflammation, arthritis, rheumatic diseases, osteoarthritis, inflammatory bowel disorders, inflammatory eye disorders, inflammatory or unstable bladder disorders, psoriasis, skin complaints with inflammatory components, chronic... Agent: Amgen Inc. 20090264427 - 3-cyanoquinolines, methods for preparation and use as insulin-like growth factor inhibitors: Imidazole-substituted 4-anilino-3-cyanoquinolines are described, which selectively inhibit IFGR kinase activity and are useful for treating disorders associated with IGFR kinases.... Agent: Wyeth Patent Law Group 20090264426 - Bicyclic aromatic substituted pyridone derivative: Wherein R1 and R2 independently represent a hydrogen atom, a lower alkyl group or the like; X1, X2 and X3 independently represent a methine group or a nitrogen atom; Y1 and Y3 independently represent a single bond, —O— or the like; Y2 represents a lower alkylene group or the like;... Agent: Merck And Co., Inc 20090264425 - Chemical compounds: e 20090264428 - Renin inhibitors: Described are compounds of the formula (I) which are orally active and bind to aspartic proteases to inhibit their activity. They are useful in the treatment or amelioration of diseases associated with aspartic protease activity. Also described are methods of use of the compounds described herein in ameliorating or treating... Agent: Hamilton, Brook, Smith & Reynolds, P.C. 20090264429 - Aryl - hydroxyethylamino - pyrimidines and triazines as modulators of fatty acid amide hydrolase: Certain aryl-hydroxyethylamino-pyrimidine and triazine compounds are described, which are useful as FAAH inhibitors. Such compounds may be used in pharmaceutical compositions and methods for the treatment of disease states, disorders, and conditions mediated by fatty acid amide hydrolase (FAAH) activity, such as anxiety, pain, inflammation, sleep disorders, eating disorders, energy... Agent: Philip S. Johnson Johnson & Johnson 20090264430 - Salt of morpholine compound: (2S)-[4-(Carboxymethyl)thiazol-2-ylthio]-N-{[4-(3,4-dichlorobenzyl)morpholin-2-yl]methyl}acetamide hydrobromide and a crystal thereof, which resist easy weight change caused by vapor sorption as compared to a free form, and are superior as drug substances of pharmaceutical products, and a production intermediate therefor are provided.... Agent: Wenderoth, Lind & Ponack, L.L.P. 20090264431 - Novel cathepsin c inhibitors and their use: S 20090264432 - Piperidine and morpholine renin inhibitors: Described are compounds which are orally active and bind to renin to inhibit its activity. They are useful in the treatment or amelioration of diseases associated with renin activity. Also described are methods of use of these compounds for treating or ameliorating a renin mediated disorder in a subject.... Agent: Hamilton, Brook, Smith & Reynolds, P.C. 20090264433 - Compounds, compositions and methods comprising triazine derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP 20090264434 - Pyridazinone glucokinase activators: e 20090264436 - Cb-1 receptor modulator formulations: Described herein are solid, stable pharmaceutical formulations of cannabinoid receptor inverse agonists, such as taranabant, and processes of making such formulations. Additionally, described herein are solid stable pharmaceutical formulations of cannabiniod inverse agonists, such as taranabant, and an additional therapeutic agent, as well as processes for making such pharmaceutical formulations.... Agent: Merck And Co., Inc 20090264435 - Novel aryl- and heteroarylpiperazines: Novel aryl- and heteroarylpiperazines, use of these compounds as pharmaceutical compositions, pharmaceutical compositions comprising the compounds, and a method of treatment employing these compounds and compositions. The compounds show a high and selective binding affinity to the histamine H3 receptor indicating histamine H3 receptor antagonistic, inverse agonistic or agonistic activity.... Agent: Novo Nordisk, Inc. Intellectual Property Department 20090264437 - 4-piperazinyl-pyrimidine compounds suitable for treating disorders that respond to modulation of the dopamine d3 receptor: v 20090264439 - Combination of a) n--4-(3-pyridyl)-2-pyrimidine-amine and b) a histone deacetylase inhibitor for the treatment of leukemia: The invention pertains to a combination of a histone deacetylase inhibitor and N-{5-[4-(4-methyl-piperazino-methyl)-benzoylamido]-2-methylphenyl}-4-(3-pyridyl)-2-pyrimidine or a pharmaceutically acceptable salt thereof for simultaneous, separate or sequential use for the treatment of leukemia and especially N-{5-[4-(4-methyl-piperazino-methyl)-benzoylamido]-2-methylphenyl}-4-(3-pyridyl)-2-pyrimidine-resistant leukemia.... Agent: Dilworth & Barrese, LLP 20090264438 - Polymorphic forms of imatinib mesylate and processes for preparation of novel crystalline forms as well as amorphous and form alpha: Solvates and crystalline forms of imatinib mesylate are described. Further, methods for preparing such solvates and crystalline forms of imatinib mesylate are described.... Agent: Kenyon & Kenyon LLP 20090264440 - Inhibitors of protein tyrosine kinase activity: This invention relates to compounds that inhibit protein tyrosine kinase activity. In particular the invention relates to compounds that inhibit the protein tyrosine kinase activity of growth factor receptors, resulting in the inhibition of receptor signaling, for example, the inhibition of VEGF receptor signaling and HGF receptor signaling. More particularly,... Agent: Keown & Zucchero, LLP 20090264441 - Compounds, compositions and methods comprising oxadiazole derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP 20090264442 - Pyrazole derivatives as sigma receptor inhibitors: e 20090264443 - Treatment of organophosphate exposure with tetrahydroindolone arylpiperazine compounds: A method of treating exposure to organophosphate agents through the use of compounds comprising tetrahydroindolone and arylpiperazine moieties.... Agent: Sheldon Mak Rose & Anderson PC 20090264444 - Organic compounds: The present invention provides heterocyclic derivatives that modulate the activity of stearoyl-CoA desaturase. Methods of using such derivatives to modulate the activity of stearoyl-CoA desaturase and pharmaceutical compositions comprising such derivatives are also encompassed.... Agent: Novartis Institutes For Biomedical Research, Inc. 20090264445 - Pyrrolidinone glucokinase activators: e 20090264446 - Condensed pyridines as kinase inhibitors: New compounds of formula (I), wherein the meanings for the various substituents are as disclosed in the description. These compounds are useful as p38 kinase inhibitors.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C. 20090264447 - Pyrimidine compounds for combating pathogenic fungi and cancer: w 20090264448 - Pyrazolo[1,5-a]pyrimidines, processes, uses and compositions: The invention provides novel pyrazolo[1,5-a]pyrimidines which are useful for treating or preventing anxiety, epilepsy and sleep disorders including insomnia, and for inducing sedation-hypnosis, anesthesia, sleep and muscle relaxation.... Agent: Birch Stewart Kolasch & Birch 20090264449 - Hair care compositions and methods for increasing hair diameter: Disclosed in a hair care composition comprising: (i) a hair diameter increasing agent comprising a xanthine compound, a vitamin B3 compound, and a panthenol compound; and (ii) an carrier comprising water and monohydric alcohols having 1 to 6 carbons; wherein the monohydric alcohol is present in the composition at a... Agent: The Procter & Gamble Company Global Legal Department - Ip 20090264450 - Limk2 inhibitors, compositions comprising them, and methods of their use: Inhibitors of LIM kinase 2 are disclosed, along with pharmaceutical compositions comprising them and methods of their use. Particular compounds are of the formula:... Agent: Lexicon Pharmaceuticals, Inc. 20090264451 - 6-1h-imidazo-quinazoline and quinolines derivatives, new potent analgesics and anti-inflammatory agents: h 20090264452 - 2-(phenylamino)-pyrimidin-5-amides as cannabinoid 2 receptors modulators for the treatment of immune or inflammatory disorders: 20090264453 - Genetic polymorphisms associated with coronary heart disease, methods of detection and uses thereof: The present invention is based on the discovery of genetic polymorphisms that are associated with coronary heart disease, and in particular MI, and response to drug treatment. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for... Agent: Celera Corporation 20090264454 - Combined hydrocodone and analgesic formulation and method: The present invention is directed to co-administration of hydrocodone and a second analgesic agent for the treatment of pain. A pharmaceutical composition suitable for the co-administration contains a therapeutically effective amount of hydrocodone or a pharmaceutically acceptable salt thereof, and a therapeutically effective amount of at least one second analgesic... Agent: Stetina Brunda Garred & Brucker 20090264455 - Androgen receptor modulator compounds and methods: Provided herein are compounds that bind to androgen receptors and/or modulate activity of androgen receptors, and to methods for making and using such compounds. Also provided are compositions including such compounds and methods for making and using such compositions.... Agent: K&l Gates LLP 20090264456 - Compostions and methods for preventing and/or treating disorders asociated with cephalic pain: Compounds, e.g., of formula (I) and (Ia), pharmaceutical compositions comprising the compounds and methods of using the compounds and pharmaceutical compositions for treating pain disorders, e.g., disorders associated with cephalic pain, are provided.... Agent: Lando & Anastasi, LLP 20090264457 - Combination of at least two 5ht6-ligands: The present invention relates to a Combination of at least two 5HT6-Ligands of which one is a partial or agonist while the other is a full antagonist or an inverse agonist, a medicament comprising this comination, the use of the combiantion in the manufacture of a medicament for the treatment... Agent: Cooper & Dunham LLP 20090264458 - 5-ht7 receptor antagonists: The invention relates to compounds having pharmacological activity towards the 5-receptor, and more particularly to some 2,2a,4,5-tetrahydro-1H-3-aza-acenaphthylen substituted sulfonamide compounds, to processes of preparation of such compounds, to pharmaceutical compositions comprising them, and to their use for the treatment and or prophylaxis of a disease in which 5-HT is involved,... Agent: Locke Lord Bissell & Liddell LLP Attn:IPDocketing 20090264459 - Organic compounds: Compounds of formula (I) in free or a pharmaceutically acceptable salt form, wherein X1, L and Q have the meanings as indicated in the specification, are useful for treating obstructive or inflammatory airways diseases. Pharmaceutical compositions that contain the compounds and processes for preparing the compounds are also described.... Agent: Novartis Corporate Intellectual Property 20090264460 - Clopidogrel pharmaceutical formulations: Formulations of clopidogrel or pharmaceutically acceptable salts thereof, processes of preparation of such formulations, and methods of using them.... Agent: Dr. Reddy''s Laboratories, Inc. 20090264461 - Polymorph of (r)-3- (2-hydroxy-2, 2-diphenyl -acetoxy) -1- (isoxazol-s-ylcarbamoyl-methyl)-1-azoni a-bicyclo-[2.2.2] octane bromide: A novel polymorphic crystal form of (R)-3-(2-hydroxy-2,2-diphenyl-acetoxy)-1-(isoxazol-3-ylcarbamoyl-methyl)-1-azonia-bicyclo-[2.2.2]octane bromide, designated crystal form Talpha. Methods for preparing same and the use of the crystal form as the active ingredient of medicaments for the treatment of inflammatory or obstructive airways diseases are also described.... Agent: Novartis Corporate Intellectual Property 20090264462 - Kappa opioid receptor ligands: Kappa opioid receptor antagonists are provided that yield significant improvements in functional binding assays to kappa opioid receptors, and the use of these antagonists in treatment of disease states that are ameliorated by binding of the kappa opioid receptor such as heroin or cocaine addictions.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090264463 - Inhibitors of protein phosphatase-1 and uses thereof: Inhibitors of Protein Phosphatase-1 have been shown to slow replication of HIV-1. Inhibitors of PP 1 and their use for treatment or prevention of HIV-1 infections are disclosed.... Agent: Fitch Even Tabin & Flannery 20090264464 - Antitumor agent for undifferentiated gastric cancer: The therapeutic agent comprises a substance having the activity of inhibiting kinase activity of fibroblast growth factor receptor 2 (“FGFR2”). The therapeutic agent can be used for treating undifferentiated gastric cancer, and can also be used to treat organisms comprising a cell overexpressing FGFR2 or a cell expressing mutant FGFR2,... Agent: Darby & Darby P.C. 20090264465 - Crystalline forms of 4- [2- (4-methylphenylsulfanyl) -phenyl] piperidine with combined serotonin and norepinephrine reuptake inhibition for the treatment of neuropathic pain: Crystalline forms of 4-[2-(4-methylphenylsulfanyl)-phenyl]piperidine and salts thereof are provided e.g. for the treatment of neuropathic pain.... Agent: Darby & Darby P.C. 20090264466 - Certain chemical entities, compositions and methods: Chemical entities that modulate smooth muscle myosin and/or non-muscle myosin, pharmaceutical compositions and methods of treatment of diseases and conditions associated with smooth muscle myosin and/or non-muscle myosin are described.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20090264467 - Agents and crystals for improving excretory potency of urinary bladder: Agents for improving potency of the urinary bladder which comprise an amine compound of non-carbamate-type having an acetylcholinesterase-inhibiting action. Particularly, crystals of a tricyclic, condensed, heterocyclic derivative are provided, which possess an excellent action to inhibit acetylcholinesterase and an action to improve the excretory potency of the urinary bladder. As... Agent: Wenderoth, Lind & Ponack, L.L.P. 20090264468 - Methods for treating a disease in which rho kinase is involved: , wherein the ring X is a benzene ring or a pyridine ring; R1 and R2 are hydrogen or alkyl or together form a cycloalkene ring; R3 is hydrogen, substituted alkyl, unsubstituted alkenyl, carboxyl or an ester or an amide thereof, amino or a cyano; R4 is hydrogen, hydroxyl, substituted... Agent: Frishauf, Holtz, Goodman & Chick, PC 20090264470 - Cb1 antagonists and inverse agonists: The present invention relates to methods of treating obesity, anorexia nervosa, or bulimia nervosa comprising administering a compound of the invention. The present invention further relates to the treatment of metabolic syndrome comprising administering a compound of the invention.... Agent: Ropes & Gray LLP 20090264471 - Compounds, compositions and methods comprising triazole derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP 20090264469 - Novel dicarboxylic acid derivatives: The present patent application concerns new compounds of formula (I): displaying agonistic activity at sphingosine-1-phosphate (S1P) receptors, their process of preparation and their use as immunosuppressive agents.... Agent: Volpe And Koenig, P.C. 20090264472 - Methods and compositions for treating post-operative pain comprising a local anesthetic: The present invention is directed to an implantable drug depot useful for reducing, preventing or treating post-operative pain in a patient in need of such treatment, the implantable drug depot comprising a polymer and a therapeutically effective amount of a local anesthetic or pharmaceutically acceptable salt thereof, wherein the drug... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department 20090264473 - Novel crystalline forms of antidiabetic compounds: A novel crystalline anhydrate of the free acid and a crystalline anhydrous besylate salt of a selective PPAR gamma partial agonist which has a fused bicyclic aromatic group attached to an oxypropanoic acid moiety are stable and non-hygroscopic. The compounds are suitable for preparing pharmaceutical formulations for the treatment of... Agent: Merck And Co., Inc 20090264474 - Sulfonamides as trpm8 modulators: n 20090264475 - Methods and compositions for altering dietary behavior: The present invention concerns exploiting a characteristically negative behavior, such as habitual behavior or addiction, for example, for a beneficial purpose. In particular aspects, an individual desires eating healthy comestibles that comprises a positively-reinforcing compound, thereby consuming greater quantities of one or more healthy comestibles. In particular aspects, an obese... Agent: Fulbright & Jaworski, LLP 20090264477 - Beta adrenergic receptor agonists for treatment of pain and/or inflammation: Effective treatments of pain and/or inflammation are provided. Through the administration of an effective amount of at least one beta adrenergic agonist at or near a target site, one can reduce, prevent or treat pain and/or inflammation.... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department 20090264476 - Cb-1 receptor modulator formulations: Described herein are solid, stable pharmaceutical formulations of cannabinoid receptor inverse agonists, such as taranabant, and processes of making such formulations. Additionally, described herein are solid stable pharmaceutical formulations of cannabinoid inverse agonists, such as taranabant, and an additional therapeutic agent, as well as processes for making such pharmaceutical formulations.... Agent: Merck And Co., Inc 20090264478 - Sulfasalazine formulations in a biodegradable polymer carrier: Effective treatments of acute pain and/or inflammation for extended periods of time are provided. Through the administration of an effective amount of sulfasalazine at or near a target site, one can relieve pain caused by diverse sources, including but not limited to spinal disc herniation (i.e. sciatica), spondilothesis, stenosis, discogenic... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department 20090264479 - Papain family cysteine protease inhibitors for the treatment of parasitic diseases: Several parasites responsible for mammalian diseases are dependent on cysteine protease for various life-cycle functions. Inhibition of these proteases can be useful in the treatment of these parasitic diseases, including toxoplasmosis, malaria, African trypanosomiasis, Chagas disease, leishmaniasis or schistosomiasis.... Agent: Merck And Co., Inc 20090264480 - Trpa1 antagonists: v 20090264482 - Chemical compounds: This invention relates to non-steroidal compounds that are modulators of androgen receptor, and also to the methods for the making and use of such compounds.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B482 20090264481 - Compounds, compositions and methods comprising oxadiazole derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP 20090264483 - Methods of using ppar-gamma agonists and caspase-dependent chemotherapeutic agents for the treatment of cancer: This invention relates to compositions and methods utilizing a caspase-dependent chemotherapeutic drug and a PPARy-agonist, such as VP-16 or Taxol as the chemotherapeutic drug and troglitazone or pioglitazone as the PPARy agonist, for the treatment of cancer, including glioblastoma multiforme. The present invention demonstrates that PPAR agonists work with caspase-dependent... Agent: Davis Wright Tremaine LLP/los Angeles 20090264484 - Methods and medicaments for administration of ibuprofen: A method for administration of ibuprofen to a subject in need of ibuprofen treatment is provided, in which an oral dosage form comprising a therapeutically effective amount of ibuprofen and a therapeutically effective amount of famotidine is administered three times per day.... Agent: Townsend And Townsend And Crew, LLP 20090264486 - Compounds, compositions and methods comprising isoxazole derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP 20090264485 - Pyrazole derivatives, their manufacture and their use as pharmaceutical agents: e 20090264487 - Hemiasterlin analogs: This invention provides analogs of hemiasterlin, methods of synthesis of the analogs and use of the analogs as a cytotoxic anti-mitotic agents.... Agent: Arent Fox LLP 20090264488 - Novel solid forms of bendamustine hydrochloride: Novel solid forms of bendamustine hydrochloride are described, as well as methods of their preparation and use.... Agent: Ross J. Oehler Cephalon, Inc. 20090264490 - Clonidine formulations in a biodegradable polymer carrier: Effective treatments of pain for extended periods of time are provided. Through the administration of an effective amount of clonidine at or near a target site, one can relieve pain caused by diverse sources, including but not limited to spinal disc herniation (i.e. sciatica), spondilothesis, stenosis, discogenic back pain and... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department 20090264489 - Method for treating acute pain with a formulated drug depot in combination with a liquid formulation: Effective methods for treating pain are provided. Through the injection of liquid formulation comprising an active ingredient followed by the administration of drug depot comprising an active ingredient at or near a target site, one can effectively treat pain. This methodology is particularly effective to treat acute radicular pain.... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department 20090264491 - Methods and compositions for treating post-operative pain comprising clonidine: The present invention is directed to an implantable drug depot useful for reducing, preventing or treating post-operative pain in a patient in need of such treatment, the implantable drug depot comprising a therapeutically effective amount of clonidine or pharmaceutically acceptable salt thereof and a polymer; wherein the depot is implantable... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department 20090264492 - Pharmaceutical composition for the treatment of a fungal skin disorder and a method for the preparation thereof: The present invention relates to a pharmaceutical composition for photodynamic treatment of a fungal skin disorder, said pharmaceutical composition comprising a photosensitizer and an enhancer, wherein the photosensitizer is a cationic photosensitizer and the enhancer is chosen from the group of i) an acid, and ii) a metal chelating agent.... Agent: Darby & Darby P.C. 20090264493 - Process for producing aqueous solution of doripenem: e 20090264494 - Use of neuroprotective 3-substituted indolone compositions: The present invention include providing a therapeutically effective amount of a 3-substituted indolin-2-one compositions to protect against neurodegeneration including diseases such as Alzheimer's disease, Parkinson's disease, or Huntington's disease, and conditions such as ischemic stroke... Agent: Chalker Flores, LLP 20090264495 - Oral sustained-release pharmaceutical composition of indapamide, production and use thereof: An oral sustained-release pharmaceutical composition of indapamide and a process for producing the foregoing pharmaceutical composition are provided. The pharmaceutical composition comprises indapamide in an amount between 0.2% and 4% (w/w) of the composition, a hydrophilic polymer in an amount between 10 % and 30% (w/w) of the composition, a... Agent: Patenttm.us 20090264496 - Compounds, compositions and methods for making the same: The present invention provides compounds and/or compositions that modulate PP2A methylation and/or activity and methods for preparing the same, which are useful for modulating the demethylation of PP2A, modulating the methylation of PP2A and/or modulating the activity of PP2A.... Agent: Choate, Hall & Stewart LLP 20090264497 - Stable pharmaceutical formulation comprising a hmg-coa reductase inhibitor: The present invention relates to a stable solid pharmaceutical formulation for the treatment of hypercholesterolemia and hyperlipidemia. More precisely, the present invention relates to the new stable solid pharmaceutical formulation containing as an active ingredient a HMG-CoA reductase inhibitor, such as atorvastatin, pravastatin, fluvastatin and cerivastatin or pharmaceutically acceptable salts... Agent: Darby & Darby P.C. 20090264498 - Cathepsin c inhibitors: e 20090264499 - Cathepsin c inhibitors: 20090264500 - 3-substituted-1,5-diarly-2-alkyl-pyrroles highly selective and orally effective cox-2 inhibitors: This invention relates to 3-substituted-1,5-diaryl-2-alkyl-pyrroles of Formula I, pharmaceutical compositions containing them, and to their use for the pharmacological treatment of pain and COX-2 over-activation associated disorders. Compounds of this invention are new pyrrole derivatives bearing in position-3 of the pyrrole ring, several variously functionalized, not aliphatic, side chains which... Agent: Sughrue Mion, PLLC 20090264516 - Milbemycin compounds and treatment of dermatological disorders in humans therewith: Compounds of the milbemycin family or derivatives thereof are formulated into pharmaceutical compositions useful for the treatment of dermatological conditions in humans, in particular rosacea.... Agent: Buchanan, Ingersoll & Rooney PC 20090264517 - Milbemycin compounds and treatment of dermatological disorders in humans therewith: Compounds of the milbemycin family or derivatives thereof are formulated into pharmaceutical compositions useful for the treatment of dermatological conditions in humans, in particular rosacea.... Agent: Buchanan, Ingersoll & Rooney PC 20090264519 - Insulin sensitivity improving agent: The present invention relates to an insulin sensitivity-improving agent for obese children, which contains a catechin as an active ingredient. There is provided an insulin sensitivity-improving agent for obese children.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090264518 - Liquid koji and quick-brewed miso-like food: The present invention provides a method for producing a salt-free miso-like food having strong umami and rich flavor with strong taste. As a means to solve the problem, a liquid koji is prepared by culturing an aspergillus in a predetermined amount of lactic acid bacterium culture solution or a supernatant... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P. 20090264520 - Lipid-containing compositions and methods of use thereof: Lipid compositions comprising nuts, seeds, oils, legumes, fruits, grains, and dairy useful in specified amounts as dietary supplements and diet plans designed around and including the aforementioned for the prophylaxis and treatment of numerous diseases are disclosed. The compositions include omega-6 and omega-3 fatty acids where the ratio of the... Agent: Greenberg Traurig, LLP (sv)IPDocketing 20090264521 - Percutaneous absorption preparation: Percutaneous absorption preparations which make it possible to absorb compounds having a melatonin receptor agonist activity via a convenient administration system, have favorable blood-drug-concentration-time profile and can exert a therapeutic effect on a disease caused by a decrease in secretion of melatonin at night.... Agent: Wenderoth, Lind & Ponack, L.L.P. 20090264522 - Methods of treating central nervous system disorders with a low dose combination of escitalopram and bupropion: The present invention relates to a method of treating a central nervous system disorder, such as a mood disorder (e.g., major depressive disorder) or an anxiety disorder (e.g., general anxiety disorder, social anxiety disorder, post traumatic stress disorder, and panic disorder) with a low dose combination of escitalopram and bupropion.... Agent: Forest Laboratories, Inc. Attn: Charles S. Ryan 20090264523 - Method for prevention of degradation of thermally unstable medicament: The present invention provides a method for preventing the degradation of a thermally unstable medicament in an eye drop containing the medicament thereby to stabilize the eye drop. By adding an organic amine to an eye drop containing a thermally unstable medicament, the degradation of the medicament in the eye... Agent: Frishauf, Holtz, Goodman & Chick, PC 20090264524 - Agent for recovery from cerebral fatigue: e 20090264525 - Fluorosurfactants: The present invention relates to fatty acid esters of polyols or sulfonated fatty acid esters or sulfonated fatty acid amides containing at least one group Y, where Y stands for CF3—(CH2)a—O—, SF5—, CF3—(CH2)a—S—, CF3CF2S—, [CF3—(CH2)a]2N— or [CF3—(CH2)a]NH—, where a stands for an integer selected from the range from 0 to... Agent: Millen, White, Zelano & Branigan, P.C. 20090264527 - Method for stabilizing retinoic acid, retinoic acid containing composition, and method of using a retinoic acid containing composition: A method for stabilizing retinoic acid is provided. The method includes a step of mixing retinoic acid with a hydrophobic polymer/hydrophilic polymer adduct in the presence of an oxygen containing atmosphere to form a retinoic acid containing composition. The hydrophobic polymer/hydrophilic polymer adduct comprises a poly(vinylpyrrolidone/alkylene) polymer and a polymer... Agent: Merchant & Gould PC 20090264526 - Natural ligand of g protein coupled receptor rcc356 and uses thereof: The invention relates to the identification of isovaleric acid as a natural ligand of the RCC356 G-protein coupled receptor (GPCR). The invention encompasses the use of the interaction of RCC356 polypeptides and isovaleric acid as the basis of screening assays for agents that modulate the activity of the RCC356 receptor.... Agent: Edwards Angell Palmer & Dodge LLP 20090264529 - Activators of peroxisome proliferator-activated receptors: Activators of peroxisome proliferator-activated receptors comprising a polyprenyl compound, preferably (2E,4E,6E,10E)-3,7,11,15-tetramethyl-2,4,6,10,14-hexadecapentaenoic acid, as an active ingredient, and medicaments for preventive and/or therapeutic treatment of hyperlipidemia, non-insulin dependent diabetes mellitus or the like comprising a polyprenyl compound as an active ingredient.... Agent: Greenblum & Bernstein, P.L.C 20090264528 - Serine palmitoylcoa transferase (spt) inhibition by myriocin or genetic deficiency decreases cholesterol absorption: A first aspect of the invention provides a method of screening cholesterol absorption inhibitors, including: administering to a mammal a biologically effective amount of a candidate SPT inhibitor; and determining whether an amount at least one cholesterol absorption indicator protein in the intestine has changed after the administering step.... Agent: Hoffmann & Baron, LLP 20090264530 - Combined nsaid and acetaminophen formulation and method: The present invention is directed to co-administration of a non-steroidal anti-inflammatory agent (NSAID) and acetaminophen for the treatment of pain and inflammation with reduced gastrointestinal irritation. A pharmaceutical composition suitable for the co-administration contains a therapeutically effective amount of at least one non-steroidal anti-inflammatory agent, and a therapeutically effective amount... Agent: Stetina Brunda Garred & Brucker 20090264531 - Sulindac formulations in a biodegradable material: Effective treatments of pain and/or inflammation for extended periods of time are provided. Through the administration of an effective amount of sulindac or a pharmaceutically acceptable salt thereof at or near a target site, one can relieve pain and/or inflammation caused by diverse sources, including but not limited to spinal... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department 20090264532 - Preservatives based on carboxylic anhydrides: Carboxylic anhydrides are highly suitable as additive for industrial materials, cosmetics, pharmaceutics and foodstuffs, in particular beverages, for protecting them against attack and/or destruction by microorganisms.... Agent: Lanxess Corporation 20090264533 - Methods and compositions for modulating rho-mediated gene transcription: The present invention is directed to methods and compositions methods and compositions for determining and inhibiting gene transcription in mammalian cells. The invention relates to novel inhibitors of rho-mediated gene transcription and to compounds that may be used as therapeutic agents.... Agent: Marshall, Gerstein & Borun LLP 20090264534 - Selective androgen receptor modulators: The present invention relates to androgen receptor targeting agents (ARTA) which demonstrate androgenic and anabolic activity, which are nonsteroidal ligands for the androgen receptor. The selective androgen receptor modulators (SARM) are useful for a) male contraception; b) treatment of a variety of hormone-related conditions, for example conditions associated with Androgen... Agent: Pearl Cohen Zedek Latzer, LLP 20090264535 - Liquid drug formulation: The invention relates to a liquid drug formulation for beta-blockers, which is suitable in particular for oral application in animals.... Agent: Bayer Healthcare LLC 20090264536 - Methods and composition for treating a material: A composition and method are described for sanitizing or otherwise treating a material such as a non-living surface, living tissue, soil or atmosphere which may be contaminated by a toxin, chemical warfare agent, insect, prion, microorganism or other infectious agent. Also described are methods of making the composition.... Agent: Ian C. Mcleod Ian C. Mcleod, P.C. 20090264537 - Biodegradable block copolymeric compositions for drug delivery: An improved drug delivery composition and method of use is disclosed. The composition comprises one or more biodegradable block copolymer drug carriers; and a reconstitution enhancing and enabling agent comprising polyethylene glycol (PEG), a PEG derivative or a mixture of PEG and a PEG derivative. The composition can be administered... Agent: Hunton & Williams LLP Intellectual Property Department 20090264538 - Multifunctional polymeric tissue coatings: Compositions for coating biological and non-biological surfaces, which minimize or prevent cell-cell contact and tissue adhesion, and methods of preparation and use thereof are disclosed. Embodiments include polyethylene glycol/polylysine (PEG/PLL) block or comb-type copolymers with high molecular weight PLL (greater than 1000, more preferably greater than 100,000); PEG/PLL copolymers in... Agent: Pabst Patent Group LLP 20090264539 - Fluoropolymer-based medical implant coating compositions: Polymers of fluorinated monomers and acrylate and alkyl acrylates are disclosed which demonstrate improved performance as coatings for implantable devices. Such coatings may, for example, be used to release a bioactive agent from the medical device. One specific application lies in drug-eluting coatings for stents.... Agent: Fulbright & Jaworski, LLP 20090264540 - Novel derivatives of cyclodextrins, process for their preparation and their use in particular for solubilizing pharmacologically active substances: The invention relates to a compound corresponding to general formula (I) wherein n is a whole number from 1-6, m is a whole number equal to 5, 6 or 7, R1 is an OH group, all R1 s are identical, Z is an NHX group, X is a hydrogen atom,... Agent: Young & Thompson 20090264541 - Cosmetic composition comprising an oil: The present invention relates to a composition for making up or caring for the skin in the form of a water-in-oil emulsion comprising an aqueous phase, at least 5% by weight, relative to the total weight of the composition, of a dispersed solid phase and a liquid fatty phase having... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP Previous industry: Perfume compositionsNext industry: Colloid systems and wetting agents; subcombinations thereof; processes of ###### RSS FEED for 20091112: Integrate FreshPatents.com into your RSS reader/aggregator or website to track weekly updates. For more info, read this article. ###### Thank you for viewing Drug, bio-affecting and body treating compositions patents on the FreshPatents.com website. These are patent applications which have been filed in the United States. There are a variety ways to browse Drug, bio-affecting and body treating compositions patent applications on our website including browsing by date, agent, inventor, and industry. If you are interested in receiving occasional emails regarding Drug, bio-affecting and body treating compositions patents we recommend signing up for free keyword monitoring by email. ### FreshPatents.com Support Results in 5.24767 seconds |
* Easy, fast online form * Protect your Inventions * US Patent Office filing Provisional Patent Utility Patent - - - - - - - - - - - - - - - - - - - - - - * Fast online form * Protect your Name/Design * US Government filing Trademark Services - - - - - - - - - - - - - - - - - - - - - - PATENT INFO |