Drug, bio-affecting and body treating compositions patents - Monitor Patents
FreshPatents.com Logo    FreshPatents.com icons
Monitor Keywords Patent Organizer File a Provisional Patent Browse Inventors Browse Industry Browse Agents

USPTO Class 514  |  Browse by Industry: Previous - Next | All     monitor keywords
10/2011 | Recent  |  15: May | Apr | Mar | Feb | Jan | 14: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | 13: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | 12: Dec | Nov | Oct | Sep | Aug | July | June | May | April | Mar | Feb | Jan | 11: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | 10: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan |  | 09: Dec | Nov | Oct | Sep | Aug | Jl | Jn | May | Apr | Mar | Fb | Jn |  | 2008 | 2007 |

Drug, bio-affecting and body treating compositions October categorized by USPTO classification 10/11

Below are recently published patent applications awaiting approval from the USPTO. Recent week's RSS XML file available below.
Listing for abstract view: USPTO application #, Title, Abstract excerpt,Patent Agent. Listing format for list view: USPTO National Class full category number, title of the patent application.
10/27/2011 > 248 patent applications in 170 patent subcategories. categorized by USPTO classification

20110263480 - Method for treating prostatitis utilizing modified pore-forming protein proaerolysin: The present disclosure includes methods and compositions for treating any condition involving prostatitis and similar diseases and/or conditions. These methods and compositions involve the use of targeted modified pore-forming proteins, including variant proaerolysin proteins.... Agent: Protox Therapeutics, Inc.

20110263479 - Peptides: A peptide which can adopt a 310-helical conformation in which the side chains of two amino acid residues in the peptide backbone are linked by a group comprising an aromatic 5-membered ring.... Agent: Universitetet I Oslo

20110263481 - Pharmaceutical composition of lyophilized formulation and preparation method of the same: Disclosed is a pharmaceutical composition of a lyophilized formulation including a multiblock copolymer in which two or more ABA-type triblocks are covalently connected through biodegradable dicarboxylic linkage, wherein A represents a polyethylene oxide block and B represents a polypropylene oxide block, a polybutylene oxide block, or a block of copolymer... Agent: Samyang Corporation

20110263478 - Sur1 inhibitors for therapy: Methods and compositions are provided that are utilized for treatment and/or prevention of intraventricular hemorrhage or progressive hemorrhagic necrosis (PHN). In particular, the methods and compositions are inhibitors of a particular NCca-ATP channel and include, for example, inhibitors of SUR1 and/or inhibitors of TRPM4. Kits for treatment and/or prevention of... Agent:

20110263482 - Complement inhibitors: The invention relates to complement inhibitors that inhibit both the classical and alternative complement pathways. In particular, the invention relates to complement inhibitors derived from the salivary glands of haematophagous arthropods that inhibit both the classical and alternative complement pathways. The invention also relates to the use of such complement... Agent: Varleigh Immuno Pharmaceuticals (vip) Ltd

20110263483 - Compositions and methods for treating pathologic angiogenesis and vascular permeability: Compounds, compositions and methods for inhibiting vascular permeability and pathologic angiogenesis are described herein. Methods for producing and screening compounds and compositions capable of inhibiting vascular permeability and pathologic angiogenesis are also described herein. Pharmaceutical compositions are included in the compositions described herein. The compositions described herein are useful in,... Agent: University Of Utah Research Foundation

20110263484 - Single chain fc type iii interferons and methods of using same: The present invention relates to single chain Fc Type III Interferon fusion proteins and methods of using same. The single chain Fc Type III Interferon fusion proteins comprise at least one Type III Interferon, two Fc regions and at least one linker, can be produced in a variety of single... Agent: Zymogenetics, Inc.

20110263485 - Bifunctional griffithsin analogs: The present disclosure provides chimeric proteins, protein combinations and other compositions comprising a gp120-binding protein such as Griffithsin. Also provided are methods of using the proteins, protein combinations or compositions to prevent or treat HIV infection.... Agent: The Regents Of The University Of California

20110263486 - Inhibitors of cancer cell, t-cell and keratinocyte proliferation: e

20110263488 - Family of pesticidal proteins and methods for their use: Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for pesticidal polypeptides are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise... Agent: Athenix Corp.

20110263487 - Plant production and delivery system for recombinant proteins as protein-flour or protein-oil compositions: The present invention relates to a plant flour material comprising a ground, dried plant material, wherein the plant material contains a recombinant protein comprises a bactericidal or an insecticidal protein toxin, or combinations thereof. The present invention further relates to a seed oil body composition comprising a seed oil body... Agent: University Of Georgia Research Foundation, Inc.

20110263489 - Combination therapy to combat helminth resistance: Pharmaceutical compositions having at least one crystal protein and a nicotinic acetylcholine receptor agonist in amounts effective to inhibit a parasitic worm or helminth infection in a vertebrate or mammal are described. Methods for treating a parasitic worm or helminth infection in a subject are also described. The methods include... Agent: The Regents Of The University Of California Office Of Technology Transfer

20110263490 - Diagnostic methods and combination therapies involving mc4r: Methods and therapeutics are provided for treating metabolic disorders by activation of melanocortin signaling pathways. Generally, the methods and therapeutics can induce activation of melanocortin receptor signaling to increase energy expenditure and induce weight loss. In one embodiment, a method for performing a diagnostic procedure can be chosen, energy expenditure... Agent: Ethicon Endo-surgery, Inc.

20110263491 - Compositions and methods for the control, prevention and treatment of obesity and eating disorders: Compositions and methods for preventing, treating or controlling conditions or disorders associated with obesity, diet and nutrition are provided. The methods provided generally involve the administration of an Amylin or an Amylin agonist to a subject in order to prevent, treat or control conditions or disorders associated with obesity, diet... Agent: Amylin Pharmaceuticals, Inc.

20110263492 - Method to generate water soluble or nonwater soluble in nanoparticulates directly in suspension of dispersion media: A method for preparing a formulation containing nanoparticles of a compound is described. The method includes forming the compound into nanoparticles and then delivering the nanoparticles directly to a collection media. The collection media is a desired component of the formulation.... Agent:

20110263493 - Treatment for diabetes in patients inappropriate for metformin therapy: The present invention relates to the finding that certain DPP-4 inhibitors are particularly suitable for treating and/or preventing metabolic diseases, particularly diabetes, in patients for whom metformin therapy is inappropriate due to intolerability or contraindication against metformin.... Agent: Boehringer Ingelheim International Gmbh

20110263494 - Nonsteroidal compounds useful as modulators of glucocorticoid receptor ap-1 and/or nf-kappab acitivity and use thereof: Disclosed are compounds of Formula (I) wherein: one of A and D is —N— and the other of A and D is —C—; or enantiomers, diastereomers, or pharmaceutically-acceptable salts thereof. Also disclosed are methods of using such compounds to modulate the function of glucocorticoid receptor activity and pharmaceutical compositions comprising... Agent: Bristol-myers Squibb Company

20110263495 - Methods and kits for treating disease by administering insulin-like growth factor binding protein-2: The present invention is directed to methods of treating Type I diabetes by administering a therapeutically effective amount of an Insulin-like Growth Factor-binding protein-2. The present invention is also directed to methods treating Type 2 diabetes comprising the step of administering a therapeutically effective amount of Insulin-like Growth Factor-binding protein-2.... Agent: The Rockefeller University

20110263497 - Apo a-i mimetic peptides and methods of treatment: A method including advancing a delivery device through a lumen of a blood vessel to a particular region in the blood vessel; and introducing a synthetic apolipoprotein A-1 (Apo A-I) mimetic peptide into a wall of the blood vessel at the particular region, wherein the peptide has a property that... Agent: Abbott Cardiovascular Systems Inc.

20110263496 - Exendins to lower cholesterol and triglycerides: Provided herein are pharmaceutical formulations containing exendins, exendin agonists, or exendin analog agonists that are administered at therapeutic plasma concentration levels over a sustained period of time to lower total cholesterol levels; to lower LDL-cholesterol levels; to lower triglyceride levels; to treat dyslipidemia; to treat and slow the progression of... Agent: Amylin Pharmaceuticals, Inc.

20110263498 - Method and composition for enhancement of male erectile function: A pharmaceutical composition for enhancing male erectile function comprising an erectile function-enhancing amount of an insulin-like growth factor selected from the group consisting of IGF-1 (Somatmedin-C) and analogue LR3 IGF1 in admixture with a pharmaceutically-acceptable diluents or carrier. Such compositions optionally further comprise compounds selected from an androgen, particularly, testosterone... Agent:

20110263499 - Ifbm's to promote the specific attachment of target analytes to the surface of orthopedic implants: The present invention provides an improved coating for surfaces of medical implants. The coating comprises at least one interfacial biomaterial (IFBM) which is comprised of at least one binding module that binds to the surface of an implant or implant-related material (“implant module”) and at least one binding module that... Agent:

20110263500 - Curcumin conjugates for treating and preventing cancers: Conjugating LHRH to curcumin (LHRH-Curcumin) substantially enhances the bioavailability of curcumin, targets it to cells expressing LHRH receptors, facilitates intravenous administration, and increases the anti-cancer efficacy of curcumin. The conjugate may be used against cancer cells that express the LHRH receptor: pancreas, prostate, breast, testicular, uterine, ovarian, melanoma. LH-Curcumin conjugates... Agent:

20110263501 - Growth hormone conjugate with increased stability: Novel growth hormone conjugates comprising a growth hormone compound (GH) and a growth hormone binding protein (GHBP) are disclosed. The invention also encompasses a novel derivatization method for producing stable, long-lasting conjugate (hGH-GHBP) by site specific conjugation. The novel GH-GHBP conjugates have an extended half-life in circulation that facilitates therapeutic... Agent: Nono Nordisk Health Care Ag

20110263502 - Prodrugs and drug-macromolecule conjugates having controlled drug release rates: The present invention provides methods and compositions that permit controlled and prolonged drug release in vivo. The compounds are either prodrugs with tunable rates of release, or conjugates of the drug with macromolecules which exhibit tunable controlled rates of release.... Agent:

20110263503 - Treatment of bleeding with low half-life fibrinogen: The invention provides low-half life fibrinogen as a result of recombinant expression or enzymatic and chemical removal. The low-half life fibrinogen is useful in treating or effecting prophylaxis of bleeding particularly in situations of an acute nature in which a high initial dose and rapid decline to normal or below... Agent: Pharming Intellectual Property B.v.

20110263504 - Tissue protective peptides and peptide analogs for preventing and treating diseases and disorders associated with tissue damage: The present invention provides peptides and peptide analogs that have tissue protective activities while having little or no potentially undesirable hematopoietic effects. The peptides and peptide analogs are useful in preventing and treating a variety of diseases and disorders associated with tissue damage.... Agent:

20110263506 - Peptides having an ace inhibiting effect: Use of the tripeptide ITP and salts thereof for the preparation of a functional food angiotensin-converting enzyme inhibitor. Also provided is the use of the combination of tripeptide MAP and the tripeptide ITP and salts thereof as an angiotensin-converting enzyme inhibitor in functional foods.... Agent: Conopco, Inc. D/b/a Unilever

20110263505 - Whey protein hydrolysate containing tryptophan peptide consisting of alpha lactalbumin and the use thereof: The invention relates to a whey protein hydrolysate, in particular a hydrolysate consisting of whey protein enriched with α-lactalbumin and α-lactalbumin, and the use thereof for producing pharmaceuticals, anti-hypertensive agents, food supplements, foodstuffs and animal feed, and to pharmaceuticals, anti-hypertensive agents, food supplements, foodstuffs and animal feed produced in this... Agent: Technische Universit&#xc4 T Dresden

20110263507 - Peptide analogs that are potent and selective for human neurotensin receptor subtype 2: Neurotensin analogs selective for neurotensin receptor subtype 2 are described. These include hexapeptides (NT(8-13)) and pentapeptides (NT(9-13)) having a D-3,1-naphthyl-alanine, D-3,2-naphthyl-alanine, an alanine derivative such as cyclohexylalanine, or 1,2,3,4-tetrahydroisoquinoline at position 11. Methods of treating pain by administering these neurotensin analogs are also described.... Agent:

20110263508 - Compositions and methods for including melanogenesis in a subject: Described herein are compositions comprising an alpha-MSH analogue and a transdermal delivery system and methods for inducing melanogenesis and/or preventing UV radiation-induced skin damage in a subject by topical administration of these compositions.... Agent: Clinuvel Pharmaceuticals Limited

20110263509 - Preparation and use of high-purity hemoparatide (hpth-1-37) for the treatment of inflammatory scaling diseases of the skin: Use of hPTH-1-37 having the amino acid sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID No. 1) or one of its natural and pharmacologically compatible derivatives, especially amidated, acylated, phosphorylated and glycosylated derivatives, for preparing a medicament for the treatment of inflammatory scaling (erythematosquamous) diseases, especially psoriasis, wherein hPTH-1-37 (SEQ ID No. 1) is... Agent: Haemopep Pharma Gmbh

20110263510 - Methods of inhibiting cell death or inflammation in a mammal: Methods are provided for inhibiting cell death or inflammation in a mammal concurrent with or after the onset of a condition expected to lead to cell death or inflammation. The methods each include the step of administering to a mammal a Bcl protein in an amount sufficient to inhibit cell... Agent:

20110263511 - Tight junction protein modulators and uses thereof: The invention provides tight junction protein modulators, compositions comprising the same, and uses thereof. In particular, the invention provides tight junction protein modulators that modulate the second extracellular loop of tight junction proteins, such as occludin or claudin.... Agent:

20110263512 - Conjugates for the treatment of mesothelioma: The present invention provides conjugates of cytokines and targeting peptides that is able to bind to a receptor expressed on tumor-associated vessels or to a component of the extracellular matrix associated to the tumor vessels, for treatment of malignant pleural mesothelioma. In particular, the invention provides conjugates comprising the cytokine... Agent: Molmed S.p.a

20110263513 - Pharmaceutical being used for treating cancer and fibrosis disease and the composition and uses thereof: Provided is the composition of a peptide and its mutagenic version, or other derivatives with the same 3-D structure with activity to bind the extracellular domain of PDGFR-α, or -β, but does not dimerize by itself, wherein said peptide comprises the sequence shown as SEQ ID NO: 1, 2 or... Agent:

20110263514 - Delivery of agents using interfering nanoparticles: Provided are compositions and methods for delivery of therapeutic agents, such as chemically stabilized antisense oligonucleotides useful in RNA silencing. The compositions include interfering nanoparticles (iNOPs) associated with one or more agents. Several functional iNOP derivatives are provided which allow for targeted delivery of agents to specific cell types as... Agent: Sanford-burnham Medical Research Institute

20110263515 - Capture agents and related compositions, methods and systems: Multi-ligand capture agents comprising two or more ligands are described, and related compositions, methods and systems.... Agent:

20110263516 - Vasodilator: There is provided a vasodilator having an endothelium-dependent vasodilator effect, a prophylactic of arteriosclerosis, and functional food having an endothelium-dependent vasodilator effect, which is suitable for daily and regular intake and excellent in safety. The vasodilator and the functional food according to the present invention are characterized in at least... Agent: Calpis Co., Ltd.

20110263517 - Cytokines and cytokine receptors with reduced immunogenicity: The present invention provides methods for the identification of CD4+ T-cell epitopes in the sequences of various proteins, namely, human cytokines and cytokine receptors, as well as the production of peptides which when incorporated into the protein sequence, are no longer capable of initiating the CD4+ T-cell response. In some... Agent: Danisco Us, Inc.

20110263518 - D-tagatose-based compositions and methods for preventing and treating atherosclerosis, metabolic syndrome, and symptoms thereof: Pharmaceutical compositions including D-tagatose along with a stilbene or stilbenoid component, or a salt or derivative thereof. Methods of prophylaxis and therapy by administering to a mammal a pharmaceutically effective amount of D-tagatose, optionally in combination with a stilbene or stilbenoid component, or a salt or derivative thereof to prevent... Agent: University Of Kentucky Research Foundation

20110263519 - Regulators of the hedgehog pathway, compositions and uses related thereto: The present invention makes available, inter alia, methods and reagents for modulating smoothened-dependent pathway activation. In certain embodiments, the subject methods can be used to counteract the phenotypic effects of unwanted activation of a hedgehog pathway, such as resulting from hedgehog gain-of-function, ptc loss-of-function or smoothened gain-of-function mutations.... Agent: Johns Hopkins University School Of Medicine

20110263520 - Composition for use in controlling harmful organisms that contains 16-keto aspergillimide: Disclosed is a composition for use in controlling harmful organisms, comprising as active ingredients at least one of 16-keto aspergillimide, its enantiomers, their mixture, or their acid addition salts and at least one of other harmful organism control agents. The present invention provides a composition for use in controlling harmful... Agent:

20110263521 - Pharmaceutical or cosmetic preparations for topical and/or parenteral application, preparation methods thereof and use of same: The invention relates to a pharmaceutical or cosmetic composition for topical and/or parenteral application comprising, in a physiologically acceptable medium, at least one oligosaccharide and at least one inhibitor of hyaluronic acid degradation. The invention is of use in particular in human dermatology or in reconstructive surgery.... Agent:

20110263522 - Antitumour compositions containing taxane derivatives: Antitumor combinations comprising a taxane and at least one antibiotic for treating neoplastic diseases are described.... Agent: Aventis Pharma S.a.

20110263523 - Tet2 as a new diagnostic and pronostic marker in hematopoietic neoplasms: The present invention concerns an in vitro method for diagnosing a myeloid tumour or a lymphoid tumour in a subject, which comprises the step of analyzing a biological sample from said subject by (i) detecting the presence of a mutation in the Ten Eleven Translocation protein family member 2 gene... Agent: Institut National De La Sante Et De La Recherche Medicale (inserm)

20110263686 - Antisense oligonucleotides for inducing exon skipping and methods of use thereof: An antisense molecule capable of binding to a selected target site to induce exon skipping in the dystrophin gene, as set forth in SEQ ID NO: 1 to 202.... Agent: The University Of Western Australia

20110263679 - C12orf48 as a target gene for cancer therapy and diagnosis: Objective methods for diagnosing a predisposition to developing pancreatic cancer and prostate cancer, particularly pancreatic ductal adenocarcinoma (PDAC) and castration-resistant prostate cancer, are described herein. In one embodiment, the diagnostic method involves the step of determining an expression level of C12ORF48 using siRNAs targeting the C12ORF48 gene. The invention also... Agent: Oncotherapy Science, Inc.

20110263677 - Gos2 modulators in the treatment of acne, of seborrhoeic dermatitis or of hyperseborrhoea: An in vitro or in vivo method for screening for candidate compounds for the preventive or curative treatment of acne, of seborrhoeic dermatitis or of skin disorders associated with hyperseborrhoea, includes determining the ability of a compound to modulate the expression or the activity of G0/G1 switch protein 2 (GOS2),... Agent: Galderma Research & Development

20110263678 - Inhibitors of tgf-r signaling for treatment of cns disorders: The present invention relates to the use of oligonucleotides for the preparation of a pharmaceutical composition for the prevention or treatment of a disease, wherein neurogenesis and/or neuroregeneration has a beneficial effect, in particular a disease like Morbus Alzheimer, Morbus Parkinson, Lewy Body Dementia,—Amyotrophic Lateral Sclerosis, Spinocerebellar Atrophies, Creutzfeldt Jakob... Agent:

20110263684 - Lipid formulated compositions and methods for inhibiting expression of serum amyloid a gene: The invention relates to a double-stranded ribonucleic acid (dsRNA) targeting a Serum Amyloid A (SAA) gene, and methods of using the dsRNA to inhibit expression of SAA.... Agent: Alnylam Pharmaceuticals, Inc.

20110263685 - Method for identification of sensitivity of a patient to telomerase inhibition therapy: The invention provides methods for determining the susceptibility of cancer patients to developing adverse reactions if treated with a telomerase inhibitor drug by measurement of telomere length in appropriate cells of the patient prior to initiation of the telomerase inhibitor treatment.... Agent: Geron Corporation

20110263682 - Methods and means for efficient skipping of at least one of the following exons of the human duchenne muscular dystrophy gene: 43, 46, 50-53: The invention relates a method wherein a molecule is used for inducing and/or promoting skipping of at least one of exon 43, exon 46, exons 50-53 of the DMD pre-mRNA in a patient, preferably in an isolated cell of a patient, the method comprising providing said cell and/or said patient... Agent: Prosensa B.v.

20110263675 - Methods of modulating mesenchymal stem cell differentiation: The present disclosure includes compositions and methods for modulating the differentiation of cells having osteogenic differentiation potential (such as mesenchymal stem cells (MSCs)) towards the osteogenic fate, and for obtaining diagnostic and prognostic information relating to diseases and disorders characterized by defects in osteogenic differentiation. The compositions include miRNAs, rm′RNA... Agent: Dharmacon, Inc.

20110263681 - Organic compositions to treat beta-enac-related diseases: The present disclosure relates to RNAi agents useful in methods of treating Beta-ENaC-related diseases such as cystic fibrosis, pseudohypoaldosteronism type 1 (PHA1), Liddle's syndrome, hypertension, alkalosis, hypokalemia, and obesity-associated hypertension, using a therapeutically effective amount of a RNAi agent to Beta-ENaC.... Agent: Novartis Ag

20110263680 - Reduced size self-delivering rnai compounds: The present invention relates to RNAi constructs with minimal double-stranded regions, and their use in gene silencing. RNAi constructs associated with the invention include a double stranded region of 8-14 nucleotides and a variety of chemical modifications, and are highly effective in gene silencing. The RNAi constructs may be, for... Agent: Rxi Pharmaceuticals Corporation

20110263683 - Rna interference mediated inhibition of gene expression using chemically modified short interfering nucleic acid (sina): The present invention concerns methods and reagents useful in modulating gene expression in a variety of applications, including use in therapeutic, diagnostic, target validation, and genomic discovery applications. Specifically, the invention relates to synthetic chemically modified small nucleic acid molecules, such as short interfering nucleic acid (siNA), short interfering RNA... Agent:

20110263676 - Small interfering rna for gene knockdown of the subcutaneous n-methyl-d-aspartate receptor nr1 subunit, and it's application on pharmaceutics: A small interfering RNA for gene knockdown of the N-methyl-D-aspartate receptor NR1 subunit comprises 21 to 25 ribonucleic acids, which are homologous to the RNA sequence of N-methyl-D-aspartate receptor NR1 subunit. A method of using the small interfering RNA, applying the small interfering RNA on subcutaneous tissues temporary interfere with... Agent:

20110263689 - Akt ligands and polynucleotides encoding akt ligands: The invention relates to kinase ligands and polyligands. In particular, the invention relates to ligands, homopolyligands, and heteropolyligands that modulate AKT activity. The ligands, homopolyligands, and heteropolyligands are utilized as research tools or as therapeutics. The invention includes linkage of the ligands, homopolyligands, and heteropolyligands to a cellular localization signal,... Agent: Intrexon Corporation

20110263688 - Coferons and methods of making and using them: A monomer useful in prepaπng therapeutic compounds includes a diversity element which potentially binds to a target molecule with a dissociation constant of less than 300 11 M and a linker element connected to the diversity element The linker element has a molecular weight less than 500 daltons, is connected,... Agent: Cornell University

20110263690 - Methods and compositions for use in gene therapy for treatment of hemophilia: Provided are compositions of viruses, the viruses including a recombinant adeno-associated virus vector comprising at least two adeno-associated virus inverted terminal repeats, a promoter/regulatory sequence, isolated DNA encoding a blood coagulation factor and accompanying 5′ and 3′ untranslated regions and a transcription termination sequence.... Agent: The Children's Hospital Of Philadelphia

20110263687 - Rna molecules and uses thereof: The present invention relates to substantially single-stranded isolated RNA molecules comprising 18 to 19 contiguous nucleotides that corresponds to a non-protein-coding genomic DNA sequence located between −60 and +120 nucleotides from a transcription start site in a mammalian genome. Specifically, the isolated RNA molecules have a high GC content (>60%),... Agent: The University Of Queensland

20110263525 - Drug composition cytotoxic for pancreatic cancer cells: The invention describes a cytotoxic composition containing a drug combination targeting two or more functional elements in pancreatic cancer cells, the functional elements comprising EGFR or Src and Stat3 or Jaks. Preferred drugs in the drug combination are selected from ZD and S3I-201, Das and S3I-201, ZD and AG490, Das... Agent:

20110263524 - Sns-595 and methods of using the same: The present invention relates to SNS-595 and methods of treating cancer using the same.... Agent: Sunesis Pharmaceuticals, Inc.

20110263526 - Nitric oxide releasing prodrugs of therapeutic agents: The present invention relates to nitric oxide releasing prodrugs of known drugs or therapeutic agents which are represented herein as compounds of formula (I) wherein the drugs or therapeutic agents contain one or more functional groups independently selected from a carboxylic acid, an amino, a hydroxyl and a sulfhydryl group.... Agent: Piramal Life Sciences Limited

20110263527 - Sulfated galactans with antithrombotic activity, pharmaceutical composition, method for treating or prophylaxis of arterial or venous thrombosis, method of extraction and use thereof: The present invention relates to low molecular weight sulfated galactans, obtained from algae, particularly genus Botryocladia, preferably species Botryocladia occidentallis, which have no effect on the factor XII activation of the clotting cascade, having antithrombotic heparinoid activity. The present invention also refers to a pharmaceutical composition comprising said sulfated galactans... Agent:

20110263528 - Antimicrobial compositions: This invention provides antimicrobial compositions containing methylglyoxal and material with methylglyoxal contained (such as manuka honey). The antimicrobial activity of methylglyoxal, or material with a methylglyoxal presence, is maintained and/or enhanced by mixing methylglyoxal or material with a methylglyoxal presence with cyclodextrin. Methods of preparing such compositions, including powder composition,... Agent: Manuka Health New Zealand Limited

20110263529 - Gamma secretase modulators: In its many embodiments, the present invention provides a novel class of heterocyclic compounds as modulators of gamma secretase, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment, prevention, inhibition, or... Agent:

20110263530 - Aurora kinase modulators and method of use: wherein A1, A2, C1, C2, D, L1, L2, Z and R3, R4, R6, R7 and R8 are defined herein, which are capable of modulating Aurora kinase protein activity, thereby influencing various disease states and conditions related to the activities of Aurora kinase proteins. For example, the compounds are capable of... Agent: Amgen Inc.

20110263531 - Methods for the treatment and amelioration of atopic dermatitis: The present invention relates of the use of certain inner ionic (zwitter ionic) phospholipids, phosphonolipids and phosphate derivatives for the preparation of a pharmaceutical composition for the treatment, prevention and/or amelioration of an immunological disorder related to mast cell sensitization and/or activation. Preferred in this context are Edelfosine, Miltefosine and... Agent: Jado Technologies Gmbh

20110263532 - Halofuginone analogs for inhibition of trna synthetases and uses thereof: The present invention provides novel analogs and derivatives of halofuginone. The invention also provides pharmaceutical and cosmetic compositions thereof and methods for using halofuginone analogs in treating chronic inflammatory diseases, autoimmune diseases, dry eye syndrome, fibrosis, scar formation, angiogenesis, viral infections, ischemic damage, transplant and implant rejection, neurodegenerative diseases, and... Agent: President And Fellows Of Harvard College

20110263533 - Novel cyclic benzimidazole derivatives useful as anti-diabetic agents: Novel compounds of the structural formula (I) are activators of AMP-protein kinase and are useful in the treatment, prevention and suppression of diseases mediated by the AMPK-activated protein kinase. The compounds of the present invention are useful in the treatment of Type 2 diabetes, hyperglycemia, Metabolic Syndrome, obesity, hypercholesterolemia, and... Agent: Merck Sharp & Dohme Corp.

20110263534 - Phosphonated rifamycins and uses thereof for the prevention and treatment of bone and joint infections: The present invention relates to phosphonated Rifamycins, and methods of making and using such compounds. These compounds are useful as antibiotics for prophylaxis and/or the treatment of bone and joint infections, especially for the prophylaxis and/or treatment of osteomyelitis.... Agent: Targanta Therapeutics, Inc.

20110263535 - Tyrosine-based prodrugs of antiviral agents: A tyrosine-based (phosphonylmethoxyalkyl)purine or -pyrimidine conjugate is provided. In some embodiments, the conjugate includes tyrosine based amino acid or dipeptide moieties of (S)-9-(3-hydroxy-2-phosphonyl-methoxypropyl)adenine or its cytosine analogue. A method of synthesizing such conjugates based on Boc-protected amino acid or dipeptides is also provided. In addition, a method of isomerizing an... Agent:

20110263536 - Methods of treating orthopox virus infections and associated diseases: The present invention provides methods of treating diseases associated with at least one virus. The methods include administering a compound described in the invention in a therapeutically effective amount. According to some aspects of the present invention, the methods provide treatment of an orthopox virus infection or a disease related... Agent: Chimerix, Inc.

20110263537 - Co-administration of steroids and zoledronic acid to prevent and treat side effects from zoledronic acid infusion: Zoledronic Acid is used for treatment of hypercalcemia of malignancy, for the treatment of bone metastasis associated with malignancies such as prostate and breast cancer, for the prevention of and treatment of osteoporosis and for the treatment of Paget's disease. Administration of Zoledronic Acid is complicated by what is described... Agent:

20110263538 - Composition and method for controlling plant diseases: The present invention provides a composition for controlling plant diseases comprising, as active ingredients, ethaboxam and tolclofos-methyl.... Agent:

20110263539 - Ship 1 modulator compounds: The present invention provides the use of pelorol analogs of Formula, (I) and pharmaceutical compositions thereof as modulators of SHIP 1 activity. A compound or a pharmaceutical composition of the present invention may be used for the treatment or prophylaxis of an inflammatory, neoplastic, hematopoetic or immune disorder or condition... Agent: The University Of British Columbia

20110263540 - Small-molecule inhibitors of protein synthesis inactivating toxins: Small-molecule inhibitors of a protein synthesis inhibiting toxin, e.g., ricin, abrin, Shiga, and Shiga-like toxins, as well as methods of using the inhibitors are provided. Further provided are methods of identifying small-molecule inhibitors of a protein synthesis inhibiting toxin.... Agent:

20110263541 - Kinase inhibitors and their use as pharmaceutical agents: Described herein are compounds that are inhibitors of one or more protein kinases. Also described are pharmaceutical compositions and medicaments that include the compounds described herein. Also described herein are methods of using such protein kinase inhibitors, alone and in combination with other compounds, for conditions or diseases mediated or... Agent: Shanghai Genomics, Inc

20110263544 - 1-phenylpyrrole derivatives: The present invention comprises a compound for the prevention and/or treatment of cardiovascular diseases, nephropathy, fibrosis, primary aldosteronism or edema. The compound is of the following general formula (I): wherein R1 represents a C1-C3 alkyl group; R2 represents a hydroxy-C1-C4 alkyl group and the like; R3 represents a halogeno group,... Agent: Exelixis, Inc.

20110263543 - Anti inflammatory compounds: Biphenyl compounds of Formula (I) and Formula (II), and their pharmaceutically acceptable salts or solvates or prodrugs, their pharmaceutical compositions, their use and process of preparation are provided. Compounds of Formula (I) and Formula (II) are disclosed to exhibit anti-inflammatory properties.... Agent:

20110263542 - Methods to treat pain using an alpha-2 adrenergic agonist and an endothelin antagonist: The present invention relates, in general to treatment of pain comprising administering an alpha-2 adrenergic agonist and an endothelin antagonist, wherein administration of the agents acts as an analgesic and ameliorates pain in a subject.... Agent: Engogenx

20110263545 - Hepatoprotectant acetaminophen mutual prodrugs: The present invention provides hepatoprotectant acetaminophen mutual prodrugs, which have an acetaminophen moiety covalently linked to a second moiety that may act as a hepatoprotectant against acetaminophen hepatotoxicity. Additionally, acetaminophen mutual prodrugs may have improved water solubility which may provide better suitability for parenteral and other dosage forms relative to... Agent:

20110263546 - Polyhydroxylated bile acids for treatment of biliary disorders: The invention provides, in part, polyhydroxylated bile acids for treating biliary disorders, for example, biliary disorders arising out of cholestasis or portal hypertension. The invention also provides, in part, polyhydroxylated bile acids for stimulating bile flow.... Agent:

20110263549 - 4-dimethylamino-phenyl-substituted naphthyridines, and use thereof as medicaments: The invention relates to novel substituted naphthyridines of formula 1 as well as pharmacologically acceptable salts, diastereomers, enantiomers, racemates, hydrates, or solvates thereof. In formula 1, R1 can represent a group A selected from among the group comprising —O—R3, —NR3 R4, —CR3R4R5, -(ethyne)-R3, —S—R3, —SO—R3, and SO2—R3, or R1 represents... Agent: Boehringer Ingelheim International Gmbh

20110263547 - C-19 steroids for specific therapeutic uses: The present invention relates to novel uses of C-19 steroid compounds, in particular C-19 steroids having an androsten-17-(OR4)-3-one structure for prophylactic and/or therapeutic uses, wherein R4 is hydrogen or an unsubstituted or substituted alkyl, aryl, acyl or any group leading to hydroxyl upon biological metabolization or chemical deprotection. The present... Agent: Procima Gmbh

20110263551 - Method for treating otitis externa: A method is provided for treating swimmer's ear and other types of otitis externa. The method comprises (a) diagnosing an instance of swimmer's ear in a patient; and (b) applying to the meatal tissues of the external ear of the patient, in a single application, a volume of a pharmaceutical... Agent:

20110263552 - Modulation of side effect profile of 5-alpha reductase inhibitor therapy: Methods for modulating one or more side effects of 5-α-reductase inhibitor therapy are provided, where the method includes administering a 5-α-reductase inhibitor and testosterone undecanoate. Also provided are methods of maintaining or restoring a DHT serum level in an individual undergoing 5-α-reductase inhibitor therapy, where the method includes administering testosterone... Agent: Sov Therapeutics

20110263548 - Pyridone and pyridazone analogues as gpr119 modulators: Novel compounds of structure Formula (I) or an enantiomer, a diastereomer, or a pharmaceutically acceptable salt thereof, wherein Z, R1, R2, R21, T1, T2, T3 and T4 are defined herein, are provided which are GPR119 G protein-coupled receptor modulators. GPR119 G protein-coupled receptor modulators are useful in treating, preventing, or... Agent: Bristol-myers Squibb Company

20110263550 - Therapeutic agent for chronic obstructive pulmonary disease: or a pharmaceutically acceptable salt of the compound or a prodrug of the compound or salt: wherein X represents an oxygen or sulfur atom; R1 represents a hydrogen atom, a substituted or unsubstituted alkyl or the like; R2 represents a hydrogen atom, a substituted or unsubstituted alkyl or the like;... Agent: Dainippon Sumitomo Pharma Co., Ltd.

20110263553 - Steroid analogues for neuroprotection: Provided are steroid analogues functionalized with polar substituents at the C3 and/or C20 positions of the steroid ring system that exhibit improved water solubility. Also provided are pharmaceutical compositions comprising the steroid analogues and methods using the novel steroid analogues for the treatment and prevention of neurodegeneration in a patient... Agent: Emory Univerisity

20110263554 - Screen for inhibitors of filovirus and uses therefor: The invention provides methods to identify agents useful to prevent, inhibit or treat viral infections, e.g. filovirus infections, as well as compositions having one or more agents to prevent, inhibit or treat viral infection.... Agent: Warf - Wisconsin Alumni Research Foundation

20110263555 - Tgr5 modulators and methods of use thereof: The invention relates to compounds of Formula (A): (A) or a salt, solvate, hydrate, or amino acid conjugate thereof. The compounds of formula A are TGR5 modulators useful for the prevention and treatment of disease.... Agent:

20110263556 - New compounds: e

20110263558 - Azetidines as mek inhibitors for the treatment of proliferative diseases: Disclosed are compounds of Formula (I) and pharmaceutically acceptable salts and solvates thereof. Such compounds are MEK inhibitors and are useful in the treatment of proliferative diseases, such as cancer. Also disclosed are pharmaceutical compositions containing such compounds as well as methods of using the compounds and compositions of the... Agent: Exelixis, Inc.

20110263559 - Indazole compounds useful as ketohexokinase inhibitors: The present invention is directed to substituted indazole compounds, pharmaceutical compositions of these compounds and methods of use thereof. The compounds of the present invention are ketohexokinase (KHK) inhibitors, useful for treating or ameliorating a KHK mediated metabolic disorders and/or diseases such as obesity, Type II diabetes mellitus and Metabolic... Agent:

20110263560 - Organic compounds: 3,4-substituted piperidine compounds, these compounds for use in the diagnostic and therapeutic treatment of a warm-blooded animal, especially for the treatment of a disease (=disorder) that depends on activity of renin; the use of a compound of that class for the preparation of a pharmaceutical formulation for the treatment of... Agent: Novartis Ag

20110263557 - Compounds and compositions as modulators of gpr119 activity: The invention provides compounds, pharmaceutical compositions comprising such compounds and methods of using such compounds to treat or prevent diseases or disorders associated with the activity of GPR119; such as, but not limited to, diabetes, obesity and associated metabolic disorders. Formula (I) is a compound, in which A can have... Agent: Irm LLC

20110263566 - 7-hydroxy-benzoimidazole-4-yl-methanone derivatives and pbk inhibitors containing the same: 7-Hydroxy-benzoimidazole-4-yl-methanone Derivatives, which are useful for PBK inhibitors, are provided.... Agent:

20110263563 - Ansamycin hydroquinone compositions: Aspects of the present invention provide compositions comprising a sulfur containing compound and a compound of the formula (I); and also provide methods of their preparation and use.... Agent: Infinity Disdcovery, Inc.

20110263562 - Bicyclic compound: p

20110263565 - Compounds: The present invention encompasses compounds of general formula (1), wherein R1 to R4 are defined as in claim 1, which are suitable for the treatment of diseases characterised by excessive or abnormal cell proliferation, and their use for preparing a medicament having the above-mentioned properties.... Agent: Boehringer Ingelheim International Gmbh

20110263561 - Novel pyrrolidone derivatives for use as metap-2 inhibitors: Compounds of the formula (I), in which R, X, Y, Z, R3 and R4 have the meanings indicated in claim 1, are inhibitors of methionine aminopeptidase and can be employed for the treatment of tumours.... Agent: Merck Patent Gmbh

20110263564 - Pyridine, bicyclic pyridine and related analogs as sirtuin modulators: Provided herein are novel sirtuin-modulating compounds and methods of use thereof. The sirtuin-modulating compounds may be used for increasing the lifespan of a cell, and treating and/or preventing a wide variety of diseases and disorders including, for example, diseases or disorders related to aging or stress, diabetes, obesity, neurodegenerative diseases,... Agent: Sirtris Pharmaceuticals, Inc.

20110263568 - Topical pharmaceutical composition comprising a cholinergic agent or a calcium channel blocker: A method and composition are provided for the treatment of an anorectal disorder and for controlling the pain associated therewith. The method comprises administering to a subject in need of such treatment therapeutically effective amounts of a calcium channel blocker either alone or together with a nitric oxide donor. Amlodipine,... Agent:

20110263569 - Ryanodine channel binders and uses thereof: Increasing the affinity of calstabin-2 for the cardiac calcium channel RyR2 and thereby stabilizing the channel in the closed state has recently been identified as novel mechanism for treating heart failure, particularly ventricular arrhythmias. JTV-519, a 1,4-benzothiazepine derivative, has been shown to stabilize the calstabin2/RyR2 complex. Novel derivatives of JTV-519... Agent: President And Fellows Of Harvard College

20110263567 - Compounds for inhibiting semicarbazide-sensitive amine oxidase (ssao) / vascular adhesion protein-1 (vap-1) and uses thereof for treatment and prevention of diseases: The present invention relates to compounds of general formula (i) having an oxime moiety or a pharmaceutically acceptable salt, hydrate or solvate thereof and its use for inhibiting semicarbazide-sensitive amine oxidase (SSAO), also known as vascular adhesion protein-1 (VAP-1), a pharmaceutical composition comprising the compound or a salt, hydrate or... Agent: Semmelweis Egyetem

20110263570 - Pyrimidine derivatives as gpcr modulators for use in the treatment of obesity and diabetes: The present invention relates to Pyriraidine Derivatives of formula (I), compositions comprising a Pyrimidine Derivative, and methods of using the Pyrimidine Derivatives for treating or preventing obesity, diabetes, a diabetic complication, a metabolic disorder, a cardiovascular disease or a disorder related to the activity of a G protein-coupled receptor (GPCR)... Agent: Schering Corporation

20110263572 - 3-aminoalkyl-1,4-diazepan-2-one melanocortin-5-receptor antagonists: The present invention provides compounds of Formula (I) that are useful for modulating the biological activity of the melanocortin-5 receptor (MC5R). Compounds of this invention can be used to treat diseases and/or conditions in which downregulation of MC5R is beneficial. Such diseases and/or conditions include, but are not limited to,... Agent: Mimetica Pty Ltd

20110263571 - Novel amide derivative and use thereof as medicine: e

20110263573 - Heterobiaryl-cyclohexyl-tetraazabenzo[e]azulenes: wherein R1, R2 and R3 are as described herein. The compounds according to the invention act as V1a receptor modulators, and in particular as V1a receptor antagonists, their manufacture, pharmaceutical compositions containing them and their use as medicaments. The active compounds of the present invention are useful as therapeutics acting... Agent:

20110263574 - Pirenzepine as otoprotective agent: The present invention generally relates to the otoprotective activity of condensed diazepinones, e.g. condensed benzodiazepines such as pirenzepine or compounds which are metabolized to condensed benzodiazepinones such as olanzapine. These compounds are suitable as medicaments for the prevention and/or treatment of otic diseases, e.g. diseases associated with loss of hearing.... Agent: Proteosys Ag

20110263575 - Compounds useful as protein kinase inhibitors: The present invention relates to compounds useful as inhibitors of protein kinase. The invention also provides pharmaceutically acceptable compositions comprising said compounds and methods of using the compositions in the treatment of various disease, conditions, or disorders.... Agent: Vertex Pharmaceuticals Incorporated

20110263577 - Novel oxadiazolyl-diazabicyclononane derivatives and their medical use: This invention relates to novel oxadiazolyl-diazabicyclononane derivatives and their use in the manufacture of pharmaceutical compositions. The compounds of the invention are found to be cholinergic ligands at the nicotinic acetylcholine receptors and modulators of the monoamine receptors and transporters. Due to their pharmacological profile the compounds of the invention... Agent: Neurosearch A/s

20110263576 - Pharmaceutical composition containing benzodiazepine and/or benzodiazepine derivatives: The invention relates to a pharmaceutical composition characterized in that it comprises a benzodiazapine and/or benzodiazapine derivative, and a non-ionic solubilizer, and induces in said combination an analogous effect to an opiate, described as a Straub phenomenon.... Agent:

20110263578 - Heteroaryl-cyclohexyl-tetraazabenzo[e]azulenes: The compounds according to the invention act as V1a receptor modulators, and in particular as V1a receptor antagonists, their manufacture, pharmaceutical compositions containing them and their use as medicaments. The active compounds of the present invention are useful as therapeutics acting peripherally and centrally in the conditions of dysmenorrhea, male... Agent:

20110263579 - Chlorothiazide, chlorothiazide salts and pharmaceutical compositions thereof: The present invention relates to an improved process for the preparation of Chlorothiazide and pharmaceutically acceptable salts thereof. The present invention relates to novel polymorphs of Chlorothiazide and Chlorothiazide salts, in particular Chlorothiazide sodium. The present invention further relates to pharmaceutical compositions comprising Chlorothiazide and Chlorothiazide salts, in particular Chlorothiazide... Agent: Usv Limited

20110263580 - Method for treating alzheimer's disease and related conditions: This invention relates to a method for treating or preventing diseases associated with the deposition of β-amyloid peptide in the brain, such as Alzheimer's disease, said method involving administration of a gamma-secretase inhibitor in an intermittent dosing regime to a patient in need thereof.... Agent:

20110263581 - Fused tricyclic compounds as serine-threonine protein kinase and parp modulators: The invention relates in part to molecules having certain biological activities that include, but are not limited to, inhibiting cell proliferation, modulating protein kinase activity and modulating polymerase activity. Molecules of the invention can modulate casein kinase (CK) activity and/or poly(ADP-ribose)polymerase (PARP) activity. The invention also relates in part to... Agent: Cylene Pharmaceuticals, Inc.

20110263583 - Cyclic inhibitors of 11beta-hydroxysteroid dehydrogenase 1: This invention relates to novel compounds of the Formula Il Ik, Im3, Im4, Im6-12, In3, In4, In6-12, lo3, lo4, lo6-12, Ip2, Ip4-7, pharmaceutically acceptable salts thereof, and pharmaceutical compositions thereof, which are useful for the therapeutic treatment of diseases associated with the modulation or inhibition of 11β-HSD1 in mammals. The... Agent: Vitae Pharmaceuticals, Inc.

20110263584 - Cyclic inhibitors of 11beta-hydroxysteroid dehydrogenase 1: This invention relates to novel compounds of the Formula I, Ik, Iq1-21, Ir1-21, Is1-21, It1-7, pharmaceutically acceptable salts thereof, and pharmaceutical compositions thereof, which are useful for the therapeutic treatment of diseases associated with the modulation or inhibition of 11 β-HSD1 in mammals. The invention further relates to pharmaceutical compositions... Agent: Vitae Pharmaceuticals, Inc. Boehringer Ingelheim International Gmbh

20110263582 - Cyclic urea inhibitors of 11 b-hydroxysteroid dehydrogenase 1: This invention relates to novel compounds of the Formula (I), (Ia) and (Ib), pharmaceutically acceptable salts thereof, and pharmaceutical compositions thereof, j which are useful for the therapeutic treatment of diseases associated with the modulation or inhibition of 11β-HSD1 in mammals. The invention further relates to pharmaceutical compositions of the... Agent:

20110263586 - Pest controlling composition and method of controlling pest: A pest controlling composition comprising tolclofos-methyl and a neonicotinoid compound represented by the formula (1) as active ingredients.... Agent: Sumitomo Chemical Company, Limited

20110263585 - Screening assay for insecticides: The present invention relates to polypeptides, preferably from Drosophila melanogaster (DmShaI) as target for insecticides.... Agent: Basf Se

20110263587 - Reversibly heat-gelable aqueous composition: The present invention relates to a reversibly heat-gelable aqueous composition comprising a reversibly heat-gelable aqueous composition according to conventional technique, to which a thixotropic property-increasing substance is added. The thixotropic property-increasing substance is preferably at least one member selected from the group consisting of sugar alcohol, lactose, carmellose or pharmaceutically... Agent: Wakamoto Pharmaceutical Co., Ltd.

20110263590 - Antibacterial compositions: wherein: m is 0 or 1; Q is hydrogen or cyclopropyl; Alk is an optionally substituted, divalent C1-C6 alkylene, alkenylene or alkynylene radical which may contain an ether (—O—), thioether (—S—) or amino (—NR)— link, wherein R is hydrogen, —CN or C1-C3 alkyl; X is —C(═O)NR6—, —S(O)NR6—, —C(═O)O— or —S(═O)O—... Agent: Biota Europe Limited

20110263589 - Method for preventing or treating a glucocorticoid receptor-related disease: A method of preventing or treating a glucocorticoid receptor-related disease involving administering a therapeutically effective amount of a 1,2-dihydroquinoline compound or a pharmaceutically acceptable salt thereof.... Agent: Santen Pharmaceutical Co., Ltd.

20110263588 - Tricyclic compounds as glutamate receptor modulators: The present invention relates to compounds that may be negative allosteric modulators of metabotropic receptors-subtype 5, and methods of making and using same.... Agent: Glaxo Group Limited

20110263591 - 2-heteroaryl carboxamides: The invention relates to novel 2-heteroaryl carboxamides and to the use thereof for producing medicaments for the treatment and/or prophylaxis of diseases and for improving perception, concentration, learning and/or memory.... Agent: Bayer Schering Pharma Ag

20110263592 - Imidazo[1,2-a]pyridine derivatives as modulators of the 5-ht2a serotonin receptor useful for the treatment of disorders related thereto: Imidazo[1,2-α]pyridine derivatives of Formula (Ia) and pharmaceutical compositions thereof that modulate the activity of the 5-HT2A serotonin receptor. Compounds and pharmaceutical compositions thereof are directed to methods useful in the treatment of insomnia, dyssomnia, parasomnia and related sleep disorders, platelet aggregation, coronary artery disease, myocardial infarction, transient ischemic attack, angina,... Agent: Arena Pharmaceuticals, Inc.

20110263593 - Novel imidazo[1,2-a]pyrimidine derivatives, method for the preparation thereof, use thereof as medicaments, pharmaceutical compositions and novel use, in particular as met inhibitors: The disclosure concerns imidazo[1,2-a]pyrimidine derivatives of formula (I) and isomers and pharmaceutically acceptable salts thereof. Methods for preparing the compounds, pharmaceutical compositions, and methods of treatment also are disclosed.... Agent: Sanofi-aventis

20110263594 - Novel triazolo(4,3-a)pyridine derivatives, process for the preparation thereof, use thereof as medicaments, pharmaceutical compositions and novel use, in particular as met inhibitors: The invention relates to the novel products of formula (I): in which: Ra represents H, Hal, aryl or heteroaryl, which is optionally substituted; Rb represents H, Rc, —COORc-CO-Rc or —CO—NRcRd; where Rc represents alkyl, cycloalkyl, heterocycloalkyl, aryl and heteroaryl, all optionally substituted; Rd represents H, alk or cycloalkyl; these products... Agent: Sanofi-aventis

20110263596 - 2-oxo-3-benzylbenzoxazol-2-one derivatives and related compounds as met kinase inhibitors for the treatment of tumours: Described are compounds which inhibit, regulate and/or modulate kinase signal transduction, for example of Met kinase. The compounds are of the formulae A1 to A148 and B1 described herein, including 2-oxobenzoxazol-3-ylmethyl]phenyl}carbamate and 2-oxooxazolo[4,5-b]pyridin-3-ylmethyl)phenyl]carbamate compounds, and pharmaceutically usable salts, tautomers and stereoisomers thereof, including mixtures thereof in all ratios. Also described... Agent:

20110263595 - Compounds and methods for kinase modulation, and indications therefor: Compounds and salts thereof, formulations thereof, conjugates thereof, derivatives thereof, forms thereof and uses thereof are described. In certain aspects and embodiments, the described compounds or salts thereof, formulations thereof, conjugates thereof, derivatives thereof, forms thereof are active on one or more of Fms, Kit, Flt3, TrkA, TrkB and TrkC... Agent:

20110263597 - Substituted pyridines and pyridazines with angiogenesis inhibiting activity: wherein the ring containing A, B, D, E, and L is phenyl or a nitrogen-containing heterocycle; groups X and Y may be any of a variety of defined linking units; R1 and R2 may be defined independent substituents or together may be a ring-defining bridge; ring J may be an... Agent: Bayer Healthcare LLC

20110263598 - Kinase inhibitors and method of treating cancer: e

20110263599 - 7-nonsubstituted indole mcl-1 inhibitors: Compounds which inhibit the activity of anti-apoptotic Mcl-1 protein, compositions containing the compounds, and methods of treating diseases involving overexpressed or unregulated Mcl-1 protein are disclosed.... Agent: Abbott Laboratories

20110263600 - Method for preventing or treating a disease related to the glucocorticoid receptor: A method for preventing or treating a disease related to the glucocorticoid receptor involving administering a pharmacologically effective amount of a 1,2-dihydroquinoline compound or a pharmaceutically acceptable salt thereof.... Agent: Santen Pharmaceutical Co., Ltd.

20110263601 - Methods of treating ulcerative colitis: Methods are disclosed for treating ulcerative colitis and related diseases and disorders, which comprise inhibiting tryptophan hydroxylase (TPH) in patients in need thereof.... Agent:

20110263602 - Tetrasubstituted pyridazine hedgehog pathway antagonists: The present invention provides novel tetrasubstituted pyridine hedgehog pathway antagonists of the following formula I (I) or a pharmaceutically acceptable salt thereof, wherein: X is C—R1 or N; R1 is hydrogen, fluoro or cyano; R2 is formula II (II), piperidinyl, or gem di-F-substituted cyclohexyl; R3 is methyl or trifluoromethyl; R4... Agent: Eli Lilly And Company

20110263603 - Imine compounds for combating invertebrate pests: The present invention relates to imine compounds which are useful for combating or controlling invertebrate pests, in particular arthropod pests and nematodes. The invention also relates to a method for controlling invertebrate pests by using these compounds and to plant propagation material and to an agricultural and a veterinary composition... Agent: Basf Se

20110263604 - Oxidase inhibitors and their use: The invention relates to phenylcyclopropylamine acetamide derivatives and their use in treating diseases.... Agent: Oryzon Genomics, S.a.

20110263605 - Azabicyclo[2.2.1]heptane compounds as alpha-7 nicotinic acetylcholine receptor ligands: The disclosure provides compounds of formula I, including Ia, Ib, Ic, or Id, including their salts, as well as compositions and methods of using the compounds. The compounds are ligands for the nicotinic α7 receptor and may be useful for the treatment of various disorders of the central nervous system,... Agent: Bristol-myers Squibb Company

20110263608 - 16-keto aspergillimides and harmful organism control agent comprising the same as active ingredient: Disclosed is a composition for use in controlling ectoparasites, comprising as an active ingredient at least one of compounds represented by formula (I) or (III) or salts thereof. The present invention provides a composition for use in controlling ectoparasites that has excellent ectoparasite control effect and is highly safe.... Agent: Meiji Seika Pharma Co., Ltd.

20110263607 - Alpha helix mimetics in the treatment of cancer: Alpha-helix mimetic structures and compounds represented by the formula (I) wherein the general formula and the definition of each symbol are as defined in the specification, a compound relating thereto, and methods relating thereto, are disclosed. Applications of these compounds in the treatment of medical conditions, e.g., cancer diseases, fibrotic... Agent: Prism Biolab Corporation

20110263606 - Solid oral dosage forms comprising tadalafil: Improved pharmaceutical solid oral dosage forms for the buccal and/or sublingual delivery of Tadalafil. The improved delivery systems for solubilizing and stabilizing pharmaceutically active ingredients exhibit enhanced methods of preparation by the use improved solubilization systems which can maintain the Tadalafil in a buccal and/or sublingual oral dosage form or... Agent:

20110263609 - Methods of identifying and treating individuals exhibiting nup214-abl1 positive t-cell malignancies with protein tyrosine kinase inhibitors and combinations thereof: The invention described herein relates to diagnostic and treatment methods and compositions useful in the management of disorders, for example cancers, involving NUP214-ABL1 positive T-cell malignancies and methods for treating an individual suffering from a NUP214-ABL1 positive T cell malignancy.... Agent:

20110263610 - Compounds and compositions as itpkb inhibitors: The invention provides a novel class of compounds, pharmaceutical compositions comprising such compounds and methods of using such compounds to treat or prevent diseases or disorders associated with abnormal or deregulated B cell activities, particularly diseases or disorders that involve aberrant activation of inositol 1,4,5-trisphosphate 3-kinase B (ITPKb).... Agent: Irm LLC

20110263611 - Kinase inhibitors: The present invention relates to drug delivery systems comprising ocular implant, which include organic molecules, capable of modulating tyrosine kinase signal transduction in order to regulate, modulate and/or inhibit abnormal cell proliferation, in combination with a polymer, which polymer serves to control, modify, modulate and/or slow the release of the... Agent: Allergan, Inc.

20110263612 - Compounds that modulate intracellular calcium: Described herein are compounds and pharmaceutical compositions containing such compounds, which modulate the activity of store-operated calcium (SOC) channels. Also described herein are methods of using such SOC channel modulators, alone and in combination with other compounds, for treating diseases or conditions that would benefit from inhibition of SOC channel... Agent: Calcimedica, Inc.

20110263613 - Compounds and compositions for cognition-enhancement, methods of making, and methods of treating: Disclosed are muscarinic agonist compounds including oxadiazole derivatives, compositions and preparations thereof. Also disclosed are methods of synthesizing such oxadiazole compounds. Further disclosed are methods for treating a subject with said muscarinic agonists or a pharmaceutically suitable form thereof to enhance cognitive function.... Agent:

20110263614 - Novel compounds: The present invention relates to substituted indoles useful as pharmaceutical compounds for treating respiratory disorders.... Agent:

20110263615 - Pyridine and pyrimidine derivatives as mglur2 antagonists: e

20110263616 - 11-(2-pyrrolidin-1-yl-ethoxy)-14,19-dioxa-5,7,26-triaza-tetracyclo[,6).1(8,12)]heptacosa-1(25),2(26),3,5,8,10,12(27),16,21,23-decaene maleate salt: The present invention relates to certain salts of a 11-(2-pyrrolidin-1-yl-ethoxy)-14,19-dioxa-5,7,26triaza-tetra-cyclo[,6).1(8,12)]heptacosa-1(25),2(26),3,5,8,10,12(27),16,21,23-decaene (Compound I) which have been found to have improved properties. In particular the present invention relates to the maleate salt of this compound. The invention also relates to pharmaceutical compositions containing this salt and methods of use of the salt... Agent: S*bio Pte Ltd.

20110263617 - Combination therapy for the treatment of diabetes and related conditions: The present invention relates to combinations of DPP-4 inhibitors with GPR119 agonists, as well as to the use of these combinations for treating and/or preventing metabolic diseases, particularly diabetes (especially type 2 diabetes mellitus) and conditions related thereto.... Agent: Boehringer Ingelheim International Gmbh

20110263618 - Method of promoting hair growth: The present invention is an invention belonging to the life style improving cosmetic in the field of hair maintenance and enrichment. More particularly, it relates to cosmetic compositions having an improved hair care actions such as to prevent hair loss and/or to promote hair growth on the scalp and skin... Agent:

20110263619 - Pharmaceutical formulations and use thereof in the prevention of stroke, diabetes and/or congestive heart failure: The present invention relates to use of an inhibitor of the renin-angiotensin system (RAS) or a pharmaceutically acceptable derivative thereof, such as ramipril or ramiprilat, in the prevention of stroke, diabetes and/or congestive heart failure (CHF).... Agent: Aventis Pharma Deutschland Gmbh

20110263620 - Quinoline compounds and their use for treating viral infection: e

20110263621 - New combination of active ingredients containing an a1-antagonist and a pde 4 inhibitor: The subject of the present invention is a new combination of active ingredients consisting of alfuzosin and PDE 4 inhibitor, and pharmaceutical compositions containing them, for ameliorating and/or treating benign prostatic hyperplasia, urinary disorders, disorders related to bladder dysfunction, lower urinary tract symptoms associated or not associated with benign prostatic... Agent: Sanofi-aventis

20110263624 - Bicyclic heterocycle derivatives and methods of use thereof: The present invention relates to Bicyclic Heterocycle Derivatives, compositions comprising a Bicyclic Heterocycle Derivative, and methods of using the Bicyclic Heterocycle Derivatives for treating or preventing obesity, diabetes, a metabolic disorder, a cardiovascular disease or a disorder related to the activity of a GPCR in a patient.... Agent: Schering Corporation

20110263623 - Process for preparation of bosentan: The present invention provides improved processes for preparing Bosentan. The present invention provides novel intermediates like 4,6-dihydroxy-5-(2-methoxy phenoxy)[2,2′]bipyrimidine of formula (II) and N-(6-Chloro-5-(2-ethoxyphenoxy)[2,2′-bipyrimidinyl]-4-t-butyl benzenesulfonamide cesium salt and process for preparation thereof. The invention also disclosed novel polymorphic form of the intermediates.... Agent: Cadila Healthcare Limited

20110263622 - Tetrahydrophenanthridinones and tetrahydrocyclopentaquinolinones as parp and tubulin polymerization inhibitors: e

20110263625 - Hiv replication inhibiting pyrimidines: the N-oxides, the pharmaceutically acceptable addition salts, quaternary amines and the stereochemically isomeric forms thereof, wherein -a1=a2-a3=a4- forms a phenyl, pyridinyl, pyrimidinyl, pyridazinyl or pyrazinyl with the attached vinyl group; n is 0 to 4; and where possible 5; R1 is hydrogen, aryl, formyl, C1-6alkylcarbonyl, C1-6alkyl, C1-6alkyloxycarbonyl, substituted C1-6alkyl, or... Agent:

20110263627 - N3-substituted-n1-sulfonyl-5-fluoropyrimidinone derivatives: This present disclosure is related to the field of N3-substituted-N1-sulfonyl-5-fluoropyrimidinones and their derivatives and to the use of these compounds as fungicides.... Agent: Dow Agrosciences LLC

20110263626 - Novel bradykinin b1-antagonists: wherein n, R1, R2, R3, R4, R5, R6, R7 and R8 are defined as stated hereinafter, the enantiomers, the diastereomers, the mixtures thereof and the salts thereof, particularly the physiologically acceptable salts thereof with organic or inorganic acids or bases, which have valuable properties, the preparation thereof, the pharmaceutical compositions... Agent: Boehringer Ingelheim International Gmbh

20110263628 - N-hydroxyamide derivatives and use thereof: The present invention is related to N-hydroxyamide derivatives of Formula (I) and use thereof in particular for the treatment and/or prophylaxis of autoimmune disorders, inflammatory diseases, cardiovascular diseases, neurodegenerative diseases, cancer, respiratory diseases and fibrosis, including multiple sclerosis, arthritis, emphysema, chronic obstructive pulmonary disease, liver and pulmonary fibrosis.... Agent: Applied Research Systems Ars Holding N.v.

20110263629 - Amides of diazabicyclooctanes and uses thereof: The present invention relates to compounds that bind to and modulate the activity of neuronal nicotinic acetylcholine receptors, to processes for preparing these compounds, to pharmaceutical compositions containing these compounds, and to methods of using these compounds for treating a wide variety of conditions and disorders, including those associated with... Agent: Targacept, Inc.

20110263631 - Combination of a serotonin and norepinephrine reuptake inhibitor and an opioid agonist for the treatment of pain: The invention provides a method of treating a pain condition in a mammal utilizing a specific serotonin and norepinephrine reuptake inhibitor (SNRI) and also the combination of the SNRI and an opioid agonist agent. The invention includes methods wherein the opioid agonist agent is administered at a dose that is... Agent:

20110263630 - Synthesis of metabolically stable agents for alcohol and drug abuse: Disclosed herein are compounds of formula (I); as defined herein, or a pharmaceutically acceptable salt thereof, pharmaceutical compositions comprising the same, and methods of using these compounds for the treatment of substance addiction.... Agent: Human Biomolecular Research Institute

20110263632 - Solid dispersions comprising tacrolimus: A pharmaceutical composition comprising tacrolimus (FK-506) dissolved and/or dispersed in a hydrophilic or water-miscible vehicle to form a solid dispersion or solid solution at ambient temperature have improved bioavailability.... Agent: Veloxis Pharmaceuticals A/s

20110263636 - 3 x 3 x 3 week dosing regimen for treating actinic keratosis with pharmaceutical compositions formulated with 3.75 % imiquimod: Pharmaceutical formulations and methods for the topical or transdermal delivery of 1-isobutyl-1H-imidazo[4,5-c]-quinolin-4-amine or 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine, i.e., imiquimod, to treat actinic keratosis with short durations of therapy, than currently prescribed for the commercially available Aldara® 5% imiquimod cream, as now approved by the U.S. Food & Drug Administration (“FDA”), are disclosed and... Agent: Graceway Pharmaceuticals, LLC.

20110263634 - Lower dosage strength pharmaceutical compositions formulated with 2.5% imiquimod: Pharmaceutical formulations and methods for the topical or transdermal delivery of 1-isobutyl-1H-imidazo[4,5-c]-quinolin-4-amine or 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine, i.e., imiquimod, to treat actinic keratosis with short durations of therapy, than currently prescribed for the commercially available Aldara® 5% imiquimod cream, as now approved by the U.S. Food & Drug Administration (“FDA”), are disclosed and... Agent: Graceway Pharmaceuticals, LLC

20110263635 - Method of treating actinic keratosis with 3.75% imiquimod cream: Pharmaceutical formulations and methods for the topical or transdermal delivery of 1-isobutyl-1H-imidazo[4,5-c]-quinolin-4-amine or 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine, i.e., imiquimod, to treat actinic keratosis with short durations of therapy, than currently prescribed for the commercially available Aldara® 5% imiquimod cream, as now approved by the U.S. Food & Drug Administration (“FDA”), are disclosed and... Agent: Graceway Pharmaceuticals, LLC.

20110263637 - Up to six weeks dosing regimen for treating actinic keratosis with pharmaceutical compositions formulated with 3.75% imiquimod: Pharmaceutical formulations and methods for the topical or transdermal delivery of 1-isobutyl-1H-imidazo[4,5-c]-quinolin-4-amine or 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine, i.e., imiquimod, to treat actinic keratosis with short durations of therapy, than currently prescribed for the commercially available Aldara® 5% imiquimod cream, as now approved by the U.S. Food & Drug Administration (“FDA”), are disclosed and... Agent: Graceway Pharmaceuticals, LLC.

20110263633 - Up to six weeks treatment regimen for treating actinic keratoses with pharmaceutical compositions formulated with 2.5% imiquimod: Pharmaceutical formulations and methods for the topical or transdermal delivery of 1-isobutyl-1H-imidazo[4,5-c]-quinolin-4-amine or 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine, i.e., imiquimod, to treat actinic keratosis with short durations of therapy, than currently prescribed for the commercially available Aldara® 5% imiquimod cream, as now approved by the U.S. Food & Drug Administration (“FDA”), are disclosed and... Agent: Graceway Pharmaceuticals, LLC

20110263638 - Therapeutic agent for glaucoma comprising rho kinase inhibitor and ß- blocker: A therapeutic agent for glaucoma including a combination of pharmaceutically effective amounts of a Rho kinase inhibitor and a β-blocker, wherein the Rho kinase inhibitor is (R)-(+)-N-(1H-pyrrolo[2,3-b]pyridin-4-yl)-4-(1-aminoethyl)benzamide and the β-blocker is befunolol, carteolol, nipradilol, betaxolol, levobunolol or metipranolol. A method of treating glaucoma including administering effective amounts of a Rho... Agent: Santen Pharmaceutical Co., Ltd.

20110263640 - 8-azabicyclo[3.2.1]oct-2-ene derivatives and their use as monoamine neurotransmitter re-uptake inhibitors: The present invention relates to novel 8-azabicyclo[3.2.1]oct-2-ene derivatives useful as monoamine neurotransmitter re-uptake inhibitors. In other aspects the invention relates to the use of these compounds in a method for therapy and to pharmaceutical compositions comprising the compounds of the invention.... Agent: Neurosearch A/s

20110263639 - Aryl-substituted bridged or fused diamines as modulators of leukotriene a4 hydrolase: Aryl-substituted bridged or fused diamine compounds, pharmaceutical compositions containing them, and methods of using the compounds and the pharmaceutical compositions for leukotriene A4 hydrolase (LTA4H or LTA4H) modulation and for the treatment of disease states, disorders, and conditions mediated by LTA4H activity, such as allergy, asthma, autoimmune diseases, pruritis, inflammatory... Agent: Janseen Pharmaceutical Nv

20110263641 - Isoxazolines for controlling invertebrate pests: y

20110263643 - 2,3-disubstituted piperidine orexin receptor antagonists: The present invention is directed to 2,3-disubstituted piperidine amide compounds which are antagonists of orexin receptors, and which are useful in the treatment or prevention of neurological and psychiatric disorders and diseases in which orexin receptors are involved. The invention is also directed to pharmaceutical compositions comprising these compounds and... Agent:

20110263644 - Compounds and methods for treatment of stroke: The present invention relates to methods and agents useful for the treatment of stroke, including ischemic stroke and hemorrhagic stroke. In particular, methods and agents for treating stroke in a subject are provided, wherein the agent is administered prior to diagnosis of the stroke as an ischemic stroke or a... Agent: Fibrogen, Inc.

20110263642 - Methods for treatment of multiple sclerosis: The present invention relates to methods and compounds useful for treating multiple sclerosis.... Agent: Fibrogen, Inc.

20110263645 - Compositions and methods of treating retinal disease: Compositions and methods for treating macular degeneration and other forms of retinal disease whose etiology involves the accumulation of A2E and/or lipofuscin, and, more specifically, for preventing the formation and/or accumulation of A2E are disclosed... Agent: Neuron Systems, Inc.

20110263647 - Fluoroisoquinoline substituted thiazole compounds and methods of use: m

20110263646 - Pharmaceutical topical compositions: The invention provides pharmaceutical stable semisolid topical compositions comprising between 0.2 to 5% of a des-fluoroquinolone compound, and a suitable carrier to manufacture an ointment or a cream.... Agent: Ferrer Internacional, S.a.

20110263648 - Bridged tetrahydronaphthalene derivatives: The invention relates to compounds of formula (I) wherein R1, R2, R3, R4, A, B, W and n are as defined in the description, and to pharmaceutically acceptable salts of such compounds. These compounds are useful as calcium channel blockers.... Agent:

20110263649 - Crystalline form of lenalidomide and a process for its preparation: The present invention relates to a novel crystalline form of lenalidomide having formula (I) and chemically known as 3-(4-amino-1-oxo-1,3-dihydro-isoindol-2-yl)-piperidine-2,6-dione. The present invention further relates to a process for the preparation of said novel form and its use in pharmaceutical preparations for the treatment of autoimmune disease, inflammation, inflammatory disease and... Agent: Generics [uk] Limited

20110263650 - Tubulysin d analogues: The present invention provides novel tubulysin analogues, methods of making and methods of using such analogues and conjugates thereof. The essential features for the potent cytotoxicity of tubulysin D have been established for the first time by the synthesis and evaluation of a series of analogues. By identifying functionality that... Agent: Helmholtz-zentrum F&#xdc R Infektions-forschung Gmbh

20110263651 - Novel piperidine-butyramide derivatives and their use as monoamine neurotransmitter re-uptake inhibitors: The present invention relates to novel piperidine-4-butyramide derivatives useful as monoamine neurotransmitter re-uptake inhibitors. In other aspects the invention relates to the use of these compounds in a method for therapy and to pharmaceutical compositions comprising the compounds of the invention.... Agent: Neurosearch A/s

20110263652 - Treatment and/or prevention of inner ear conditions by modulation of a metabotropic glutamate receptor: Described herein are compositions and methods of treating and/or preventing inner ear conditions by administering to a patient in need thereof a modulator of a metabotropic glutamate receptor.... Agent: House Ear Institute

20110263653 - Migrastatin analog compositions and uses thereof: In another aspect, the present invention provides a method for treating breast tumor metastasis in a subject comprising administering to a subject in need thereof a therapeutically effective amount of the inventive composition described directly above and a pharmaceutically acceptable carrier, adjuvant or vehicle.... Agent:

20110263654 - Solid forms of 3-(6-(1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl) cyclopropanecarboxamido)-3-methylpyridin-2-yl)benzoic acid: The present invention relates to a substantially a solid form of 3-(6-(1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl)cyclopropanecarboxamido)-3-methylpyridin-2-yl)benzoic acid (Compound 1, Solvate Form A and Compound 1, HCl Salt Form A), processes for making such forms, pharmaceutical compositions thereof, and methods of treatment therewith.... Agent: Vertex Phamaceuticals Incorporated

20110263655 - Method for controlling insects in plants: The invention relates to a method for controlling woolly apple aphid insect comprising contacting the insect or a locus, where control of the insect is desired, with a combination of at least one neonicotinoid compound and at least one benzoylphenyl urea compound.... Agent: Makhteshim Chemical Works Ltd.

20110263656 - Pirfenidone treatment for patients with atypical liver function: Methods are provided for administering pirfenidone to a patient that has exhibited abnormal biomarkers of liver function in response to pirfenidone administration. The methods include administering to a patient pirfenidone at doses lower than the full target dosage for a time period, followed by administering to the patient pirfenidone at... Agent: Intermune, Inc.

20110263657 - Diaryl ureas for treating heart failure: The present invention relates to pharmaceutical compositions for treating, preventing or managing heart failure and/or connected diseases therewith comprising at least a diaryl urea compound optionally combined with at least one additional therapeutic agent. Useful combinations include e.g. BAY 43-9006 as a diaryl urea compound.... Agent: Bayer Schering Pharma Aktiengesellschaft

20110263658 - Renin inhibitors: The present invention relates to biphenyl-based renin inhibitor compounds having amino-terminal groups, and their use in treating cardiovascular events and renal insufficiency.... Agent:

20110263659 - Analogs of 1-methylnicotinamide: The present invention is directed to derivatives and analogs of 1-methyl-nicotinamide useful for elevating the blood levels of 1-methylnicotinamide or deuterated species in a subject.... Agent: Cortria Corporation

20110263660 - Antihypertensive pharmaceutical composition: An antihypertensive pharmaceutical composition is provided, which contains levamlodipine or a pharmaceutically acceptable salt thereof, and indapamide. In the present invention, levamlodipine and indapamide are administrated in combination for treating hypertension, a good synergistic antihypertensive effect is achieved, and the edema side effect due to sodium and water retention caused... Agent: Shihuida Pharmaceuticals Group (jilin) Ltd

20110263661 - 3-(4-((1h-imidazol-1-yl)methyl)phenyl)-5-aryl-1,2,4-oxadiazole derivatives as sphingosine-1 phosphate receptors modulators: Substituted 3-(4-((1H-imidazol-1-yl)methyl)phenyl)-5-phenyl-1,2,4-oxadiazole derivatives which are useful as sphingosine-1-phosphate modulators and useful for treating a wide variety of disorders associated with modulation of sphingosine-1-phosphate receptors.... Agent: Allergan, Inc.

20110263662 - 1,2-diamido-ethylene derivatives as orexin antagonists: The invention relates to 1,2-diamido-ethylene derivatives of the formula (I) wherein R1, R2, R3, and A are as described in the description and their use as medicaments, especially as orexin receptor antagonists.... Agent:

20110263663 - Synthesis of epothilones, intermediates thereto, analogues and uses thereof: The present invention provides convergent processes for preparing epothilone A and B, desoxyepothilones A and B, and analogues thereof. Also provided are analogues related to epothilone A and B and intermediates useful for preparing same. The present invention further provides novel compositions based on analogues of the epothilones and methods... Agent: Sloan-kettering Institute For Cancer Research

20110263664 - Inhibitors of pim-1 protein kinases, compositions and methods for treating prostate cancer: The disclosure relates to inhibitors of Pim-1 and/or Pim-2 protein kinase, to compositions comprising one or more inhibitors of Pim-1 and/or Pim-2 protein kinase, and to methods for treating cancer.... Agent: Musc Foundation For Research Development

20110263665 - Formulations comprising an anti-microbial composition: The present invention describes a formulation comprising: (A) at least one surfactant; and (B) an anti-microbial composition that comprises (i) an anti-microbial agent with surfactant properties; (ii) a hydrophobic material and (iii) a polar solvent.... Agent: Byotrol PLC

20110263666 - process for the preparation or purification of olmesartan medoxomil: The present invention relates to a process for the preparation and purification of olmesartan medoxomil hydrohalide salts and optionally converting them to olmesartan medoxomil. The invention also relates to products obtainable by the process of the invention, to pharmaceutical compositions comprising the products and to their use in medicine, particularly... Agent: Lek Pharmaceuticals D.d.

20110263667 - Salts of isobutyric acid (1 r*,2r*,4r*) -2- (2- - ethyl)-5-phenyl-bicyclo [2.2.2] oct-5-en-2-yl: The invention relates to crystalline salts of isobutyric acid (1R*,2R*,4R*)-2-(2-{[3-(4,7-dimethoxy-1H-benzoimidazol-2-yl)-propyl]-methyl-amino}-ethyl)-5-phenyl-bicyclo[2.2.2]oct-5-en-2-yl ester, processes for the preparation thereof, pharmaceutical compositions containing said crystalline salts, and their use as medicaments, especially as calcium channel blockers.... Agent:

20110263668 - Beta 3-adrenoreceptor agonists for the treatment of cardiac hypertrophy and heart failure: The present invention relates to the field of cardiology. More specifically, the present invention relates to the use of β3 adrenoreceptor agonists to treat cardiac hypertrophy and heart failure. In a specific embodiment, a method for treating cardiac hypertrophy comprises the step of administering a therapeutically effective amount of a... Agent: The Johns Hopkins University

20110263669 - Novel pyrrolo [2,3-a] carbazoles and use thereof as pim kinase inhibitors: The invention relates to pyrrolo[2,3-a]carbazole derivatives, to a method for preparing the same, and to the use thereof as PIM kinase inhibitors. The invention can particularly be used in the pharmaceutical field.... Agent:

20110263670 - Novel polymorphs of sunitinib and processes for their preparation: The present invention relates to novel polymorphs of sunitinib free base designated form II and form III and to processes for their preparation. The invention also relates to their use as APIs and in the preparation of various forms of sunitinib. Further, the invention relates to pharmaceutical compositions comprising said... Agent:

20110263671 - Novel salts of sunitinib: Pharmaceutically acceptable salts of sunitinib, processes of making sunitinib salts, as well as related pharmaceuticals and methods of treating are described.... Agent:

20110263672 - Metabolites of wortmannin analogs and methods of using the same: Novel metabolites of wortmannin and wortmannin analogs and their use in inhibiting PI-3 kinase activity in mammals and the treatment and prevention of cancer or tumor formation in a subject are described herein.... Agent: Arizona Board Of Regents On Behalf Of The University Of Arizona

20110263673 - Atropisomers of (hydroxyalkyl) pyrrole derivatives: The present invention comprises a compound for the prevention and/or treatment of cardiovascular diseases. The compound is an atropisomer of a compound represented by the following general formula (I): wherein R1 represents a C1-C3 alkyl group; R2 represents a 2-hydroxy-C4-C6 alkyl group; R3 represents a halogeno group, a halogeno-C1-C3 alkyl... Agent: Exelixis, Inc.

20110263674 - C-nitroso-derived nitroxyl donors: e

20110263691 - Methods concerning ppar delta and antagonists thereof: Non-human animals which overexpress PPARd or which express transgenic PPARd are useful as models for inflammatory skin conditions such as psoriasis. Test substances can be screened to assess their suitability for the treatment of inflammatory skin conditions such as psoriasis. Methyl 3-({[2-(methoxy)-4-phenyl]amino}sulfonyl)-2-thiophenecarboxylate can be administered topically for the prevention or... Agent:

20110263692 - Therapeutic compounds: n

20110263693 - Celastrol, gedunin, and derivatives thereof as hsp90 inhibitors: Based on the discovery that celastrol and gedunin are Hsp90 inhibitors, the present invention provides novel inhibitors of Hsp90. and pharmaceutically acceptable salts, derivatives, and compositions thereof. The invention provides two classes of compounds. One class includes celastrol and its derivatives. The other class includes gedunin and its derivatives. The... Agent: Massachusetts Institute Of Technology

20110263695 - Nfat signal inhibitor and hair-growing agent: An NFAT signal inhibitor and the like, containing, as an active ingredient, at least one compound selected from the group consisting of a coumarin derivative represented by formula [where in the formula (I), R1 and R2, which may be identical with or different from each other, each represent a hydrogen... Agent: Kao Corporation

20110263694 - Use of xanthone derivatives as a medicament for cancer: The invention relates to xanthone derivatives of formula (IA) or (IB) and their use for manufacturing a medicament for cancer, and in particular for chemotherapeutic resistant cancer. More particularly, the invention relates to compounds and compositions comprising such xanthone derivatives for the prevention and/or treatment for chronic leukemia and, for... Agent: Institut National De La Sante Et De La Recherche Medicale (inserm)

20110263697 - Methods of reducing oxidative modification of a muscle cell protein: The present invention is directed to methods for reducing oxidative modification of one or more proteins or other cellular constituents involved in muscle cell contraction, for reducing muscle fatigue or for increasing muscle performance.... Agent: Stokely-van Camp, Inc.

20110263698 - Proanthocyanidin of cashew apple, composition containing proanthocyanidin, and application thereof: This invention provides useful applications of cashew apple. This invention also provides a naturally occurring active ingredient having useful activities, such as alpha-amylase inhibitory activity, lipase inhibitory activity, and antibacterial activity against Propionibacterium acnes. The invention also provides a composition containing cashew apple-derived proanthocyanidin having excellent alpha-amylase inhibitory activity, lipase... Agent: Nichirei Biosciences, Inc.

20110263696 - Proanthocyanidins from cinnamon and its water soluble extract inhibit tau aggregation: Compositions comprising proanthocyanidin compositions (e.g. those extracted from cinnamomum species) that are observed to bind tau and inhibit its aggregation as well as methods for making and using such compositions are disclosed. In certain embodiments of the invention, the proanthocyanidins can be used as a probe to identify and/or characterize... Agent:

20110263699 - 1-phenyl-2-dimethylaminomethylcyclohexane compounds and therapies for depressive symptoms, pain and incontinence: Metabolites of [2-(3-methoxyphenyl)-cyclohexylmethyl]dimethylamine as free bases and/or in the form of physiologically acceptable salts, corresponding medicaments, the use of [2-(3-methoxyphenyl)-cyclohexylmethyl]-dimethylamine and the metabolites thereof for producing a medicament used for treating depression, and related methods of treating depression, pain and urinary incontinence.... Agent: Gruenenthal Gmbh

20110263700 - Antrocin containing pharmaceutical compositions for inhibiting cancer cells: This subject invention is directed to a pharmaceutical composition for the inhibition of cancer cells, comprising an effective amount of a compound of formula I (Sesquiterpene lactones, antrocin) or pharmaceutically acceptable salts thereof, together with a pharmaceutically acceptable carrier.... Agent: Chaoyang University Of Technology

20110263701 - Gabapentin enacarbil compositions: The present invention provides a stabilized composition comprising a non-crystalline gabapentin enacarbil and at least one crystallization-inhibiting compound. In particular, the present invention provides a stabilized composition of gabapentin enacarbil, wherein the gabapentin enacarbil is maintained in a non-crystalline form by the composition, for example, as an amorphous form. The... Agent:

20110263702 - Methods and compositions for improved chromium complexes: Complex metal-containing matrices, and especially chromium-containing matrices are produced from a water soluble preparation that is derived from an item suitable for animal (and most typically human) consumption. In particularly contemplated aspects, the water soluble preparation is an extract or filtrate of disintegrated brewer's yeast, and the so prepared complex... Agent:

20110263703 - Solid forms of selective androgen receptor modulators: The present invention relates to solid forms of (S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-3-(4-cyanophenoxy)-2-hydroxy-2-methylpropanamide and process for producing the same.... Agent:

20110263704 - Methods of using cycloalkylmethylamines: The present invention provides novel cycloalkylmethylamine analogs, and methods of preparing cycloalkylmethylamine analogs. The present invention also provides methods of using cycloalkylmethylamine analogs and compositions of cycloalkylmethylamine analogs. The pharmaceutical compositions of the compounds of the present invention can be advantageously used for treating and/or preventing obesity and obesity related... Agent: Reviva Pharmaceuticals, Inc.

20110263705 - Transdermal delivery of ketoprofen polar derivates: A topical or transdermal composition including a polar derivative of ketoprofen and a pharmaceutically acceptable topical or transdermal carrier, wherein the polar derivative of ketoprofen comprises a polarity that is greater than that of ketoprofen.... Agent: Noven Pharmaceuticals, Inc.

20110263706 - Method for enhancing the dna repair process, treating disorders associated with the dna repair process, enhancing antitumor response and treating disorders associated with anti-tumor response in mammals by administering pruified quinic acid and/or carboxy: The disclosure provides a method for isolating the bioactive component of the water-soluble extract of Uncaria tomentosa known as C-MED-100®, comprising (i) precipitating the spray drying carrier from C-MED-100®; (ii) using the resulting C-MED-100® to obtain a spotting mixture for thin layer chromatography (TLC); (iii) spotting the C-MED-100® spotting mixture... Agent: Optigenex, Inc.

20110263707 - Mosquito repellent: The present invention relates to a mosquito repellent comprises at least one or more selected from the group consisting of neric acid and derivatives thereof in an effective amount to repel mosquito.... Agent: Bio & Hnt, Inc.

20110263709 - Method for obtaining polyunsaturated fatty acid-containing compositions from microbial biomass: A method is disclosed for obtaining a refined lipid composition comprising at least one polyunsaturated fatty acid from a microbial biomass, wherein the refined lipid composition comprises at least one polyunsaturated fatty acid and is enriched in triacylglycerols relative to the oil composition of the microbial biomass.... Agent: E. I. Du Pont De Nemours And Company

20110263708 - Over-production of dihomo linolenic acid by a mutant strain of parietochloris incisa: The present invention is primarily directed to a mutant strain of Parietochloris incisa, characterized in comprising a substantially reduced intracellular concentration of arachidonic acid (AA) together with a substantially increased intracellular concentration of dihomo-gamma-linolenic acid 20:3ω6 (DGLA).... Agent:

20110263710 - Transepithelial methods of using gamma aminobutyric acid compositions for pain relief: The epithelial tissue includes skin, nasal mucosa or membranes and other epithelial tissue such as buccal, palatal, sublingual, rectal, vaginal, thecal and the like. The GABA is supplied in compositions such as water, saline, buffered saline, parenteral solutions, lotions, semi-solids such as, gels, creams, pastes, salves, ointments, solids such as... Agent:

20110263711 - 1-(2-fluorobiphenyl-4-yl)-alkyl carboxylic acid derivatives for the therapy of transthyretin amyloidosis: Derivatives of 1-(2-fluorobiphenyl-4-yl)-alkyl carboxylic acid are capable of stabilizing the tetrameric native state of transthyretin for the prophylaxis and treatment of amyloidosis.... Agent: Chiesi Farmaceutici S.p.a.

20110263712 - Process for the preparation of vorinostat: The present invention relates to an improved process for the preparation of the active pharmaceutical ingredient vorinostat. In particular it relates to a process for preparing vorinostat substantially free from impurities, involving suberic acid, aniline and hydroxylamine as starting materials.... Agent: Generics (uk) Limited

20110263713 - Polymorphs: The present invention relates to crystalline forms of the active pharmaceutical ingredient vorinostat, processes for their preparation and their use in pharmaceutical compositions. Formula (I).... Agent: Mylan India Private Limited

20110263714 - Reverse vesicle: e

20110263715 - Local anesthetic emulsion compositions and methods of making and using the same: Local anesthetic emulsion compositions are provided. The local anesthetic emulsion compositions may include: an oily phase comprising a eutectic mixture of a local anesthetic and an acyclic amide; a surfactant; and an aqueous phase. Also provided are methods of making and using the emulsions.... Agent:

20110263716 - Colchine compositions and methods: Stable ultrapure colchicine compositions comprising ultrapure colchicine and a pharmaceutically acceptable excipient are described. The compositions can be tablets. Methods for preparing such compositions and methods of use are also disclosed. Methods of treating gout flares with colchicine compositions are also disclosed.... Agent: Mutual Pharmaceutical Company, Inc

20110263717 - Ophthalmic compositions with biguanide and peg-glycerol esters: wherein R1 is a C3-C8alkyl and R2 is H or a C1-C4alkyl; and x+y+z has an average value from 8 to 30. The invention is also directed to the use of the ophthalmic compositions to clean and disinfect contact lenses, and in particular, soft, silicone hydrogel contact lenses.... Agent:

20110263718 - Process for the preparation of o-desmethylvenlafaxine: The present invention provides a convenient and efficient process for the preparation of O-desmethylvenlafaxine (ODV) or a salt thereof, comprising the reaction of venlafaxine, or a salt thereof, with a thiourea or a mixture of thioureas.... Agent: Generics [uk] Limited

20110263719 - Polymorphic form of rasagiline mesylate: The present invention relates to a novel crystalline form of rasagiline mesylate and a pure form of rasagiline mesylate and processes for their preparation. Further, the invention relates to pharmaceutical compositions comprising said forms and use of said compositions in the treatment of patients suffering from Parkinson's Disease, dementia, Alzheimer's... Agent:

20110263720 - Synthesis of alpha-tocopherolquinone derivatives, and methods of using the same: the method comprising oxidizing alpha-tocopherol with a metal salt oxidizing agent to form the compound of Formula I, wherein the stoichiometric ratio (mol/mol) of metal salt oxidizing agent/alpha-tocopherol is 1.6 to 4. The invention is also directed to a method of synthesizing a compound of Formula I, the method comprising... Agent: Penwest Pharmaceuticals Co.

20110263721 - Aryl di-substituted propenone compounds: wherein R1 and R4 are OR7, R2 and R3 are H or OR7, with the proviso that when R2 is OR7 then R3 is H, and when R3 is OR7 then R2 is H; R5 and R6 are independently H, OH, or OR7 with the proviso that when R5 is... Agent: Heartlink Limited

20110263722 - Well defined stars with segmented arms: The present invention relates to the preparation and use of well defined star macromolecules wherein the composition of the arms are selected to induce self assembly when the multi-arm segmented star macromolecules are dispersed in a liquid. The self assembled star macromolecules modify the rheology of the dispersing media. When... Agent:

20110263723 - Pigment composition comprising anthocyanic vacuolar inclusions: The invention provides a pigment composition comprising anthocyanic vacuolar inclusions or “AVIs” from a plant, and an acceptable carrier. The invention also provides methods for colouring products with the pigment composition, and products comprising the pigment composition or AVIs.... Agent: The New Zealand Institute For Plant And Food Research Limited

20110263724 - Threads of hyaluronic acid and/or derivatives, thereof, methods of making thereof and uses thereof: The present invention provides threads of hyaluronic acid, and/or derivatives thereof, methods of making thereof and uses thereof, for example, in aesthetic applications (e.g., dermal fillers), surgery (sutures), drug delivery, etc.... Agent:

20110263725 - Alpha-branched alkenoic acids and the use of alpha-branched alkanoic and alkenoic acids as a fragrance: e

10/20/2011 > 200 patent applications in 140 patent subcategories. categorized by USPTO classification

20110257075 - Guanidino acetic acid used as an animal food additive: The present invention relates to the use of guanidinoacetic acid and/or salts thereof as feed additive, in predominantly vegetarian diets, in particular use being made of salts with hydrochloric acid, hydrobromic acid and phosphoric acid. The use proceeds especially in individual doses from 0.01 to 100 g/kg of feed in... Agent:

20110257074 - Method for the purification of substituted cyclopent-2-en-1-one congeners and substituted 1,3-cyclopentadione congeners from a complex mixture using countercurrent separation: Methods of purifying individual congeners of substituted cyclohexa-2,4-dienones, substituted cyclohexane-1,3,5-triones, substituted cyclopent-2-en-1-ones, and substituted 1,3-cyclopentadiones and compositions using the same are disclosed. The purification method includes the steps of: (a) selecting a congener to be isolated; (b) dissolving the mixture of congeners in a bi-phasic solvent system specific to the... Agent: Metaproteomics, LLC

20110257076 - Amide based insulin prodrugs: Prodrug formulations of insulin and insulin analogs are provided wherein the insulin peptide has been modified by an amide bond linkage of a dipeptide prodrug element. The prodrugs disclosed herein have extended half lives of at least 10 hours, and more typically greater than 2 hours, 20 hours and less... Agent:

20110257077 - Compounds and compositions as channel activating protease inhibitors: The invention provides compounds and pharmaceutical compositions thereof, which are useful for modulating channel activating proteases, and methods for, using such compounds to treat, ameliorate or prevent a condition associated with a channel activating protease, including but not limited to prostasin, PRSS22, TMPRSS11 (e.g., TMPRSS11B, TMPRSS11E), TMPRSS2, TMPRSS3, TMPRSS4 (MTSP-2),... Agent: Irm LLC

20110257078 - Antibacterial combination therapy for the treatment of gram positive bacterial infections: There is described a composition comprising a therapeutically active imidazole, and derivatives thereof, and an agent active on a bacterial cell surface selected from the group consisting of one or more of colistin, nisin, D-cycloserine, fosfomycin, fosfomycin trometamol, fosfomycin disodium and polymixin B, and derivatives thereof.... Agent: E-therapeutics PLC

20110257079 - Parenteral combination therapy for infective conditions with drug resistant bacterium: The invention describes a pharmaceutical composition to combat multiple-drug-resistant bacteria in non-ocular infective conditions. Compositions comprising glycopeptides, in particular vancomycin, and cephalosporins, in particular ceftriaxone, are disclosed. Such compositions are found to be useful for parenteral administration for hospitalized patients with serious infections. Specifically, this invention also discloses a pharmaceutical... Agent: Venus Remedies Limited

20110257080 - Hepatitis b virus compositions and methods of use: A polypeptide comprising a preS1 region of hepatitis B virus (HBV), or a fragment thereof, and/or the preS2 region of HBV or a fragment thereof, and methods of use to inhibit virus infection are disclosed. A lentivirus comprising hepatitis B virus (HBV) envelope proteins, or a fragment thereof, and/or the... Agent: Fox Chase Cancer Center

20110257081 - Multigand constructs: Multiligand constructs and intermediate multivalent constructs for use in their preparation are described. The multiligand constructs have utility in diagnostic and therapeutic applications.... Agent:

20110257082 - Hiv-1 integrase derived stimulatory peptides interfering with integrase -- rev protein binding: Isolated peptides comprising sequences derived from the protein integrase of HIV-1, as well as their analogs, mixtures, conjugates with permeability enhancing moieties, and pharmaceutical compositions are disclosed. The peptides and compositions are capable of selectively killing HIV-1 infected cells and are used in treatment of HIV infection and AIDS.... Agent:

20110257083 - Msp-1 protein preparations from plasmodium: The invention relates to a merozoite surface protein 1 (“MSP-1”) preparation of Plasmodium falciparum, said MSP-1 preparation comprising a) a purified fragment p83/30 of the gp190/MSP-1 from Plasmodium without heterologous sequences, and b) a purified fragment p38/42 of the 190/MSP-1 from Plasmodium without heterologous sequences.... Agent:

20110257085 - Crystal forms of saxagliptin and processes for preparing same: are provided including the free base monohydrate thereof (form H-1) and the hydrochloric acid salt thereof, including hydrochloric acid salt containing 0.75 equivalent of H2O (form H0.75-3) and hydrochloric acid salt containing 2 equivalents of H2O (form H2-1), and hydrochloric acid salt Pattern P-5, preferably in substantially pure form, and... Agent: Bristol-myers Squibb Company

20110257084 - Exendin derivative linked biotin, method for the preparation thereof and pharmaceutical composition comprising the same: Disclosed are exendin-3 or exendin-4 derivatives modified with biotin, a preparation method thereof and a pharmaceutical composition containing the same. More specifically, disclosed are exendin-3 or exendin-4 derivatives in which the lysine residue of exedin is modified with biotin. The disclosed exendin-3 or exendin-4 derivatives modified with biotin show biological... Agent: Sungkyunkwan University

20110257086 - Methods for synthesis and uses of inhibitors of ghrelin o-acyltransferase as potential therapeutic agents for obesity and diabetes: The invention provides inhibitors of ghrelin O-acyltransferase, and methods of making and using them. In some embodiments, the invention provides bisubstrate analog inhibitors of ghrelin O-acyltransferase, which can be effective in treating, for example, obesity and diabetes mellitus.... Agent:

20110257087 - Protein hydrolysate compositions having enhanced cck releasing activity: The present invention provides protein hydrolysate compositions having enhanced cholecystokinin (CCK) releasing activity that can be used to promote satiety.... Agent: Solae, LLC

20110257088 - Low-concentration nutritional composition: The present invention provides an enteral nutritional composition with which the labor of administering water between meals can be saved. The enthral nutritional composition comprises proteins, carbohydrates and lipids, with the calories per ml of the composition being less than 1 kcal and the moisture content being 30 percent by... Agent: Nutri Co., Ltd.

20110257089 - Liquid high-fat protein composition: The invention concerns nutritional compositions for persons with a (partially) functional gastrointestinal tract, who are unwilling and/or unable to consume sufficient quantities of conventional food to meet their nutritional requirements such as malnourished persons or persons at risk of becoming malnourished, and in need of liquid oral nutrition. The shelf-stable... Agent: N.v. Nutricia

20110257090 - Solutions for volume therapy: The invention relates to artificial plasma-like solutions and methods for their use. The subject solutions find use in a variety of applications, particularly in those applications where at least a portion of a host's blood volume is replaced with a blood substitute.... Agent: Fresenius Kabi Deutschland Gmbh

20110257091 - Insulin analogs: Full potency analogs of insulin are provided wherein the analog comprises a modification of the tyrosine residue at position 19 of the A chain.... Agent:

20110257092 - Glucagon/glp-1 receptor co-agonists: Modified glucagon peptides are disclosed having enhanced potency at the glucagon receptor relative to native glucagon. Further modification of the glucagon peptides by forming intramolecular bridges or the substitution of the terminal carboxylic acid with an amide group produces peptides exhibiting glucagon/GLP-1 receptor co-agonist activity. The solubility and stability of... Agent: Indiana University Research And Technology Corp.

20110257094 - Anti periodontitis-causing microorganism agent and medical or dental materials using the same: A medical or dental material can be prepared by using, as an active ingredient, at least one of a protamine, and derivatives thereof and hydrolysates thereof, or a complex of at least one of a protamine, and derivatives thereof and hydrolysates thereof with an anionic high molecular weight compound. As... Agent: Maruha Nichiro Foods, Inc.

20110257093 - Therapies for acute renal failure: The present invention provides methods for the treatment, and pharmaceuticals for use in the treatment, of mammalian subjects in, or at risk of, acute renal failure, or subject to, or at risk of, inflammation, neutrophil-mediated cell damage, and apoptosis resulting from tissue damage or injury. The methods involve the administration... Agent: Stryker Corporation

20110257095 - Pharmaceutical compositions and related methods of delivery: The pharmaceutical compositions described herein include a suspension which comprises an admixture in solid form of a therapeutically effective amount of a therapeutic agent and at least one salt of a medium chain fatty acid and a hydrophobic medium, e.g. castor oil or glyceryl tricaprylate or a mixture thereof. The... Agent:

20110257096 - Compositions for drug administration: The present invention provides compositions and methods and for increasing the bioavailability of therapeutic agents in a subject. The compositions include at least one alkyl glycoside and at least one therapeutic agent, wherein the alkylglycoside has an alkyl chain length from about 10 to about 16 carbon atoms. In various... Agent: Aegis Therapeutics, Inc.

20110257097 - Pharmaceutical compositions of somatotrophic hormones: The invention provides a composition comprising (i) a somatotrophic hormone; (ii) a biodegradable polymer component; and (iii) a release modifier. A process for preparing, and the use of such a composition are also provided.... Agent:

20110257098 - Compositions and methods for treating growth hormone deficiency: The present invention relates to the use of genetic markers to identify the response to growth hormone treatment in Growth Hormone Deficiency (GHD) or Turner Syndrome (TS) patients as well as a method of treating GHD or TS patients and kits for genotyping.... Agent: Merck Serono S.a.

20110257099 - Use of natriuretic peptide for treating heart failure: The present invention relates to the use of a natriurectic peptide, such as urodilatin, for treating a patient suffering from heart failure, such as acute decompensated heart failure. Preferably, a composition comprising an effective amount of urodilatin is intravenously administered to the patient continuously through a time period of at... Agent: Cardiopep Pharma Gmbh

20110257100 - Inhibitors of protein tyrosine kinase activity: This invention relates to compounds that inhibit protein tyrosine kinase activity. In particular the invention relates to compounds that inhibit the protein tyrosine kinase activity of growth factor receptors, resulting in the inhibition of receptor signaling, for example, the inhibition of VEGF receptor signaling. The invention also provides compounds, compositions... Agent:

20110257101 - Catecholamine regulated protein: A novel mammalian catecholamine-regulated protein called CRP40 is identified. This protein, and nucleic acid encoding same, is useful in methods of diagnosing and treating hypodopaminergic neurological disease, such as Parkinson's disease, multisystem atrophy, lewy body dementia, schizophrenia, and bipolar disease.... Agent:

20110257102 - Compositions and methods of treating cancer: A method of inhibiting neoplastic, cancer, and/or tumorgenic cell proliferation, cell growth and motility in a subject includes administering to a cancer cell expressing Pro-PrP and FLNa a therapeutically effective amount of a Pro-PrP regulating agent.... Agent:

20110257103 - Compositions and methods for the treatment of sj?rgren's syndrome: This invention provides a method of inducing a lacrimal acinar cell in a tissue to degrade a secretory vesicle and its content protein or proteins from the trans-Golgi network (TGN) by contacting the cells with an effective amount of an agent that induces autophagy. Also provided is a method for... Agent: University Of Southern California

20110257104 - Methods to identify macromolecule binding and aggregation prone regions in proteins and uses therefor: The present invention provides methods and computational tools based, at least in part, on computer simulations that identify macromolecule binding regions and aggregation prone regions of a protein. Substitutions may then be made in these aggregation prone regions to engineer proteins with enhanced stability and/or a reduced propensity for aggregation.... Agent: Novartis Ag

20110257105 - Synthetic peptide amides and dimers thereof: e

20110257106 - Polymer stabilized neuropeptides: A substantially hydrophilic conjugate is provided having a peptide that is capable of passing the blood-brain barrier covalently linked to a water-soluble nonpeptidic polymer such as polyethylene glycol. The conjugate exhibits improved solubility and in vivo stability and is capable of passing the blood-brain barrier of an animal.... Agent: Nektar Therapeutics

20110257107 - Compounds for delivering amino acids or peptides with antioxidant activity into mitochondria: Disclosed are compounds containing single amino acids, peptides, or derivatives thereof which are selectively delivered to the mitochondria of a cell. Compounds of the invention exhibit antioxidant activity thereby reducing reactive oxygen species in cells. These compounds are useful for inhibiting oxidative stress-induced cell injury or death both in vivo... Agent: University Of Rochester

20110257116 - Biosurfactant-containing skin care cosmetic and skin roughness-improving agent: The present invention relates to a cosmetic for skin roughness improvement/skin care containing a biosurfactant, particularly MEL-A, MEL-B or MEL-C.... Agent: Toyo Boseki Kabushiki Kaisha

20110257110 - Composition comprising a glycoside of a mono- or diacylglycerol compound and an oil rich in n-3 polyunsaturated fatty acids, a method of producing the composition and use of the composition: A composition and use of a composition comprising a glycoside of a mono- or diacylglycerol compound and an oil rich in n-3 polyunsaturated fatty acids, e.g. fish oil. The composition may also comprise a rose hip concentrate. The composition is used to treat inflammatory diseases, e.g. joint diseases such as... Agent: Hyben Vital Licens Aps

20110257114 - Crystalline forms of 1,6-bis [3-(3-carboxymethylphenyl)-4-(2-alpha-d-mannopyranosyl-oxy)-phenyl] hexane: The novel crystalline and polymorphic forms of 1,6-Bis [3-(3-carboxymethylphenyl)-4-(2-α-D-mannopyranosyloxy)-phenyl]hexane have advantageous properties and can be used in pharmaceutical and dermatological compositions.... Agent: Revotar Biopharmaceuticals Ag

20110257111 - Hydroxyethlamino sulfonamide derivatives: This invention relates to novel hydroxyethylamino sulfonamides and pharmaceutically acceptable salts thereof. This invention also provides compositions comprising a compound of this invention and the use of such compositions in methods of treating diseases and conditions that are beneficially treated by administering a compound with the ability to act as... Agent:

20110257112 - Isolated compounds from phaleria macrocarpa as anti-cancer agents: The invention concerns compounds DLBS1425E2.2 and DLBS1425F1 isolated and identified from the extract of the plant Phaleria macrocarpa (Scheff.) Boerl. The invention also relates to the use of said compounds, either as a single active compound or in combination, in a pharmaceutical dosage form that has anti-proliferative activity of cancer... Agent:

20110257113 - Method for inducing a trif-bias: The use of a selected aminoalkyl glusoaminide 4-phosphate (AGP) CRX-547 to induce a TRIF biased response in a human system, which results in reduced levels of MyD88-dependent cytokines relative to the MyD88-dependent cytokines induced by its diastereomer AGP CRX-527.... Agent:

20110257115 - Method for treating rhinitis and sinusitis by rhamnolipids: The present invention is directed to methods for treating rhinitis or sinusitis in a subject. In one embodiment, the method comprises the steps of: identifying a subject in need thereof, and administering intranasally to the subject a formulation comprising an only active ingredient of an effective amount of rhamnolipid. In... Agent:

20110257108 - Synthesis and activity of lactose esters: e

20110257109 - Use of drugs that activate p2y receptors to enhance synaptogenesis: The present invention encompasses compositions and methods that activate P2Y receptors for the increased production of new synapses in the central nervous system. The formulations of the invention may be administered to a healthy subject or to a subject in need thereof to restore synapses.... Agent:

20110257119 - Microcirculation improvement and/or treatment: This invention relates to compositions, and methods of use thereof, for improving microcirculation in a diabetic subject, and for dietary management of diabetes-associated condition(s) comprising administering certain polyphenols such as flavanols, procyanidins, or pharmaceutically acceptable salts or derivatives thereof to the subject in need thereof.... Agent:

20110257117 - Olive compositions and methods for treating inflammatory conditions: A method of treating an inflammatory condition with a hydroxytyrosol-rich composition. Improvement is monitored as a reduction in the levels of a biochemical marker such as homocysteine or C-reactive protein. The composition may be administered in an amount and for a period sufficient to effect a drop in the level... Agent: Creagri, Inc.

20110257118 - Vascular circulation in peripheral and/or small blood vessels: The invention relates to compositions, and methods of use thereof, containing polyphenols such as flavanols, procyanidins, their derivatives and epimers thereof, for improving vascular circulation in peripheral and/or small blood vessels.... Agent: Mars, Incorporated

20110257244 - Chemically modified oligonucleotides and small molecules for use in reducing micro rna activity levels and uses thereof: This invention relates generally to chemically modified oligonucleotides useful for modulating activity of microRNAs and pre-microRNAs. More particularly, the invention relates to single stranded chemically modified oligonucleotides for inhibiting microRNA and pre-microRNA activity and to methods of making and using the modified oligonucleotides.... Agent: Alnylam Pharmaceuticals, Inc.

20110257249 - Drug carriers: Compositions that can include a cationic polymeric carrier, targeting agent, and therapeutic agent are disclosed herein. The therapeutic agent may have a therapeutic activity such as inhibiting fibrosis within a target organ or tissue or inhibiting the growth of a cancer cell.... Agent: Nitto Denko Corporation

20110257247 - Method of treating neurodegenerative disease: Aspects featured in the invention relate to compositions and methods for inhibiting alpha-synuclein (SNCA) gene expression, such as for the treatment of neurodegenerative disorders. An anti-SNCA agent featured herein that targets the SNCA gene can have been modified to alter distribution in favor of neural cells.... Agent: Alnylam Pharmaceuticals, Inc.

20110257245 - Methods of identifying regulators of cellular proteostasis: Embodiments of the present invention provide methods for identifying and utilizing regulators of cellular proteostasis as new therapeutic targets against protein misfolding diseases.... Agent: The Board Of Trustees Of The Leland Stanford Junior University

20110257246 - Rnai-mediated inhibition of hif1a for treatment of ocular angiogenesis: RNA interference is provided for inhibition of HIF1A mRNA expression for treating patients with ocular angiogenesis, particularly for treating retinal edema, diabetic retinopathy, sequela associated with retinal ischemia, posterior segment neovascularization (PSNV), and neovascular glaucoma, and for treating patients at risk of developing such conditions.... Agent: Alcon Research, Ltd.

20110257248 - Rnai-related inhibition of tnfa signaling pathway for treatment of ocular angiogenesis: RNA interference is provided for inhibition of tumor necrosis factor α (TNFα) by silencing TNFα cell surface receptor TNF receptor-1 (TNFR1) mRNA expression, or by silencing TNFα converting enzyme (TACE/ADAM17) mRNA expression. Silencing such TNFα targets, in particular, is useful for treating patients having a TNFα-related condition or at risk... Agent: Alcon Research, Ltd.

20110257252 - Novel antithrombotic diadenosine tetraphosphates and related analogs: The invention features compounds of formula I and methods of their use as antiplatelet and antithrombotic compounds: H/N=Qχ2OOOOΛQ2-N, HR6/NIf)(̂XMO-MγτOM°τX1MQ′)r(̂rfHOOHHOOQHiNχiR2 Formula (I).... Agent: Glsynthesis Inc.

20110257251 - Telomerase inhibitors and methods of use thereof: One object of the present invention is to provide methods and compositions for inhibiting human telomerase, by providing inhibitors that bind to the CR4-CR5 or pseudoknot/template domains of the RNA component of human telomerase.... Agent: Presidents And Fellows Of Harvard College

20110257250 - Treating insulin secreting cells: This invention relates to a recombinant nucleic acid for an RIP-tk (rat insulin promoter-thymidine kinase) construct that selectively targets insulin secreting cells, such as β-cells, PDX-1 positive human pancreatic ductal carcinomas, and other cells containing certain transcription factors. The present invention is useful in the treatment of pancreatic cancers, such... Agent:

20110257120 - Beta-l-2'-deoxy-nucleosides for the treatment of hepatitis b: wherein R is selected from the group consisting of H, straight chained, branched or cyclic alkyl, CO-alkyl, CO-aryl, CO-alkoxyalkyl, CO-aryloxyalkyl, CO-substituted aryl, alkylsulfonyl, arylsulfonyl, aralkylsulfonyl, amino acid residue, mono, di, or triphosphate, or a phosphate derivative; and BASE is a purine or pyrimidine base which may be optionally substituted. The... Agent: Centre National De La Recherche Scientifique

20110257122 - Nucleoside phosphoramidate prodrugs: e

20110257121 - Purine nucleoside phosphoramidate: Disclosed herein is a compound represented by formula 1 or its hydrate thereof in crystalline or crystal-like form.... Agent: Pharmasset, Inc.

20110257123 - Aryl/alkyl vinyl sulfone hyaluronic acid derivatives: A hyaluronic acid derivative, and methods of producing and using said derivative, the derivative comprising n repeating units and having the general structural formula (I), wherein, in at least one repeating unit, one or more of R1, R2, R3, R4 comprises an etherbound aryl/alkyl sulfone having the general structural fomula... Agent: Novozymes Biopolymer A/s

20110257124 - Esterified polysaccharide osmotics: The present invention relates to esterified polysaccharide osmotics, use of same, processes for synthesis of same as well as compositions containing same.... Agent: Fresenius Medical Care Deutschland Gmbh

20110257125 - Mucomimetic compositions and uses therefore: The present invention relates to mucomimetic and ophthalmic solutions comprising a cationic multimeric antimicrobial agent such as polyaminopropyl biguanide and a magnesium, calcium or magnesium/calcium complex of an anionic polymer such as hyaluronate, alginate, carboxymethyl cellulose, chondroitin sulfate or mixtures thereof. In specific embodiments, the solutions include additional components such... Agent:

20110257126 - Water soluble curcumin compositions for use in anti-cancer and anti-inflammatory therapy: The present invention relates to the medical field. In a first aspect the present invention relates to novel water soluble cyclodextrin-curcumin complexes having a pharmacological activity, in particular an anti-tumour and/or anti-inflammatory activity, and improved physico-chemical properties. In a second aspect, the present invention relates to a method for preparation... Agent: Universite Libre De Bruxelles

20110257128 - 2-alkyl-cycloalk(en)yl-carboxamides: e

20110257127 - A2b adenosine receptor antagonists: Disclosed are novel compounds that are A2B adenosine receptor antagonists, useful for treating various disease states, including asthma and diarrhea.... Agent: Gilead Sciences, Inc.

20110257129 - Enantiomerically pure phosphoindoles as hiv inhibitors: 3-phosphoindole compounds substantially in the form of a single enantiomer useful for the treatment of Flaviviridae virus infections, and particularly for HIV infections are provided. Also provided are pharmaceutical compositions comprising the 3-phosphoindole compounds alone or in combination with one or more other anti-viral agents, processes for their preparation, and... Agent: Idenix Pharmaceuticals, Inc.

20110257130 - Compositions and methods for treatment of renin-angiotensin aldosterone system (raas)- related disorders: Compounds are provided which can be useful in reducing the activity of an angiotensin-converting enzyme and thus be used to treat or prevent a renin-angiotensin aldosterone system-related disorder. These compounds include lipoic acid derivatives such as prolyl lipoic acid and pipecolinyl lipoic acid, and other compounds, and these compounds are... Agent:

20110257131 - Phenylalkyl-imidazole-bisphosphonate compounds: m

20110257132 - Charged phospholipid compositions and methods for their use: The invention provides a pharmaceutical composition comprising a synthetic or naturally occurring charged phospholipid, which is formulated into a dosage form for administration to a subject or which is administered as a food additive. Negatively charged phospholipid composition increase the net negative charge on intravascular lipoproteins, enhance the clearance of... Agent:

20110257133 - Dosage regimen for a s1p receptor agonist: S1P receptor modulators or agonists are administered following a dosage regimen whereby during the initial days of treatment the daily dosage is lower than the standard daily dosage.... Agent:

20110257134 - Co-crystals of tramadol and nsaids: The present invention relates to co-crystals of tramadol and co-crystal formers selected from NSAIDs, processes for preparation of the same, their uses in pharmaceutical formulations, and for the treatment of various disorders, including pain.... Agent: Laboratorios Del Dr. Esteve, S.a.

20110257135 - Topical pesticide formulation: Described are formulations and methods for animal pest control. A formulation for topical administration to animal pests includes a solution including an effective amount of cholecalciferol (also known as Vitamin D3) and at least one dermal penetrant or carrier, such that a lethal dose of the cholecalciferol can be delivered... Agent:

20110257137 - Heterocyclic inhibitors of histamine receptors for the treatment of disease: The present invention relates to compounds and methods which may be useful as inhibitors of H1R and/or H4R for the treatment or prevention of inflammatory, autoimmune, allergic, and ocular diseases.... Agent: Kalypsys, Inc.

20110257138 - Monoterpenes for treating respiratory tract diseases, in particular bronchopulmonary diseases: The invention relates to the combined use of at least one monoterpene which can be applied systemically, in particular perorally, and at least one respiratory tract therapeutic agent which can be applied topically, in particular through inhalation, for the prophylactic and/or therapeutic treatment, in particular combination therapy and/or co-medication, of... Agent:

20110257136 - Ophthalmic formulations of cetirizine and methods of use: The present invention provides stable topical formulations of cetirizine that provide a comfortable formulation when instilled in the eye and is effective in the treatment of allergic conjunctivitis and/or allergic conjunctivitis. The invention further provides methods of treating allergic conjunctivitis rhinitis, and/or allergic rhinoconjunctivitis in a subject in need of... Agent: Aciex Therapeutics, Inc.

20110257139 - Treatment of diarrhoea: A method for the treatment or prevention of diarrhoea (or diarrhoeal disease) in an individual comprises a step of administering a therapeutically effective amount of a potent and or selective FXR agonist to the individual. A method for the treatment or prevention of dysregulated fluid transport into the intestine in... Agent: Royal College Of Surgeons In Ireland

20110257140 - Biomarkers of mineralocorticoid receptor activation: The present invention relates to the use of Neutrophil Gelatinase-Associated Lipocalin (NGAL) and/or SERPINA3 as biomarkers of the Mineralocorticoid Receptor (MR) activation in a patient. More particularly, the present invention relates to a method for predicting the responsiveness of a patient to a treatment with a MR antagonist or an... Agent: Inserm (institut National De La Sante Et De La Rec Herche Medicale)

20110257141 - Transdermal pharmaceutical formulation for minimizing skin residues: This invention relates to novel transdermal or transmucosal pharmaceutical formulation having an active agent of testosterone which reduces the occurrences of contamination of other individuals and the transference to clothing of the user. The solvent system of the formulation includes a monoalkylether of diethylene glycol and a glycol present in... Agent: Antares Pharma, Ipl, Ag

20110257142 - Method for preparing 4-[17beta-methoxy-17alpha-methoxymethyl-3-oxoestra-4,9-dien-11-beta-yl]benzaldehyde (e)-oxime (asoprisnil): The present invention relates to a method for the reliable and reproducible preparation of 4-[17β-methoxy-17α-methoxymethyl-3-oxoestra-4,9-dien-11β-yl]benzaldehyde (E)-oxime (asoprisnil) on the pilot and manufacturing scale. Asoprisnil, which is prepared by this method, is distinguished by a very good physical stability and is therefore particularly suitable for the manufacture of solid pharmaceutical forms... Agent:

20110257143 - Compositions and method for the treatment of multiple myeloma: The disclosure provides compositions and methods for treating multiple myeloma. In some embodiments, the compositions comprise (E)-3-hydroxy-21-[2′-(N,N-dimethylamino)ethoxy]-19-norpregna-1,3,5(10),17(20)-tetraene or a pharmaceutically acceptable salt or prodrug thereof and a pharmaceutical carrier.... Agent: Sri International

20110257144 - Novel dermaceutical cream made using sodium fusidate: The present invention relates to primary and secondary bacterial skin infections and in particular it relates to the treatment of these infections using a Fusidic acid cream that has been made using Sodium fusidate as the starting Active Pharmaceutical Ingredient (API). The invention discloses a dermaceutical cream containing Fusidic acid... Agent: Apex Laboratories Private Limited

20110257145 - Method of treating neurological diseases: A method of treating neurological diseases, like Alzheimer's Disease by administering a compound that activates protein kinase C and inhibits histone deacetylases to an individual suffering from the neurological disease. The method utilizes benzolactam compounds that reduce Aβ production and blocks oxidative stress in the treatment of Alzheimer's disease. The... Agent: The Board Of Trustees Of The University Of Illinois

20110257146 - Method of treating kcnq related disorders using organozinc compounds: The instant invention describes methods of treating KCNQ related diseases and disorders using organozinc compounds. In certain embodiments, pain is treated using Zinc Pyrithione.... Agent: The Johns Hopkins University

20110257147 - Neurotherapeutic treatment for sexual dysfunction: A method for improving sexual function is described. A mammal suffering from sexual dysfunction or otherwise in need of enhanced sexual function is administered a compound selected from those that are capable of inhibiting the activity of β-lactams, penicillin-binding protein, carboxypeptidase. Such compounds, including particularly β-lactam ring-containing compounds, can be... Agent: Revaax Pharmaceuticals, LLC

20110257148 - Novel 1-alkyl-3-hydroxy-3-phenylazetidine derivatives useful as modulators of cortical catecholaminergic neurotransmission: The present invention relates to novel 3-phenyl-azetidine derivatives, useful for modulating dopamine neurotransmission and extracellular levels of catecholamines, dopamine and norepinephrine, in cerebral cortical areas of the mammalian brain, and more specifically for the treatment of central nervous system disorders. In other aspects the invention relates to pharmaceutical compositions comprising... Agent: Nsab, Filial Af Neurosearch Sweden Ab, Sverige

20110257149 - Formulation for oral transmucosal administration of lipid-lowering drugs: The invention relates to a formulation for delivering by oral transmucosal administration at least one lipid-lowering active principle, preferably from the statin family, said formulation including said active principle in the base or salt form, an aqueous alcohol solution titrating at least 30° alcohol, and optionally a pH correcting agent... Agent:

20110257150 - New salts: This invention relates to a hydrochloride, malate, oxalate and tartrate salt forms of 1-(4-{1-[(E)-4-cyclohexyl-3-trifluoromethyl-benzyloxyimino]-ethyl}-2-ethyl-benzyl)-azetidine-3-carboxylic acid (Compound I), to pharmaceutical compositions comprising this salt, to processes for forming this salt and to its use in medical treatment. In addition, the present invention also relates to new polymorphic forms of each of... Agent:

20110257153 - Aryl-substituted bridged or fused diamines as modulators of leukotriene a4 hydrolase: Aryl-substituted bridged or fused diamine compounds, pharmaceutical compositions containing them, and methods of using the compounds and the pharmaceutical compositions for leukotriene A4 hydrolase (LTA4H or LTA4H) modulation and for the treatment of disease states, disorders, and conditions mediated by LTA4H activity, such as allergy, asthma, autoimmune diseases, pruritis, inflammatory... Agent: Janssen Pharmaceutical Nv

20110257154 - Compounds and compositions as protein kinase inhibitors: The invention provides novel pyrimidine and pyridine derivatives and pharmaceutical compositions thereof, and methods for using such compounds. For example, the pyrimidine and pyridine derivatives of the invention may be used to treat, ameliorate or prevent a condition which responds to inhibition of anaplastic lymphoma kinase (ALK) activity, focal adhesion... Agent: Irm LLC

20110257155 - Compounds and compositions as protein kinase inhibitors: The invention provides novel pyrimidine and pyridine derivatives and pharmaceutical compositions thereof, and methods for using such compounds. For example, the pyrimidine and pyridine derivatives of the invention may be used to treat, ameliorate or prevent a condition which responds to inhibition of anaplastic lymphoma kinase (ALK) activity, focal adhesion... Agent: Irm LLC

20110257151 - Novel 3,3-dimethyl tetrahydroquinoline derivatives: e

20110257152 - Pyrrolopyridine inhibitors of kinases:

20110257156 - Gamma secretase modulators: In its many embodiments, the present invention provides novel heterocyclic compounds as modulators of gamma secretase, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment, prevention, inhibition, or amelioration of one... Agent:

20110257157 - Thiolactams and uses thereof:

20110257158 - Precompacted fast-disintegrating formulations of compounds with a low oral bioavailability: This invention relates to the field of pharmaceutical chemistry. Embodiments of the present invention relate to, and provide precompacted fast-disintegrating formulations of compounds with a low oral bioavailability.... Agent:

20110257159 - Orally disintegrating tablet formulations of mirtazapine and process for preparing the same: Silicon dioxide free orally disintegrating tablet formulations of mirtazapine or a pharmaceutically acceptable salt thereof having crospovidone and sodium stearyl fumarate and one or more pharmaceutically acceptable excipients and a process for preparing such a formulation.... Agent: Sanovel Ilac Sanayi Ve Ticaret Anonim Sirketi

20110257160 - Quinoline derivatives and uses thereof: This disclosure provides a new class of compounds referred to as “reversed chloroquines” (RCQs), which are highly effective against CQR and CQS malaria parasites. RCQs are hybrid molecules, which include an antimalarial quinoline analog (such as chloroquine) moiety and a CQR reversal moiety. Exemplary RCQ chemical structures are provided. Also... Agent: State Of Oregon Acting By And Through The State

20110257162 - Hiv integrase inhibitors: wherein m, n, X, R1, R2, R3, R4, R5, R6, R7, R8, R9 and R10 are defined herein. The compounds are useful for the prophylaxis or treatment of infection by HIV and the prophylaxis, treatment, or delay in the onset of AIDS. The compounds are employed against HIV infection and... Agent:

20110257161 - Novel diaza-bicyclononyl-phenyl derivatives and their medical use: This invention relates to novel diazabicyclononyl-phenyl derivatives and their use in the manufacture of pharmaceutical compositions. The compounds of the invention are found to be cholinergic ligands at the nicotinic acetylcholine receptors and modulators of the monoamine receptors and transporters. Due to their pharmacological profile the compounds of the invention... Agent: Neurosearch A/s

20110257164 - Dipeptidyl peptidase iv inhibitors: Described are novel compounds of the Formula (I), their derivatives, analogs, tautomeric forms, regioisomers, stereoisomers, polymorphs, solvates, intermediates, pharmaceutically acceptable salts, pharmaceutical compositions, metabolites and prodrugs thereof. These compounds are effective in lowering blood glucose, serum insulin, free fatty acids, cholesterol, triglyceride levels; treatment of obesity, inflammation, autoimmune diseases such... Agent: Orchid Research Laboratories Limited

20110257163 - Gamma secretase modulators: This invention provides novel compounds that are modulators of gamma secretase. The compounds have the formula Compounds of formula (I) include compounds of formulas (IA) and (IB). Also disclosed are methods of modulating gamma secretase activity and methods of treating Alzheimer's Disease using the compounds of formula (I).... Agent: Schering Corporation

20110257165 - Bicyclic pyrazoles as protein kinase inhibitors: 3,4-diaryl-bicyclicpyrazole derivatives of formula (I) as defined in the specification, and pharmaceutically acceptable salts thereof, process for their preparation and pharmaceutical compositions comprising them are disclosed; the compounds of the invention may be useful, in therapy, in the treatment of diseases associated with a disregulated protein kinase activity, like cancer.... Agent: Nerviano Medical Sciences S.r.l.

20110257166 - Novel agrochemical suspoemulsions: The present invention provides an aqueous suspoemulsion comprising (a) an oil phase comprising (i) at least one triazole active compound as emulsified component, solid at room temperature, (ii) at least one alkyl carboxylic acid amide as a solvent and a crystal growth inhibitor, and (iii) a polymeric stabilizer, and (b)... Agent: Rotam Agrochem International Co., Ltd.

20110257167 - Identification of lkb1 mutation as a predictive biomarker for sensitivity to tor kinase inhibitors: Provided herein are methods for treating and/or preventing a cancer or a tumor syndrome in a patient, comprising administering an effective amount of a TOR kinase inhibitor to a patient having cancer or a tumor syndrome, characterized by a LKB1 and/or AMPK gene or protein loss or mutation.... Agent:

20110257168 - Derivatives of oxabispidine as neuronal nicotinic acetylcholine receptor ligands: The present invention relates to compounds of formula (I) that bind to and modulate the activity of neuronal nicotinic acetylcholine receptors, to processes for preparing these compounds, to pharmaceutical compositions containing these compounds, and to methods of using these compounds for treating a wide variety of conditions and disorders, including... Agent: Targacept, Inc.

20110257169 - Novel hydroxy-6-heteroarylphenanthridines and their use as pde4 inhibitors: e

20110257170 - 4-morpholino-pyrido[3,2-d]pyrimidines: This invention relates to compounds of Formula (I) as Pi3k inhibitors for treating autoimmune diseases, inflammatory disorders, multiple sclerosis and other diseases like cancers.... Agent: Merck Serono Sa

20110257173 - 3 (3-pyrimidin-2-ylbenzyl)-1,2,4-triazolo[4,3-b]pyridazine derivatives: Compounds of the formula (I), in which R1, R2, R3, R3′, R4 have the meanings indicated in claim 1, are inhibitors of tyrosine kinases, in particular Met kinase, and can be employed, inter alia, for the treatment of tumours.... Agent: Merck Patent Gmbh Mit Beschraenkter Haftung

20110257172 - 3-(3-pyrimidine-2-yl-benzyl)-[1,2,4] triazolo[4,3-b]pyrimidine derivatives: Compounds of the formula I, in which R1, R2, R3, R3, R4 have the meanings indicated in Claim 1, are inhibitors of tyrosine kinases, in particular Met kinase, and can be employed, inter alia, for the treatment of tumours.... Agent: Merck Patent Gesellschaft Mit Beschrankter Haftung

20110257171 - Novel imidazo[1,2-a]pyridine derivatives, method for the preparation thereof, use thereof as medicaments, pharmaceutical compositions and novel use in particular as met inhibitors: The invention relates to the novel products of formula (I): in which: Ra is H, Hal, aryl or heteroaryl, which are optionally substituted; Rb is H, Rc, —COORc-CO-Rc or —CO—NRcRd; where Rc is alkyl, cycloalkyl, heterocycloalkyl, aryl and heteroaryl, all optionally substituted; Rd is H, alk or cycloalkyl; these products... Agent: Sanofi-aventis

20110257174 - Chromenone analogs as sirtuin modulators: Provided herein are novel sirtuin-modulating compounds and methods of use thereof. The sirtuin-modulating compounds may be used for increasing the lifespan of a cell, and treating and/or preventing a wide variety of diseases and disorders including, for example, diseases or disorders related to aging or stress, diabetes, obesity, neurodegenerative diseases,... Agent: Sirtris Pharmaceuticals, Inc.

20110257175 - Selected inhibitors of protein tyrosine kinase activity: The invention provides new compounds and compositions thereof. The invention also provides methods for treating ophthalmic diseases, disorders and conditions.... Agent:

20110257177 - Benzylthiotetrazole inhibitors of store operated calcium release: Described herein are compounds and pharmaceutical compositions containing such compounds, which modulate the activity of store-operated calcium (SOC) channels. Also described herein are methods of using such SOC channel modulators, alone and in combination with other compounds, for treating diseases, disorders or conditions that would benefit from inhibition of SOC... Agent: Calcimedica, Inc.

20110257176 - Nitrogen heterocycle derivatives as proteasome modulators: s

20110257178 - Cannabinoid receptor antagonists/inverse agonists useful for treating metabolic disorders, including obesity and diabetes: The present invention provides novel pyrazolines that are useful as cannabinoid receptor blockers and pharmaceutical compositions thereof and methods of using the same for treating obesity, diabetes, inflammatory disorders, cardiometabolic disorders, hepatic disorders, and/or cancers.... Agent: Jenrin Discovery

20110257180 - Novel polymorphic forms of 6-(1-methyl-1h-pyrazol-4-yl)-2--2h-pyridazin-3-one dihydrogenphosphate and processes of manufacturing thereof: The present invention relates to 6-(1-methyl-1H-pyrazol-4-yl)-2-{3-[5-(2-morpholin-4-yl-ethoxy)-pyrimidin-2-yl]-benzyl}-2H-pyridazin-3-one dihydrogenphosphate, its solvates and crystalline modifications thereof. The present invention further relates to processes of manufacturing these crystalline modifications as well as their use in the treatment and/or prophylaxis of physiological and/or pathophysiological conditions, which are caused, mediated and/or propagated by the inhibition, regulation... Agent: Merck Patent Gesellschaft Mit Beschrankter Haftung

20110257179 - Novel thiazoles derivatives and their use as positive allosteric modulators of metabotropic glutamate receptors: The present invention relates to novel compounds of Formula (I), wherein M, P, A and (B)n are defined as in Formula (I); invention compounds are modulators of metabotropic glutamate receptors—subtype 4 (“mGluR4”) which are useful for the treatment or prevention of central nervous system disorders as well as other disorders... Agent:

20110257181 - Pyridazinone derivatives: Compounds of the formula (I), in which Y, R1, R2, R3 and R3′ have the meanings indicated in claim 1, are inhibitors of tyrosine kinases, in particular of Met kinase, and can be employed, inter alia, for the treatment of tumours.... Agent: Merck Patent Gesellschaft Mit Beschrankter Haftung

20110257182 - Novel amido derivatives and their use as positive allosteric modulators of metabotropic glutamate receptors: m

20110257183 - Bis-aryl sulfonamides: Compounds are provided that act as potent antagonists of chemokine receptors. The compounds are generally aryl sulfonamide derivatives and are useful in pharmaceutical compositions, methods for the treatment of chemokine receptor-mediated diseases, and as controls in assays for the identification of chemokine antagonists.... Agent:

20110257185 - Reverse-turn mimetics and method relating thereto: Conformationally constrained compounds that mimic the secondary structure of reverse-turn regions of biologically active peptides and proteins are disclosed. Such reverse-turn mimetic structures have utility over a wide range of fields, including use as diagnostic and therapeutic agents. Libraries containing the reverse-turn mimetic structures of this invention are also disclosed... Agent: Choongwae Pharma Corporation

20110257184 - Shp-2 phosphatase inhibitor: A method of treating SHP-2 phosphatase associated diseases in a subject includes administering a SHP-2 inhibitor to the subject.... Agent:

20110257186 - Compositions and methods for treating visual disorders: Wherein R1 and R2 are independently hydrogen, alkyl, substituted alkyl, cycloalkyl, alkynyl, substituted alkynyl, cyano, alkoxy, carboxamido, substituted carboxamido, and if R1 and R2 are alkyl, R1 and R2 may be joined with a bond or —(CH2)m— to produce a cycloalkyl, R3 and R4 are independently hydrogen, alkyl, hydroxyl, alkoxy,... Agent:

20110257187 - Phthalazin-(2h)-one inhibitors of kinases: e

20110257188 - Compositions and methods for the treatment of nasal conditions: The invention provides compositions and methods for treating nasal congestion. The provided compositions and methods utilize low concentrations of selective α-2 adrenergic receptor agonists. The compositions preferably include brimonidine.... Agent:

20110257190 - Crystalline forms: The disclosure relates to crystalline forms of 2-[4-(7-ethyl-5H-pyrrolo[2,3-b]pyrazin-6-yl)-phenyl]-propan-2-ol, characterized by physico-chemical data described herein.... Agent: Sanofi

20110257189 - Pyrrolopyrazinone inhibitors of kinases: e

20110257192 - Compound for treatment of respiratory condition or disease: The present invention relates to the treatment, alleviation, prevention or reduction of symptoms or exacerbations of asthma or chronic obstructive pulmonary disease (COPD), of which reduced lung function is typically symptomatic.... Agent: Biota Scientific Management Pty Ltd

20110257191 - Hydrazine-substituted anthranilic acid derivatives: e

20110257193 - Fused imidazole derivatives as trpv3 antagonist: The present invention provides transient receptor potential vanilloid (TRPV) modulators of formula (I). In particular, compounds described herein are useful for treating or preventing diseases, conditions and/or disorders modulated by TRPV3. Also provided herein are processes for preparing compounds described herein, intermediates used in their synthesis, pharmaceutical compositions thereof, and... Agent: Glenmark Pharmaceuticals, S.a.

20110257194 - Substituted oxindol derivatives and medicaments containing the same: e

20110257195 - Cosmetic use of 1-aroyl-n-(2-oxo-3-piperidinyl)-2-piperazine carbomamides and related compounds: Cosmetic compositions comprising 1-aroyl-N-(2-oxo-3-piperidinyl)-2-piperazine carboxamides and methods of using such compositions to impart anti-aging benefits to the skin are disclosed. The 1-aroyl-N-(2-oxo-3-piperidinyl)-2-piperazine carboxamides are believed to have modulatory activity against one or more biochemical pathways implicated in skin aging.... Agent: Avon Products, Inc.

20110257196 - Compounds for treatment of cancer: The present invention relates to novel compounds having anti-cancer activity, methods of making these compounds, and their use for treating cancer and drug-resistant tumors, e.g. melanoma, metastatic melanoma, drug resistant melanoma, prostate cancer and drug resistant prostate cancer.... Agent:

20110257199 - Novel teraryl compounds as antiparasitic agents: Novel dicationic terphenyl compounds and their aza analogues. Methods for combating microbial infections with novel dicationic terphenyl compounds and their aza analogues. Processes for synthesizing novel dicationic terphenyl compounds and their aza analogues.... Agent:

20110257197 - Pharmaceutical formulations comprising voriconazole and processes for preparation thereof: The present invention provides a pharmaceutical formulation comprising voriconazole or a pharmaceutically acceptable derivative thereof, and an excipient of formula (I), i.e., monomethoxy poly(ethylene glycol)-poly (D,L-lactic acid) block copolymers (mPEG-PDLLA). The pharmaceutical formulation of the present invention has been shown to be stable and safe by experiments.... Agent: Nanjing Cavendish Bio-engineering Technology Co., Ltd.

20110257198 - Piperidine derivatives useful as orexin antagonists: e

20110257200 - Treatment of acne and other diseases: The invention relates to compounds for the treatment of dermatological diseases where inflammation, matrix metalloproteinases (MMPs) and peroxisome proliferator-activated receptors (PPARs) play a role in mediating the disease, such as the treatment of acne with Pemirolast or a closely related compound thereof.... Agent:

20110257201 - Agent for overcoming resistance to anti-cancer agent: An agent comprising, as an active ingredient, a xanthine oxidase inhibitor such as 2-[3-cyano-4-(4-fluorophenoxy)phenyl]-4-hydroxythiazolo[5,4-d]pyrimidine potassium salt, 2-[3-cyano-4-(4-fluorophenoxy)phenyl]thiazolo[5,4-d]pyrimidine, 2-(3-cyano-4-phenoxyphenyl)-4-hydroxythiazolo[5,4-d]pyrimidine, 2-(3-cyano-4-phenoxyphenyl)-4-hydroxythiazolo[5,4-d]pyrimidine potassium salt, 2-(3-cyano-4-phenoxyphenyl)thiazolo[5,4-d]pyrimidine, TMX-67, and FYX-051, which can be used as an agent for overcoming anti-cancer agent resistance.... Agent: Nippon Chemiphar Co., Ltd.

20110257203 - Inhibitors of bruton's tyrosine kinase: Disclosed herein are compounds that form covalent bonds with Bruton's tyrosine kinase (Btk). Also described are irreversible inhibitors of Btk. Methods for the preparation of the compounds are disclosed. Also disclosed are pharmaceutical compositions that include the compounds. Methods of using the Btk inhibitors are disclosed, alone or in combination... Agent: Phamarcyclics, Inc.

20110257202 - Therapeutic compositions and methods for treating chronic kidney disease associated with a metabolic imbalance: Disclosed herein are compositions and methods for treating chronic kidney disease and/or a metabolic imbalance. Specifically exemplified herein are methods involving the coadministration of a RAS inhibitor with a conjunctive agent that improves endothelial NO or endothelial function. Also disclosed are methods of treating a patient exhibiting symptoms of a... Agent:

20110257204 - Penciclovir or famciclovir for treatment of recurrent genital herpes with a one-day application: A method for the treatment of recurrent genital herpes, in mammals, including humans, which method comprises administering to the mammal in need of such treatment, an effective amount of penciclovir or famciclovir, or a pharmaceutically acceptable salt thereof for a treatment period of one day.... Agent:

20110257205 - Xanthine derivatives as selective hm74a agonists: The present invention relates to compounds which are xanthine derivatives, processes for the manufacture of said derivatives, pharmaceutical formulations containing these compounds and the use of the compounds in therapy, for example, in the treatment of diseases where under-activation of the HM74A receptor contributes to the disease or where activation... Agent:

20110257206 - Combinations of therapeutic agents for treating cancer: The invention relates to a combination comprising a microtubule active agent; and one or more pharmaceutically active agents; pharmaceutical compositions comprising said combination; methods of treatment comprising said combination; processes for making said combination; and a commercial package comprising said combination.... Agent:

20110257207 - Raf inhibitors: The present invention provides derivatives of pyrido[2,3-d]pyrimidin-7-one. These compounds are inhibitors or kinases such as Raf, including compounds that show anti-proliferative activity, including against tumor cells, and are useful in the treatment of diseases including cancer.... Agent: Agennix Ag

20110257208 - Compounds useful as faah modulators and uses thereof: Compounds are disclosed that have formula I: where A, B, L1, W, Y, R1, and R3 are as defined herein. The compounds and pharmaceutical compositions thereof are useful for the prevention and treatment of a variety of conditions in mammals including humans, including by way of non-limiting example, pain, anxiety,... Agent:

20110257209 - 6-1h-imidazo-quinazoline and quinolines derivatives, new potent analgesics and anti-inflammatory agents: The present invention is directed to novel 6-1H-imidazo-2-aryl and 2-heteroaryl quinazoline and quinoline of formula I, corresponding salts and solvates thereof, to a process for their preparation and to the use of this compounds and corresponding pharmaceutical composition for the treatment of pain and inflammatory related disorders. Compounds of the... Agent: Rottapharm S.p.a

20110257210 - Benzimidazole derivatives and their use for modulating the gabaa receptor complex: The present application discloses novel benzimidazole derivatives of general formula (I) or an N-oxide thereof, any of its stereoisomers or any mixture of its stereoisomers, or a pharmaceutically acceptable salt thereof, wherein R represents a pyridyl or pyrimidyl group; which pyridyl or pyrimidyl group is optionally substituted with one or... Agent: Neurosearch A/s

20110257211 - Small-molecule choline kinase inhibitors as anti-cancer therapeutics: e

20110257212 - New azacyclic derivatives:

20110257213 - Substituted piperidine spiro pyrrolidinone and piperidinone, preparation and therapeutic use thereof: wherein R1, R2, R3, m, n and p are as described herein. More specifically, the compounds of this invention are modulators of H3 receptors and are, therefore, useful as pharmaceutical agents, especially in the treatment and/or prevention of a variety of diseases modulated by H3 receptors including diseases associated with... Agent: Sanofi

20110257214 - Morphinan compounds: This invention relates to novel morphinan compounds and pharmaceutically acceptable salts thereof. This invention also provides compositions comprising a compound of this invention and the use of such compositions in methods of treating diseases and conditions that are beneficially treated by administering a σ1 receptor agonist that also has NMDA... Agent:

20110257215 - Novel co-crystal of tiotropium bromide: The invention relates to a new crystalline form of tiotropium bromide, processes for preparing it and its use for preparing a pharmaceutical composition for the treatment of respiratory complaints, particularly for the treatment of COPD (chronic obstructive pulmonary disease) and asthma.... Agent: Boehringer Ingelheim Pharma Gmbh Co.kg

20110257218 - 2 x 2 x 2 week dosing regimen for treating actinic keratosis with pharmaceutical compositions formulated with 3.75 % imiquimod: Pharmaceutical formulations and methods for the topical or transdermal delivery of 1-isobutyl-1H-imidazo[4,5-c]-quinolin-4-amine or 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine, i.e., imiquimod, to treat actinic keratosis with short durations of therapy, than currently prescribed for the commercially available Aldara® 5% imiquimod cream, as now approved by the U.S. Food & Drug Administration (“FDA”), are disclosed and... Agent: Graceway Pharmaceuticals, LLC

20110257216 - 2 x 2 x 2 week treatment regimen for treating actinic keratosis with pharmaceutical compositions formulated with 2.5% imiquimod: Pharmaceutical formulations and methods for the topical or transdermal delivery of 1-isobutyl-1H-imidazo[4,5-c]-quinolin-4-amine or 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine, i.e., imiquimod, to treat actinic keratosis with short durations of therapy, than currently prescribed for the commercially available Aldara® 5% imiquimod cream, as now approved by the U.S. Food & Drug Administration (“FDA”), are disclosed and... Agent: Graceway Pharmaceuticals, LLC.

20110257217 - 3 x 3 x 3 week treatment regimen for treating actinic keratosis with pharmaceutical compositions formulated with 2.5% imiquimod: Pharmaceutical formulations and methods for the topical or transdermal delivery of 1-isobutyl-1H-imidazo[4,5-c]-quinolin-4-amine or 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine, i.e., imiquimod, to treat actinic keratosis with short durations of therapy, than currently prescribed for the commercially available Aldara® 5% imiquimod cream, as now approved by the U.S. Food & Drug Administration (“FDA”), are disclosed and... Agent: Graceway Pharmaceuticals, LLC.

20110257219 - Lower dosage strength pharmaceutical compositions forumlated with 3.75% imiquimod: Pharmaceutical formulations and methods for the topical or transdermal delivery of 1-isobutyl-1H-imidazo[4,5-c]-quinolin-4-amine or 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine, i.e., imiquimod, to treat actinic keratosis with short durations of therapy, than currently prescribed for the commercially available Aldara® 5% imiquimod cream, as now approved by the U.S. Food & Drug Administration (“FDA”), are disclosed and... Agent: Graceway Pharmaceuticals, LLC

20110257220 - 3,11 b-cis-dihydrotetrabenazine for the treatment of schizophrenia and other psychoses: The invention provides the use of 3,11b-cis-dihydrotetrabenazine or a pharmaceutically acceptable salt thereof for the manufacture of a medicament for the prophylaxis or treatment of schizophrenia and other psychoses.... Agent: Cambridge Laboratories (ireland) Limited

20110257221 - Novel hydroxy-6-heteroarylphenanthridines and their use as pde4 inhibitors: e

20110257222 - Compounds and methods for the treatment of pain and other diseases: The present invention relates generally to alkyne containing pharmaceutical agents, and in particular, to phenylethynyl-thiophene based metalloprotease inhibitor compounds. More particularly, the present invention provides a new class of MMP inhibiting compounds that exhibit increased potency, metabolic stability and/or reduced toxicity in relation to currently known MMP inhibitors for the... Agent: Aquilus Pharmaceuticals, Inc.

20110257223 - Modulators of cystic fibrosis transmembrane conductance regulator: The present invention relates to modulators of cystic fibrosis transmembrane conductance regulator (“CFTR”), compositions thereof, and methods therewith. The present invention also relates to pharmaceutical compositions comprising a compound of Formula I with one or both of a Compound of Formula II and/or a Compound of Formula III. Further, the... Agent: Vertex Pharmaceuticals Incorporated

20110257224 - Preparation and therapeutic applications of (2s,3r)-n-2-((3-pyridinyl)methyl)-1-azabicyclo[2.2.2]oct-3-yl)-3,5-difluorobenzamide: The present invention relates to compounds that bind to and modulate the activity of neuronal nicotinic acetyl-choline receptors, to processes for preparing these compounds, to pharmaceutical compositions containing these compounds, and to methods of using these compounds for treating a wide variety of conditions and disorders, including those associated with... Agent: Targacept, Inc

20110257225 - Cyclohexylamine derivative containing phenyl group, and therapeutic agent for diseases accompanied by central nervous system disorders: wherein X and Y independently represent a hydrogen atom, a halogen atom, a trihalomethyl group, a dihalomethyl group, a monohalomethyl group, a methoxy group, a hydroxyl group, or an alkyl group having 1 to 3 carbon atoms; R1, R2, R3 and R4 independently represent a hydrogen atom, a hydroxyl group,... Agent: M's Science Corporation

20110257226 - Halogen-containing organosulfur compound and use thereof: There is provided a halogen-containing organosulfur compound having a controlling effect on arthropod pests represented by the formula (I): wherein m represents 0, 1 or 2; n represents 0, 1 or 2; A represents an optionally substituted 3- to 8-membered saturated heterocyclic group; Q represents a fluorine atom or a... Agent:

20110257227 - Methods for treatment of cognitive and menopausal disorders with d-threo methylphenidate: In one aspect, the present invention is directed to methods for treating fatigue, neurobehavioral slowing and other cognitive disorders and defects due to cancers and treatments associated with cancers, and similar conditions. In a further aspect, the present invention is directed to methods for treating disorders related to menopause, including... Agent:

20110257228 - Liquid pharmaceutical compositions comprising a triptan compound and xylitol: The present disclosure relates to aqueous liquid pharmaceutical compositions comprising a) at least one triptan compound, pharmaceutically acceptable salts or hydrates thereof, and b) xylitol.... Agent:

20110257229 - Selective serotonin 2a/2c receptor inverse agonists as therapeutics for neurodegenerative diseases: Behavioral pharmacological data with the compound of formula (I), a novel and selective 5HT2A/2C receptor inverse agonist, demonstrate in vivo efficacy in models of psychosis and dyskinesias. This includes activity in reversing MK-801 induced locomotor behaviors, suggesting that this compound may be an efficacious anti-psychotic, and activity in an MPTP... Agent:

20110257230 - Benzimidazole derivatives and their use for modulating the gabaa receptor complex: The present application discloses novel benzimidazole derivatives and their use as modulators of the GABAA receptor complex. In other aspects the application discloses the use of these compounds, in a method for therapy and to pharmaceutical compositions comprising these compounds.... Agent: Neurosearch A/s

20110257231 - Anthranilamide compounds, process for their production and pesticides containing them: Anthranilamide compounds, a process for their production, and pesticides containing these compounds as active ingredients. This Abstract is not intended to define the invention disclosed in the specification, nor intended to limit the scope of the invention in any way.... Agent: Ishihara Sangyo Kaisha Ltd.

20110257232 - Biphenyl oxadiazole derivatives as sphingosine-1-phosphate receptors modulators: The present invention relates to novel biphenyl oxadiazole derivatives, processes for preparing them, pharmaceutical compositions containing them and their use as pharmaceuticals as modulators of sphingosine-1-phosphate receptors.... Agent: Allergan, Inc.

20110257233 - Benzoisothiazolones as inhibitors of phosphomannose isomerase: The disclosure provides new compounds and compositions thereof, and methods for treating or ameliorating a disorder relating to CDG-Ia. In particular, the disclosure provides benzoisothiazolone inhibitors of PMI, which have been synthesized and their ability to drive glycosylation has been demonstrated. The disclosure provides two synthetic routes for these compounds,... Agent: Sanford-burnham Medical Research Institute

20110257234 - Agrochemical auxiliary compositions: Suggested are agrochemical auxiliary compositions, comprising (a) alkoxylated polyol esters, (b) optionally alkoxylated alk(en)yl oligoglycosides, and (c) fatty acids or their salts.... Agent: CognisIPManagement Gmbh

20110257235 - Triazolium and imidazolium salts and uses thereof: The present disclosure relates to certain new and known triazolium and/or imidazolium salts and to their therapeutic use, for example in methods of treating or preventing an infection by a Plasmodium or Babesia parasite in a subject in need thereof. The triazolium and imidazolium salts are compounds of the Formula... Agent:

20110257236 - Solid solution of valine, isoleucine, leucine and its manufacturing method: [Solving Means] The above problem is solved by a solid solution composed of three amino acids of valine, isoleucine, leucine, and a solid solution composed of these and at least one of acid selected from the group consisting of neutral aliphatic amino acid, neutral hydroxy amino acid, neutral acid amide... Agent: Ajinomoto Co., Inc.

20110257238 - Heteroaryl dihydroindolones as kinase inhibitors: wherein the variables R1, b, R6, Y, Z, X, R and a are defined in the specification. Said compound may be used in a method for treating diseases related to unregulated tyrosine kinase signal transduction, wherein said disease is selected from the group consisting of cancer, blood vessel proliferative disorders,... Agent: Allergan, Inc.

20110257237 - Process for the preparation of crystalline forms of sunitinib malate: The present invention, relates to novel processes for the preparation of sunitinib malate formula (I), pharmaceutical compositions comprising said polymorph and the use of the said pharmaceutical compositions in the treatment of various forms of cancer.... Agent: Generics [uk] Limited

20110257239 - Sustained release pharmaceutical composition and method of releasing pharmaceutically active agent: The present invention is directed to solid, sustained-release, oral dosage form pharmaceutical compositions which contain therapeutic amounts of a pharmaceutically active agent, hydroxypropyl methyl cellulose and a non-ionic, hydrophilic polymer selected froth the group consisting of hydroxyethyl cellulose having a number average molecular weight ranging from 90,000 to 1,300,000, hydroxypropyl... Agent:

20110257240 - Stabilized statin formulations: The present invention is directed to statin formulations having improved solubility and/or stability and methods for the same.... Agent: Cumberland Pharmaceuticals Inc.

20110257241 - 3-phenyl-3-methoxypyrrolidine derivatives as modulators of cortical catecholaminergic neurotransmission: The present invention relates to novel 3-phenyl-3-methoxy-pyrrolidine derivatives, useful for modulating extracellular levels of catecholamines, dopamine and norepinephrine, in cerebral cortical areas of the mammalian brain, and more specifically for the treatment of central nervous system disorders. In other aspects the invention relates to pharmaceutical compositions comprising the 3-phenyl-3-methoxy-pyrrolidine derivatives... Agent: Nsab, Filial Af Neurosearch Sweden Ab, Sverige

20110257242 - 3-phenyl-3-methoxypyrrolidine derivatives as modulators of cortical catecholaminergic neurotransmission: The present invention relates to novel 3-phenyl-3-methoxy-pyrrolidine derivatives, useful for modulating dopamine neurotransmission and extracellular levels of catecholamines, dopamine and norepinephrine, in cerebral cortical areas of the mammalian brain, and more specifically for the treatment of central nervous system disorders. In other aspects the invention relates to pharmaceutical compositions comprising... Agent: Nsab, Filial Af Neurosearch Sweden Ab, Sverige

20110257243 - 3-phenoxymethylpyrrolidine compounds: e

20110257253 - Preparation method of polymeric micellar nanoparticles composition containing a poorly water-soluble drug: Provided is a method for preparing a poorly water-soluble drug-containing polymeric micellar nanoparticle composition, which includes: dissolving a poorly water-soluble drug, a salt of polylactic acid or polylactic acid derivative, whose carboxylic acid end is bound to an alkali metal ion, and an amphiphilic block copolymer into an organic solvent;... Agent: Samyang Corporation

20110257254 - Adamantane derivatives of aza-crown ethers and their use in treatment of tumor: The invention relates to adamantane diaza-crown ether derivatives and the use of mono and diaza-crown ether adamantine derivatives in treatment, especially in tumor treatment. Adamantane aza-crown ethers were obtained by reaction of the corresponding adamantane derived tosylates or adamantane acid chlorides with mono- and diaza-18-crown-6. The prepared compounds showed moderate... Agent:

20110257255 - Composition and method for inhibition of nerve transmission: The presently claimed and disclosed invention(s) provides a therapeutically effective composition and method of inhibiting nerve cell transmission. In a preferred embodiment of the presently claimed and disclosed invention(s), the treatment of neuropathic pain utilizing terpene compounds isolated from plant essential oils or manufactured synthetically is detailed. These compounds, such... Agent:

20110257256 - Cannabinoids for use in treating or preventing cognitive impairment and dementia: The present invention is directed to the use of at least one cannabinoid in the manufacture of a medicament for use in treating or preventing or in the manufacture of a dietary supplement for preventing a disease or condition benefiting from a reduced activity of the enzyme indoleamine 2,3-dioxygenase (IDO).... Agent: Bionoria Research Gmbh

20110257257 - Composition for treatment of epithelial tissue: A pharmaceutical composition is provided. The composition is a topical oil-in-water formulation which includes a GABA agonist such as topiramate as the active ingredient.... Agent:

20110257258 - Method for preventing and treating avian influenza in human: A method and composition for preventing and treating Avian Influenza in Humans utilizes an effective quantity of polyphenolic(s) and/or its derivatives in combination with a carrier. The anti-avian influenza ingredient having a composition selected from the group consisting of theaflavin, theaflavin-3,3′-digallate, theaflavin-3-monogallate, theaflavin-3 gallate, theaflavin-3′-gallate, thearubigin, gallic acid, tannic acid,... Agent:

20110257259 - Nut skin products and methods of use thereof: The invention relates to a method of treating or preventing a nitric oxide (NO)-responsive disease or disorder by administering to a subject in need thereof a composition, including foods such as confectionary and pet foods, comprising nut skins and/or a procyanidin-containing nut skins extract. Said composition may further comprise cocoa... Agent: Mars, Incorporated

20110257260 - 3,4-methylenedioxyphenyl inhibitors of gaba aminotransferase and/or gaba reuptake transporter inhibitor: The present invention relates to new 3,4-methylenedioxyphenyl inhibitors of GABA aminotransferase activity and/or GABA reuptake transporter activity, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Auspex Pharmaceuticals, Inc.

20110257261 - Platinum (iv) complexes for use in dual mode pharmaceutical therapy: The present invention provides compositions, preparations, formulations, kits, and methods useful for treating subjects in need of therapeutic protocol, including subjects having cancer or at risk of developing cancer. Some embodiments of the invention may comprise a composition comprising a first component comprising a precursor to a therapeutically active platinum... Agent: Massachusetts Institute Of Technology

20110257262 - Crystalline ingenol mebutate: The present invention relates to a novel crystalline form of ingenol mebutate, methods of preparation thereof, and to its use. More specifically, the invention relates to the conversion of amorphous ingenol mebutate (ingenol-3-angelate, PEP005) to a crystalline form, which was characterized by single crystal X-Ray crystallography (XRC), attenuated total reflectance... Agent: Leo Pharma A/s

20110257263 - Jasmonic acid compounds in cocoa products: The invention provides methods for isolating and enhancing the levels of jasmonates from cacao plant sources. In a preferred embodiment, jasmonic acid and 12-hydroxy jasmonate sulfate are detected in various cocoa products, and the levels of these compounds can be manipulated to increase the beneficial health effects of a food... Agent:

20110257264 - Use of 2,5-dihydroxybenzene derivatives for treating actinic keratosis: The present invention relates to the use of a 2,5-dihydroxybenzene derivative represented by Formula (I) or a pharmaceutically acceptable salt, solvate, isomer, or prodrug thereof for the therapeutic and/or prophylactic treatment of, inter alia, actinic keratosis.... Agent: Action Medicines

20110257265 - Uv absorbers for reducing the e/z isomerization of pesticides: The present invention provides the use of a UV absorber for reducing the E/Z isomerization of pesticides comprising a double bond. It furthermore relates to a composition comprising an E and/or a Z isomer of a pesticide comprising a double bond and a UV absorber.... Agent:

20110257266 - Therapeutic regimen and methods for treating or ameliorating visual disorders associated: Disclosed herein are therapeutic regimens for treating or ameliorating a visual disorder associate with an endogenous retinoid deficiency in a subject by administering a therapeutically effective amount of a synthetic retinal derivative or a pharmaceutically acceptable composition comprising a synthetic retinal derivative according to the therapeutic regimen which leads to... Agent: Qlt, Inc.

20110257267 - Reducing the risk of pathological effects of traumatic brain injury: The present disclosure provides methods and compositions for reducing the risk of pathological effects of traumatic brain injury.... Agent:

20110257268 - Reduction of sterols and other compounds from oils: A process for the removal of sterols, specifically cholesterol, from a triglyceride oil, preferably a marine triglyceride oil, said process comprising contacting an oil with an adsorbent, specifically TRIS YL™, clay or a mixture thereof, heating the mixture to 100° C. to 210° C., preferably 150° C. to 170° C.,... Agent: Ocean Nutrition Canada Limited

20110257269 - Preventive and/or therapeutic agent for inflammatory bowel diseases: The present invention relates to a preventive and/or a therapeutic agent for inflammatory bowel diseases containing a fermentation product of a propionic acid bacterium as an active ingredient.... Agent: Meiji Dairies Corporation

20110257270 - Drug for treatment of colon cancer: A first aspect of the invention provides a method for treating, preventing or ameliorating a hyperproliferative disease and/or disorder in a mammal comprising administering to the mammal a therapeutically effective amount of one or more compounds selected from the group consisting of compounds of Formula (1), (2), or a pharmaceutically... Agent:

20110257271 - Derivatives of dimethylcurcumin: f

20110257272 - Mixed crystals, method for the production thereof and use thereof in the production of baked goods: The present invention relates to mixed crystals comprising a) leavening agent and b) 0.1 to 5000 ppm by weight of crystallization aid, based on the total amount of the leavening agent, in the form of at least polymer, wherein when hydrophilic cellulose derivatives are used as crystallization aid, the amount... Agent: Basf Se

20110257273 - Polyester resin and purposes thereof: A low-molecular-weight polyester resin which can elasticize a resin suitably and can be used for various purposes, various resins obtained by using the resin, and the purposes thereof. The polyester resin is obtained by polymerizing a monomer composition containing 10 to 90 weight % of a linear dicarboxylic acid and/or... Agent: Nippon Bee Chemical Co., Ltd.

10/13/2011 > 175 patent applications in 131 patent subcategories. categorized by USPTO classification

20110251120 - Antimicrobial peptides and methods of identifying the same: Antimicrobial peptides and methods of identifying the same are provided.... Agent:

20110251121 - Use of cysteine-rich whey derived protein in patients receiving chemotherapy and/or radiotherapy to improve patient survival: A cysteine-rich undenatured whey-derived protein formulation did not interfere with the tumor-cytotoxic effects of chemotherapy and radiation therapy and did not have a negative effect on the clinical outcome, that is, negatively affect survival and increase mortality. Indeed, use of a high-cysteine undenatured whey derived protein in the treatment of... Agent: 2458781 Canada Inc.

20110251122 - Polynucleotide constructs, pharmaceutical compositions and methods for targeted downregulation of angiogenesis and anticancer therapy: A novel nucleic acid construct for down-regulating angiogenesis in a tissue of a subject is provided. The nucleic acid construct includes: (a) a first polynucleotide region encoding a chimeric polypeptide including a ligand binding domain fused to an effector domain of an apoptosis signaling molecule; and (b) a second polynucleotide... Agent: Vascular Biogenics Ltd.

20110251123 - Oral pharmaceutical composition of desmopressin: The present invention relates to a liquid oral pharmaceutical composition of desmopressin, and its use for the treatment of central diabetes insipidus, primary nocturnal enuresis, bleeding in patients with Hemophilia A, with von Willebrand-Jürgens disease and postoperative bleeding.... Agent: Gp Pharm, S.a. Laboratorio Reig Jofre, S.a.

20110251124 - Regulation of mineral and skeletal metabolism: A method is disclosed whereby levels of calcium, phosphate and parathyroid hormone are measured in a patient. The patient is treated with a formulation comprising a compound having phosphotonin activity and thereafter measurements are made again. Dosing of the formulation is adjusted based on measurements with measuring, administering and adjusting... Agent: Acologix, Inc.

20110251125 - Disodium salts, monohydrates, and ethanol solvates for delivering active agents: R5 is a substituted or unsubstituted C2-C16alkylene, substituted or unsubstituted C2-C16 alkenylene, substituted or unsubstituted C1-C12 alkyl(arylene), or substituted or unsubstituted aryl(C1-C12 alkylene). The hydrates and solvates of present invention also have surprisingly greater efficacy for delivering active agents, such as heparin and calcitonin, than their corresponding monosodium salts and... Agent: Emisphere Technologies, Inc.

20110251126 - Intestinal treatment: Y4 receptor agonists which are selective for the Y4 receptor over the Y1 and Y2 receptors, are useful in the prevention and/or treatment of damage to bowel function caused by radiation therapy, radiation exposure, cytotoxic chemotherapy, inflammation, or ischemia-reperfusion of intestinal mucosa.... Agent:

20110251127 - Inactivation of infectious agents in plasma proteins by extreme pressure: A method of inactivation of infectious agents in a fluid containing plasma protein and potentially containing at least one infection agent which includes unique steps of placing the fluid in a container which is resistant to leakage under high pressure, placing the container in a compression chamber, pressurizing the fluid... Agent:

20110251128 - Thymosin beta4 peptides promote tissue regeneration: The present invention relates to thymosin β-4 peptides and analogs thereof that can promote tissues regeneration, particularly cardiac tissue.... Agent: The Board Of Regents Of The University Of Texas System

20110251129 - Rheumatoid arthritis-preventive agent for oral intake: There is provided a rheumatoid arthritis inhibitor for oral intake that has an inhibitory effect on rheumatoid arthritis and is excellent in safety. The rheumatoid arthritis inhibitor for oral intake of the present invention contains, as an active component, a casein hydrolysate containing free amino acids and peptides obtained by... Agent: Calpis Co., Ltd.

20110251130 - Methods and compositions for promoting bone growth: The invention relates to methods and compositions for promoting bone growth, bone healing and/or bone formation. Disclosed herein are isolated truncated Wilms tumor on gene chromosome X (WTX) polypeptides and uses thereof. Also disclosed are methods of treating a bone related disease or condition in a subject by modulating the... Agent:

20110251131 - Deuterated 2-amino-3-hydroxypropanoic acid derivatives: This invention relates to novel 2-amino-3-hydroxypropanoic acid derivatives and pharmaceutically acceptable salts thereof. This invention also provides compositions comprising a compound of this invention and the use of such compositions in methods of treating diseases and conditions that are beneficially treated by administering an NMDA glycine-site antagonist.... Agent: Concert Pharmaceuticals Inc.

20110251132 - Treatment with a pharmaceutical composition comprising manf2 nucleic acid: A method for treating a condition in a patient, wherein the condition is selected from the group consisting of Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, stroke and peripheral neuropathy. The method consists of administering to the patient a pharmaceutically effective amount of a pharmaceutical composition comprising the MANF2 polypeptide... Agent:

20110251133 - Blockade of gamma-secretase activity to promote myelination by oligodendrocytes: Methods are provided for enhancing myelination. Myelination is enhanced by administration of agents that are inhibitors of γ-secretase. Methods of screening for pharmaceutically active compounds that enhance myelination, and for genes involved in myelination are also provided.... Agent: The Board Of Trustees Of The Leland Stanford Junior University

20110251134 - Combination of (a) a dna toposomerase inhibitor and (b) an iap inhibitor: The invention relates to a pharmaceutical combination which comprises (a) a DNA topoisomerase inhibitor compound and (b) a compound that inhibits the caspase-9 inhibiting properties of an inhibitor of apoptosis protein (IAP) for the treatment of a proliferative disease, especially a solid tumor disease; a pharmaceutical composition comprising such a... Agent:

20110251135 - Inhibitors of peritoneal seeding of cancer cells: Disclosed compositions and methods for inhibiting NF-κB mediated cellular proliferation and metastasis.... Agent: University Of Utah Research Foundation

20110251136 - Glue composition for lung volume reduction: The present invention relates to methods and compositions for sealing localized regions of damaged lung tissue to reduce overall lung volume. The glue compositions provide a glue featuring an adhering moiety coupled to one or more other moieties including, for example, a cross-linkable moiety and/or one other adhering moiety. The... Agent: Pneumrx, Inc.

20110251137 - Gamma-polyglutamic acid-based ocular irrigating solutions: Ophthalmic irrigating solutions are disclosed. The ophthalmic irrigating solution comprises: a) γ-polyglutamic acid (γ-PGA) and/or salt thereof in an amount effective to increase the viscosity of the irrigating solution; and b) an ophthalmically acceptable aqueous vehicle for the γ-PGA and/or salt thereof. Also disclosed is a method of irrigating ocular... Agent: National Health Research Institutes

20110251138 - Lipoic acid metabolite conjugate: preparation and their therapeutic effect: The present invention is a design and synthesis of a series of therapeutic conjugates which consists of tautomers of lipoic acid metabolites, with small molecule, vitamin, carbohydrates, peptides, chemotherapeutic agent wherein or not the conjugate possesses dual binding ability. The present invention can be used to therapeutics and diagnostics in... Agent:

20110251139 - Treatment of inflammatory bowel diseases with mammal beta defensins: The present invention relates to treatment of inflammatory bowel diseases with mammal beta defensins.... Agent: Novozymes A/s

20110251140 - Peptide antagonist of interleukin-15 activity: The present invention is related to the field of molecular immunology, particularly to a peptide derived from the sequence of interleukine-15 (IL-15), wherein said peptide was optimized to inhibit the biological activity of this molecule. In the present invention, it is shown that this peptide inhibits IL-15-induced T cell proliferation,... Agent:

20110251141 - Composition for topical treatment of mixed vaginal infections: A pharmaceutical composition comprises (a) an antibacterial agent in an antibacterially effective amount, illustratively comprising clindamycin or a pharmaceutically acceptable salt or ester thereof; and (b) an antifungal agent in an antifungally effective amount, illustratively comprising butoconazole or a pharmaceutically acceptable salt or ester thereof. The composition is adapted for... Agent: Drugtech Corporation

20110251142 - Use of triterpenic and anthraquinone glycosides as substances exerting hydragogue activity on mucosa of upper respiratory apparatus for the treatment of the effects resulting from the upper respiratory tract diseases: Use of triterpene and anthraquinone glycosides, as substances exerting hydragogue activity on mucosa of upper respiratory apparatus, for the treatment of the effects resulting from the upper respiratory tract diseases. The present invention concerns the use of triterpene and anthraquinone glycosides, as substances exerting hydragogue activity on mucosa of upper... Agent:

20110251144 - Molecular modulators of the wnt/beta-catenin pathway: The present invention is directed toward a method of treating a subject for a condition mediated by aberrant Wnt/β-catenin signaling by selecting a subject with a condition mediated by aberrant Wnt/β-catenin signaling and administering to the selected subject at least one compound selected from the group consisting of those set... Agent: University Of Washington

20110251145 - Phytoestrogenic compositions for preventing or treating symptoms associated with menopause: The present invention relates to a pharmaceutical composition for preventing or treating a menopausal symptom, comprising cinnamic acid, shanzhiside methylester or a mixture thereof as an active ingredient. The composition of the present invention exhibits an excellent estrogenic activity, and is effectively utilized for treating or preventing diverse menopausal symptoms... Agent: Natural Endotech Co., Ltd.

20110251143 - Stable elsamitrucin salt formulations: Formulations containing stable forms of elsamitrucin salts are provided. These formulations are useful for treating neoplastic diseases and conditions.... Agent: Spectrum Pharmaceuticals, Inc.

20110251147 - Compositions comprising quinolone and methods for treating or controlling infections: Compositions for treating or controlling infections comprise a fluoroquinolone having Formulae I-VIII and have a pH in the range from about 3.5 to about 5.5 or from about 10.5 to about 12. Methods for treating or controlling such infection use such compositions. Such compositions and methods can deliver a higher... Agent:

20110251146 - Topical antifungal composition: A topical, foamable composition is provided that includes at least one antifungal agent that is able to penetrate the upper layers of skin and is retained in or on an area to be treated for a prolonged period of time, and that has a residual non-volatile component content less than... Agent: Stiefel Research Australia Pty Ltd

20110251148 - Glycomimetic compounds and methods to inhibit infection by hiv: Compounds, compositions and methods are provided for use to inhibit infection by human immunodeficiency virus (HIV). More specifically, the present invention relates to glycomimetic compounds that inhibit HIV infection, and uses thereof.... Agent: Glycomimetics, Inc.

20110251149 - Methods and low dose regimens for treating red blood cell disorders: Disclosed herein are methods and low dose regimens for increasing fetal hemoglobin levels in patients with red blood cell disorders, such as beta thalassemia, sickle cell disease, other anemias, or blood loss. Fetal and total hemoglobin levels and red blood cell counts are increased by administering 2,2-dimethylbutyrate (DMB) alone or... Agent: Hemaquest Pharmaceuticals, Inc.

20110251150 - Targeting micrornas for the treatment of liver cancer: Provided herein are methods for the treatment of liver cancer. These methods encompass the administration of a compound comprising a modified oligonucleotide, wherein the modified oligonucleotide is targeted to a miRNA. Also provided herein are compositions for the treatment of liver cancer. Such compositions include compounds comprising a modified oligonucleotide,... Agent: Rosetta Genomics Ltd.

20110251262 - Compositions and methods for inhibiting expression of an rna from west nile virus: This invention relates to double-stranded ribonucleic acid (dsRNA), and its use in mediating RNA interference to inhibit the expression of an RNA from the West Nile virus (WNV), and the use of the dsRNA to treat pathological processes mediated by WNV infection, such as viral encephalitis.... Agent: Alnylam Pharmaceuticals, Inc.

20110251259 - Compositions and methods for inhibiting expression of cd274/pd-l1 gene: The invention relates to double-stranded ribonucleic acid (dsRNA) compositions targeting the CD274/PD-L1 gene, and methods of using such dsRNA compositions to inhibit expression of CD274/PD-L1.... Agent: Alnylam Pharmaceuticals, Inc.

20110251261 - Compositions and methods for inhibition of nucleic acids function: The invention relates generally to compositions and methods for inhibiting the function of target nucleic acids by sequence specific binding. The compositions and methods can be used for inhibition of micro RNAs and other relatively short non-coding RNAs.... Agent: Life Technologies Corporation

20110251255 - Methods and compositions for inhibiting the proliferation of cancer cells: A method of decreasing the expression of LIM kinase 1 in a cancer cell comprising; providing an oligonucleotide consisting of the sequence of SEQ ID NO: 1; providing a cancer cell comprising an mRNA encoding LIM kinase 1; and introducing the oligonucleotide into the cancer cell, wherein the oligonucleotide decreases... Agent:

20110251257 - Methods and compositions for treating neurological disease: This invention relates to methods and compositions for treating neurological disease, and more particularly to methods of delivering iRNA agents to neural cells for the treatment of neurological diseases.... Agent:

20110251260 - Novel sirnas and methods of use thereof: The invention relates to compounds, in particular siRNAs, which inhibit the expression of specific human genes. The invention also relates to pharmaceutical compositions comprising such compounds and a pharmaceutically acceptable carrier. The present invention also provides a method of treating and/or preventing the incidence or severity of various diseases or... Agent: Quark Pharmaceuticals Inc.

20110251258 - Rnai constructs and uses thereof: The invention relates to improved double-stranded RNAi constructs (sometimes referred to as “solo-rxRNA”) and uses thereof. The construct comprises a structure formed in some aspects of the invention by two identical single-stranded polynucleotides, with the structure having two double-stranded stem regions (each having less than 21 base pairs) and a... Agent: Rxi Pharmaceuticals Corporation

20110251263 - Rnai modulation of the bcr-abl fusion gene and uses thereof: The invention relates to compositions and methods for modulating the expression of Bcr-Abl, and more particularly to the down-regulation of Bcr-Abl mRNA and Bcr-Abl protein levels by oligonucleotides via RNA interference, e.g., chemically modified oligonucleotides.... Agent:

20110251256 - Use of trim72 as a target for muscle and heart enhancer: The present invention relates to a new use of TRIM72 as a target for muscle enhancer and heart enhancer, more particularly to a composition for enhancing muscle or heart comprising an expression or action inhibitor of TRIM72 protein. The present invention further relates to a new TRIM mutant protein inducing... Agent: Korea University Industrial & Academic Collaborative Foundation

20110251266 - Aptamer for ngf and use thereof: Provided are an aptamer having an inhibitory activity against NGF; a complex containing an aptamer having a binding activity or inhibitory activity against NGF and a functional substance (e.g., affinity substances, labeling substances, enzymes, drug delivery vehicles, drugs and the like); a medicament, a diagnostic agent, a labeling agent and... Agent: Ribomic Inc.

20110251267 - Methods of using polynucleotides encoding truncated glial cell line-derived neurotrophic factor: Disclosed are novel proteins, referred to as truncated glial cell line-derived neurotrophic factor (truncated GDNF) proteins, that promote dopamine uptake by dopaminergic cells and promote the survival of nerve cells. Also disclosed are processes for obtaining the truncated GDNF proteins by recombinant genetic engineering techniques.... Agent: Amgen Inc.

20110251265 - Polyamine-containing polymers and methods of synthesis and use: The present invention relates to polyamine-containing polymers and methods of their synthesis and use. The polymer may be hydroxyethylcellulose, dextran, poly(vinyl alcohol) or poly(methyl acrylate).... Agent: Alberta Innovates - Technology Futures

20110251264 - Transcription factor decoys: Methods and compositions for altering prokaryotic cellular viability phenotypes, including antibiotic susceptibility.... Agent:

20110251151 - Combination compositions for reducing intraocular pressure: Provided herein is a pharmaceutical composition or a kit comprising a combination of a non-selective beta-adrenergic receptor blocker and an adenosine A1 receptor agonist. Also provided herein is a method of reducing intraocular pressure (IOP) in a subject using such a combination or kit. In a particular embodiment, provided herein... Agent: Inotek Pharmaceuticals Corporation

20110251152 - Nucleoside phosphoramidates: Disclosed herein are nucleoside phosphoramidates and their use as agents for treating viral diseases. These compounds are inhibitors of RNA-dependent RNA viral replication and are useful as inhibitors of HCV NS5B polymerase, as inhibitors of HCV replication and for treatment of hepatitis C infection in mammals.... Agent: Pharmasset, Inc.

20110251153 - Prophylactic or therapeutic composition for hemoglobinuria or myoglobinuria: According to the present invention, the prophylactic or therapeutic composition for hemoglobinuria or myoglobinuria which comprises a branched-chain amino acid such as valine, leucine or isoleucine or a salt thereof, a basic amino acid such as ornithine, arginine, lysine, histidine or citrulline or a salt thereof and glutamine or a... Agent: Kyowa Hakko Bio. Co., Ltd.

20110251155 - Methods of using diacerein as an adjunctive therapy for diabetes: The present invention provides methods of treating type II diabetes using combinations of diacerein or its derivatives with other antidiabetic agents. The methods may also allow improving glycemic control of type II diabetes patients and/or reducing side effects and/or cardiovascular risks of antidiabetic agents.... Agent:

20110251154 - Sulfated polysaccharide compound and the preparation and use thereof: The present invention relates to a sulfated polysaccharide compound and the preparation and use thereof, and in particular to a narrow distribution low molecular weight, highly sulfated pentosan (in this instance a xylan) referred to as glucuronoxylan sulfate (GXS). The invention has been developed primarily for use in the treatment... Agent:

20110251156 - Vehicle for delivering a compound to a mucous membrane and related compositions, methods and systems: PSA is delivered to the host by outer membrane vesicles (OMVs), secretion structures that target bacterial molecules to host cells. Purified OMVs direct the in vitro differentiation of functional Tregs with potent suppressive activity in a PSA dependent manner. Treatment of animals with OMVs containing PSA prevents experimental colitis and... Agent:

20110251157 - Inhalant formulation containing sulfoalkyl ether cyclodextrin and corticosteroid: An inhalable formulation containing SAE-CD and corticosteroid is provided. The formulation is adapted for administration to a subject by nebulization with any known nebulizer. The formulation can be included in a kit. The formulation is administered as an aqueous solution, however, it can be stored as a dry powder, ready-to-use... Agent: Cydex Pharmaceuticals, Inc.

20110251158 - Fullerene therapies for inflammation and inhibition of build-up of arterial plaque: Described herein are methods for treating inflammatory disorders or for inhibiting the build-up of arterial plaque. The methods comprise administering to a subject in need thereof a therapeutically effective amount of a synthetically modified fullerene.... Agent: Luna Innovations Incorporated

20110251159 - Phosphoramidate alkylator prodrugs: Phosphoramidate alkylator prodrugs can be used to treat cancer when administered alone or in combination with one or more anti-neoplastic agents.... Agent: Threshold Pharmaceuticals, Inc.

20110251160 - Method for treating or preventing thrombosis using dabigatran etexilate or a salt thereof with improved efficacy over conventional warfarin therapy: A method for preventing stroke in a patient suffering from atrial fibrillation, wherein the patient has no risk factors for major bleeding events, the method comprising administering to the patient a dosage of >150 mg b.i.d. to 300 mg b.i.d. of dabigatran etexilate, optionally in the form of a pharmaceutically... Agent: Boehringer Ingelheim International Gmbh

20110251161 - Personal care composition: A personal care composition comprising a eutectic mixture, the eutectic mixture comprising an alkyl monoethanolamide having an alky chain length from 10 to 14.... Agent:

20110251162 - Methods of treatment for mrsa infections: The present subject matter relates to pathogenesis of MRSA. Specifically, the present disclosures identifies the pro-inflammatory properties of PVL as the cause of MRSA. Viewed from this new perspective, the present subject matter achieves novel methods and apparatus for treating MRSA infection in a subject involving the administration of an... Agent: Cedars-sinai Medical Center

20110251163 - Transdermal delivery: Dosing regimen for transdermal delivery of hormones comprising a variable treatment cycle and a variable rest interval.... Agent:

20110251164 - Carboxamide derivatives as muscarinic receptor antagonists: s

20110251165 - Derivatives of 4-(2-amino-1-hydroxyethyl)phenol as agonists of the beta2 adrenergic receptor: The present invention provides a compound of formula (I) wherein: R1 is a group selected from —CH2OH, —NHC(O)H and R2 is a hydrogen atom; or R1 together with R2 form the group —NH—C(O)—CH═CH— wherein the nitrogen atom is bound to the carbon atom in the phenyl ring holding R1 and... Agent: Almirall, S.a.

20110251166 - Derivatives of 4-(2-amino-1-hydroxyethyl)phenol as agonists of the beta2 adrenergic receptor: The present invention provides a compound of formula (I) wherein: R1 is a group selected from —CH2OH, —NHC(O)H and R7 is a hydrogen atom; or R1 together with R2 form the group —NH—C(O)—CH═CH— wherein the nitrogen atom is bound to the carbon atom in the phenyl ring holding R1 and... Agent:

20110251167 - Oral testosterone ester formulations and methods of treating testosterone deficiency comprising same: A pharmaceutical formulation of testosterone undecanoate is provided. Methods of treating a testosterone deficiency or its symptoms with the inventive formulations are also provided.... Agent: Clarus Therapeutics, Inc.

20110251169 - Arylethynyl derivatives: R1, R2, R2′, R3, R3′, R4, R4′, U, V, W, Y, m, and n are as defined herein and to a pharmaceutically acceptable acid addition salts, to a racemic mixtures, or to its corresponding enantiomers and/or optical isomers and/or stereoisomers thereof. Compounds of formula I are allosteric modulators of the... Agent:

20110251171 - Heterocyclic compounds and methods of use: provide pharmacological agents which are potent agonists of Peroxisome Proliferator-Activated Receptors (PPARs). Accordingly, the compounds of the instant invention are useful for the treatment of conditions mediated by the PPAR receptor activity in mammals. Such conditions include dyslipidemia, hyperlipidemia, hypercholesteremia, atherosclerosis, hypertriglyceridemia, heart failure, myocardial infarction, vascular diseases, cardiovascular diseases,... Agent:

20110251170 - New polymorphic form of 1-(4--2-ethyl-benzyl)-azetidine-3-carboxylic: This invention relates to a novel crystalline form (Form A) of 1-(4-{1-[(E)-4-cyclohexyl-3-trifluoromethyl-benzyloxyimino]-ethyl}-2-ethyl-benzyl)-azetidine-3-carboxylic acid (Compound I), to pharmaceutical compositions comprising this crystalline form, to processes for forming it and to its use in medical treatment.... Agent:

20110251174 - 2,4-diamino-pyrimidines as aurora inhibitors: i

20110251173 - Chemical compounds:

20110251172 - Purine derivatives for treatment of alzheimer's disease: The invention encompasses purine derivatives as gamma secretase modulators, useful for treating diseases associated with the deposition of beta-amyloid peptide in the brain, such as Alzheimer's disease, or of preventing or delaying the onset of dementia associated with such diseases. Pharmaceutical compositions and methods of use are included.... Agent:

20110251168 - 3-aminopyrrolidine derivatives as modulators of chemokine receptors: (wherein R1, R2, R3, R4, R5, R6, R7, R8, X, Y and X are as defined herein) which are useful as modulators of chemokine receptor activity. In particular, these compounds are useful as modulators of chemokine receptors and more specifically as a modulator of the CCR2 and/or CCR5 receptor. The... Agent:

20110251175 - Stigmine conjugates for substance use disorders: The invention relates to methods for the treatment or prevention of substance use disorders.... Agent:

20110251177 - 2, 4-pyrimidinediamine compounds and prodrugs thereof and their uses: e

20110251176 - Pyrazol-4-yl-heterocyclyl-carboxamide compounds and methods of use: Pyrazol-4-yl-heterocyclyl-carboxamide compounds of Formula I, including stereoisomers, geometric isomers, tautomers, and pharmaceutically acceptable salts thereof, wherein X is a thiazolyl, picolinyl, pyridinyl, or pyrimidinyl, are useful for inhibiting Pim kinase, and for treating disorders such as cancer mediated by Pim kinase. Methods of using compounds of Formula I for in... Agent:

20110251178 - Bicyclic pyridinylpyrazoles: r

20110251179 - 3,4-dihydro-2h-pyrrolo[1,2-a]pyrazin-1-one derivatives: Compounds which are 4,7-disubstituted derivatives of 3,4-dihydro-2H-pyrrolo[1,2-a]pyrazin-1-one compounds, or pharmaceutically acceptable salts thereof, their preparation process and pharmaceutical compositions comprising them are disclosed; these compounds are useful in the treatment of diseases caused by and/or associated with an altered protein kinase activity such as cancer, viral infection, prevention of AIDS... Agent: Nerviano Medical Sciences S.r.l

20110251180 - Pharmaceutical agent comprising quinolone compound: m

20110251181 - 5h-cyclopenta[d]pyrimidines as akt protein kinase inhibitors: Compounds of Formula I are useful for inhibiting AKT protein kinases. Methods using compounds of Formula I and stereoisomers and pharmaceutically acceptable salts thereof, for in vitro, in situ, and in vivo diagnosis, prevention or treatment of such disorders in mammalian cells, or associated pathological conditions are disclosed. Formula (I).... Agent: Array Bopharma Inc.

20110251182 - Agents and methods for treating ischemic and other diseases: This invention relates to methods of screening for modulators of mammalian cell injury cause by TRPM7 gene and protein activity, compounds that modulate TRPM7 gene and protein activity and methods of treatment of mammalian cell injury using modulators of TRPM7 gene and protein activity.... Agent: Nono, Inc.

20110251183 - Aryl-/heteroaryl-cyclohexenyl-tetraazabenzo[e]azulenes: wherein R1, R2 and R3 are as described herein. The invention further provides methods for the manufacture of such compounds and pharmaceutical compositions containing them. The compounds according to the invention act as V1 a receptor modulators, and in particular as V1 a receptor antagonists, their manufacture, pharmaceutical compositions containing... Agent:

20110251184 - Substituted hydroxamic acids and uses thereof: wherein X1, X2, R1a, R1b, R1c, R1d, n, and G have values as described in the specification, useful as inhibitors of HDAC6. The invention also provides pharmaceutical compositions comprising the compounds of the invention and methods of using the compositions in the treatment of proliferative, inflammatory, infectious, neurological or cardiovascular... Agent: Millennium Pharmaceuticals, Inc.

20110251185 - Benzoxazines and related nitrogen-containing heterobicyclic compounds useful as mineralocorticoid receptor modulating agents: wherein Ring A is a benzene ring optionally having a substituent(s) other than R1 etc, R1 is a group of the formula: RaSO2NH— etc, Ra is an alkyl group etc, R2 and R3 are each a hydrogen atom, a phenyl group, an optionally substituted alkyl group etc, X is an... Agent:

20110251186 - Amino-oxazines and amino-dihydrothiazine compounds as beta-secretase modulators and methods of use: wherein A1, A2, A3, A4, A5, A6, R2, R7, X, Y and Z of Formula I are defined herein. The invention also includes use of these compounds in pharmaceutical compositions for treatment, prophylactic or therapeutic, of disorders and conditions related to the activity of beta-secretase protein. Such disorders include, for... Agent: Amgen Inc.

20110251187 - Heterocyclic compound: e

20110251188 - Acenaphtho heterocycle compounds, cyclodextrin inclusion compounds and complexes, and uses in the manufactures of bh3 protein analogue, bcl-2 family protein inhibitors thereof: The present invention relates to acenaphtho heterocyclic compounds, cyclodextrin inclusion compounds and complexes thereof, and their uses in manufacturing the inhibitors of BH3 analogue, Bcl-2 family proteins. The acenaphtho heterocyclic compounds are obtained by introducing oxo-, thio-, carbonyl, ester or acyl in the 3-, 4- and 6-position of 8-oxo-8H-acenaphtho[1,2-b]pyrrole-9-carbonitrile, or... Agent: Dalian University Of Technology

20110251189 - Hypoxia targeted compounds for cancer diagnosis and therapy: The present invention generally relates to oxazine derivative compounds and related compositions and methods for inducing hypoxic tumor cell death, treating cancer and locating a hypoxic tumor in a subject.... Agent:

20110251190 - Spiro-tetracyclic ring compounds as beta-secretase modulators and methods of use: wherein A1, A2, A3, A4, A5, A6, R2, R7, X and Y of Formula I are defined herein. The invention also includes use of these compounds in pharmaceutical compositions for treatment, prophylactic or therapeutic, of disorders and conditions related to the activity of beta-secretase protein. Such disorders include, for example,... Agent: Amgen Inc.

20110251192 - Amide compounds, their pharmaceutical compositions, their preparation method and their uses: The present invention pertains to the field of pharmaceutical chemistry and discloses 8-(3-aminopropyl)-3-exo-8-azabicyclo[3.2.1]octane-3-amino amide compounds represented by formula I, the pharmaceutical compositions, the preparation method and the use thereof. Such compounds or pharmaceutically acceptable salts thereof can be used as an antagonist of CCR5 in preparing medicaments for treating diseases... Agent: Shanghai Institute Of Materia Medica, Chinese Academy Of Sciences

20110251191 - Use of substituted 2, 3-dihydroimidazo[1,2-c]quinazolines for the treatment of myeloma: The present invention relates to the use of 2,3-dihydroimidazo[1,2-c]quinazoline compounds, and of pharmaceutical compositions containing such compounds, for the treatment or prophylaxis of multiple myeloma, as a sole agent or in combination with other one or more other active ingredients.... Agent: Bayer Schering Pharma Aktiengesellschaft

20110251193 - 1,2-benzisothiazolinone and isoindolinone derivatives: Novel classes of 1,2-benzisothiazolinone and isoindolinone compounds and compositions are disclosed. These compounds and compositions are useful in treating, preventing, and/or ameliorating viral, yeast, and fungal infections such as, for example, Hepatitis C Virus, Flavivirus infections, Aspergillus fumigatus, and candidiasis.... Agent: Georgetown University

20110251194 - Antineoplastic derivatives, preparation thereof and therapeutic use thereof: The disclosure concerns heterobicyclic compounds of general formula (I) and acid addition salts, hydrates and solvates thereof, as well as enantiomers, diastereoisomers and mixtures thereof. Methods for preparing the compounds, pharmaceutical compositions, and methods of treatment also are disclosed.... Agent: Sanofi-aventis

20110251195 - Adrb2 gene polymorphism associated with intraocular pressure response to topical beta-blockers: The invention provides a single nucleotide polymorphism (SNP) rs1042714 in the human ADRB2 gene (Gln27Glu) associated with a clinically meaningful reduction in intraocular pressure (IOP) in a human following treatment with a topical beta-blocker. Nucleic acids comprising the SNP are used to screen glaucoma-afflicted individuals to thereby provide an improved... Agent: Marshfield Clinic

20110251196 - Modulators of g protein-coupled receptor 88: The present disclosure is generally directed to compounds which can modulate G-protein coupled receptor 88, compositions comprising such compounds, and methods for modulating G-protein coupled receptor 88.... Agent: Bristol-myers Squibb Company And Lexicon Pharmaceuticals, Inc.

20110251197 - Lysosomotropic inhibitors of acid ceramidase: The presently disclosed subject matter provides compounds of the formula, formula (Ia): and pharmaceutically acceptable salts thereof, wherein R1, R2, R3, R4, R5, X, Y, and n are as defined herein. Also disclosed are methods for making the compounds of the formula as set forth hereinabove, their use in inhibiting... Agent:

20110251198 - Methods for producing viloxazine salts and novel polymorphs thereof: Provided here are methods of manufacture of viloxazine and its various salts, as well as viloxazine-related compounds, such as novel intermediate reaction products and polymorphs thereof. In particular, the methods provide a substantially pure API of viloxazine HCl while avoiding undesirable impurities. The methods further provide for separating, identifying, and... Agent: Supernus Pharmaceuticals Inc.

20110251199 - Nitrogen-containing bicyclic heteroaryl compounds and methods of use: o

20110251202 - 1,3-dihydro-imidazo[4,5-c]quinolin-2-ones as lipid kinase inhibitors: processes for the preparation thereof, the application thereof in a process for the treatment of the human or animal body, the use thereof—alone or in combination with one or more other pharmaceutically active compounds—for the treatment of an inflammatory or obstructive airway disease, such as asthma, disorders commonly occurring in... Agent: Novartis Ag

20110251200 - Aryl guanidine f1f0-atpase inhibitors and related methods: The invention provides to a family of aryl guanidine-based F1F0-ATPase inhibitors, e.g., mitochondrial F1F0-ATPase inhibitors, methods for their discovery, and their use as therapeutic agents for treating certain disorders.... Agent: The Regents Of The University Of Michigan

20110251201 - Sustained release intraocular implants and methods for preventing retinal dysfunction: Biocompatible intraocular implants include an alpha-2 adrenergic receptor agonist and a polymer associated with the alpha-2 adrenergic receptor agonist to facilitate release of the alpha-2 adrenergic receptor agonist into an eye for an extended period of time. The alpha-2 adrenergic receptor agonist may be associated with a biodegradable polymer matrix,... Agent: Allergan, Inc.

20110251203 - Use of pkc inhibitors in diabetic complications: The present invention pertains “to the use of a PKC inhibitor in the manufacture of a medicament in the treatment or prevention of diabetic complications, where in the PKC inhibitor is one of 3-(1.H.-indol-3-yl)-4-[2-(4-methyl-piperazin-1-yl)-quinazolin-4-yl]-pyrrole-2,5-dione, 3-(1.H.-indol-3-yl)-4-[2-(piperazin-1-yl)-quinazolin-4-yl]-pyrrole-2,5-dione, 3-[3-(4,7-Diaza-spiro [2.5]oct-7-yl)-isoquinolin-1-yl]-4-(7-methyl-1H-indol-3-yl)-pyrrole-2,5-dione or a pharmaceutically acceptable salt thereof.... Agent:

20110251207 - Biaryl-spiroaminooxazoline analogues as alpha 2c adrenergic receptor modulators: In its many embodiments, the present invention provides a novel class of biaryi spiroaminooxazoline analogues as modulators of α2C adrenergic receptor agonists, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment,... Agent: Merck Sharp & Dohme Corp.

20110251208 - Phosphodiesterase type iii (pde iii) inhibitors or ca2+-sensitizing agents for the treatment of hypertrophic cardiomyopathy: The present invention relates to a phosphodiesterase type III (PDE III) inhibitor and/or Ca2+- sensitizing agent or a pharmaceutically acceptable derivative thereof for the treatment of a patient suffering from hypertrophic cardiomyopathy (HCM). According to another aspect the present invention relates to the use of a PDE III inhibitor and/or... Agent: Boehringer Ingelheim Vetmedica Gmbh

20110251204 - Modulators of g protein-coupled receptor 88: The present disclosure is generally directed to compounds which can modulate G-protein coupled receptor 88, compositions comprising such compounds, and methods for modulating G-protein coupled receptor 88.... Agent: Bristol-myers Squibb Company And Lexicon Pharmaceuticals, Inc.

20110251205 - Squaramide derivatives as cxcr2 antagonist: e

20110251206 - Squaramide derivatives as cxcr2 antagonist:

20110251209 - Compounds for treating parasitic disease:

20110251210 - Modified chloroquines with single ring moiety or fused ring moiety: The disclosure provides modified chloroquine compounds having single ring or fused ring moieties. Also provided are pharmaceutical compositions comprising such compounds, methods of using such compounds to inhibit or treat diseases or conditions caused by chloroquine-resistant (CQR) and chloroquine-sensitive (CqS) malaria parasites and other CQ-susceptible microorganisms, and processes and intermediates... Agent: Designmedix, Inc.

20110251211 - Methods of using substituted isoxazolo pyridinones as dissociated glucocorticoids: A method for treating a subject having an inflammatory or auto-immune disease with a substituted isoxazolo pyridinone. Also, a method for administering a substituted isoxazolo pyridinone to a cell to retain or increase glucocorticoid receptor transrepression activity with only minimal glucocorticoid receptor transactivation activity.... Agent:

20110251212 - Piperazine derivatives: m

20110251213 - Cosmetic use of 1-aroyl-n-(2-oxo-3-piperidinyl)-2-piperazine carbomamides and related compounds: Cosmetic compositions comprising 1-aroyl-N-(2-oxo-3-piperidinyl)-2-piperazine carboxamides and methods of using such compositions to impart anti-aging benefits to the skin are disclosed. The 1-aroyl-N-(2-oxo-3-piperidinyl)-2-piperazine carboxamides are believed to have modulatory activity against one or more biochemical pathways implicated in skin aging.... Agent: Avon Products, Inc.

20110251214 - Monohydrate of pardoprunox: This invention also relates to the monohydrate of said compound, as well as to pharmaceutical compositions containing these compounds, to methods for preparing these compounds, to methods for preparing intermediates useful for their synthesis, and to methods for preparing compositions containing these compounds. Embodiments of the invention also relate to... Agent:

20110251215 - Macrocyclic compounds and their use as kinase inhibitors: i

20110251216 - Compositions and methods for inhibiting ezh2: The present invention relates to therapeutic targets for cancer. In particular, the present invention relates to small molecules and nucleic acids that target EZH2 expression in cancer (e.g., prostate cancer, breast cancer, other solid tumors, multiple myeloma).... Agent: The Regents Of The University Of Michigan

20110251217 - Substituted purinyl-pyrazol derivatives and their use as potassium channel modulators: This invention relates to novel substituted purinyl-pyrazol derivatives of formula (I) and their use as potassium channel modulating agents. Moreover the invention is directed to pharmaceutical compositions useful for the treatment or alleviation of diseases or disorders associated with the activity of potassium channels.... Agent: Neurosearch A/s

20110251218 - Novel compounds: i

20110251219 - Treatment for glomerulonephritis with 2-[4-(7-ethyl-5h-pyrrolo[2,3-b]pyrazin-6-yl)phenyl]propan-2-ol: A treatment for glomerulonephritis, and other renal dysfunctions using a compound of Formula I is disclosed.... Agent: Sanofi

20110251220 - Pharmaceutical compositions comprising gamma secretase modulators: The present invention relates to pharmaceutical compositions comprising gamma secretase modulators as well as to the use of gamma secretase modulators for treating renal disorders, cancer, neurodegenerative disorders as well as related disorders.... Agent:

20110251221 - Pyrimidinylpiperidinyloxypyridinone analogues as gpr119 modulators: or an enantiomer, a diastereomer, or a pharmaceutically acceptable salt thereof, wherein n1, R1, R2, R3 and R4 are defined herein, are provided which are GPR119 G protein-coupled receptor modulators. GPR119 G protein-coupled receptor modulators are useful in treating, preventing, or slowing the progression of diseases requiring GPR119 G protein-coupled... Agent: Bristol-myers Squibb Company

20110251222 - Sulfone-substituted anilinopyrimidine derivatives as cdk inhibitors, the production thereof, and use as a medicine:

20110251223 - Cgrp receptor antagonists: The disclosure generally relates to the novel compounds of formula I, including pharmaceutically acceptable salts, which are CGRP receptor antagonists. The disclosure also relates to pharmaceutical compositions and methods for using the compounds in the treatment of CGRP related disorders including migraine and other headaches, neurogenic vasodilation, neurogenic inflammation, thermal... Agent: Bristol-myers Squibb Company

20110251226 - Cyclohexylamin isoquinolone derivatives: e

20110251224 - Spiro-oxindole compounds and their uses as therapeutic agents: wherein k, j, Q, R1, R2a, R2b, R2c, R2d, R3a, R3b, R3c, and R3d are as defined herein, as a stereoisomer, enantiomer, tautomer thereof or mixtures thereof; or a pharmaceutically acceptable salt, solvate or prodrug thereof, which are useful for the treatment and/or prevention of sodium channel-mediated diseases or conditions,... Agent:

20110251225 - Substituted tetrahydropyran spiro pyrrolidinone and piperidinone, preparation and therapeutic use thereof: wherein R1, R2, m, n and p are as described herein. More specifically, the compounds of this invention are modulators of H3 receptors and are, therefore, useful as pharmaceutical agents, especially in the treatment and/or prevention of a variety of diseases modulated by H3 receptors including diseases associated with the... Agent: Sanofi

20110251227 - Analgesic agents: The invention provides a compound of formula (I) or a salt thereof, as well as compositions comprising such compounds. The compounds and compositions are useful as analgesics.... Agent: Regents Of The University Of Minnesota

20110251228 - Nalmefene hydrochloride dihydrate: The present invention relates to the Nalmefene hydrochloride dihydrate, methods of manufacturing Nalmefene hydrochloride dihydrate, a pharmaceutical composition comprising Nalmefene hydrochloride dihydrate and a method of treatment comprising administering Nalmefene hydrochloride dehydrate.... Agent: H. Lundbeck A/s

20110251229 - (+)-opioids and methods of use: The invention provides 4,5-epoxymorphinan or a derivative thereof, a morphinan or a derivative thereof, or a pharmaceutical salt or a prodrug thereof. The present invention also provides compositions comprising the same, and methods for using the same. In particular, the invention relates to TLR antagonistic opioids and methods for using... Agent: The Regents Of The University Of Colorado

20110251230 - Therapeutics for neurological disorders: The present invention relates to therapeutic compounds that are Nrf2-ARE pathway activators suitable for the treatment of diseases known to be mediated by oxidative stress such as motor neurone disease. The invention also includes compounds identified by methods of the invention for treatment of neurogenerative diseases.... Agent: University Of Sheffield

20110251231 - Modified release compositions comprising tacrolimus: A modified release composition comprising tacrolimus releases less than 20% w/w of the active ingredient within 0.5 hours when subjected to an in vitro dissolution test using USP Paddle method and using 0.1 N HCl as dissolution medium and has increased bioavailability by effectively reducing or even avoiding the effects... Agent: Lifecycle Pharma A/s

20110251232 - Modified release compositions comprising tacrolimus: A modified release composition comprising tacrolimus releases less than 20% w/w of the active ingredient within 0.5 hours when subjected to an in vitro dissolution test using USP Paddle method and using 0.1 N HCl as dissolution medium and has increased bioavailability by effectively reducing or even avoiding the effects... Agent: Lifecycle Pharma A/s

20110251233 - Formulation for the buccal transmucosal administration of setrons: The invention provides a formulation for transmucosal administration of at least one active ingredient from the setron family, the formulation comprising said active ingredient in base form and/or in salt form, a hydroalcoholic solution titrating at least 30° alcohol, and optionally a pH correcting agent, said active principle being present... Agent:

20110251234 - Mesylate salt of 5-(2--1-hydroxyethyl)-8-hydroxyquinolin-2(1h)-one as agonist of the beta2 adrenergic receptor: The present disclosure relates to a mesylate salt of 5-(2-{[6-(2,2-difluoro-2-phenylethoxy)hexyl]amino}-1-hydroxyethyl)-8-hydroxyquinolin-2(1H)-one as well as pharmaceutical compositions comprising them, and their use in therapy as agonists of the β2 receptor.... Agent:

20110251235 - Stable laquinimod preparations: The invention relates to a pharmaceutical composition comprising a pharmaceutically acceptable salt of N-ethyl-N-phenyl-1,2,-dihydro-4-hydroxy-5-chloro-1-methyl-2-oxoquinoline-3-carboxamide, N-methylglucamine, and a pharmaceutically acceptable carrier.... Agent: Teva Pharmaceutical Industries, Ltd.

20110251237 - 2,5-disubstituted piperidine orexin receptor antagonists: The present invention is directed to 2,5-disubstituted piperidine amide compounds which are antagonists of orexin receptors, and which are useful in the treatment or prevention of neurological and psychiatric disorders and diseases in which orexin receptors are involved. The invention is also directed to pharmaceutical compositions comprising these compounds and... Agent: Merck Sharp & Dohme Crop.

20110251236 - Galactokinase inhibitors: Therapeutic agents for treatment of Galactosemia and disorders thereof, and other enzyme related disorders thereof are identified. The compounds inhibit galactokinase (GALK) and other kinase activity and are identified by a high throughput screening assay.... Agent: University Of Miami

20110251238 - Ppar agonist compositions and methods of use: Method for treating or preventing a PPAR-responsive condition in a subject, comprising administering to the subject a PPAR agonist that comprises a 8-hydroxyquinoline-methylene-N- group in an amount effective to activate a PPAR polypeptide.... Agent: Biopharmed

20110251239 - Combination therapy for the treatment of dementia: Provided herein is a combination therapy useful for the treatment of Alzheimer's disease and Alzheimer's disease related dementia. The combination comprises memantine in an immediate or sustained release form and donepezil in a sustained release form.... Agent: Eisai Inc.

20110251240 - Dosing regimen of flavopiridol for treating cancer: A dosing regimen comprising a therapeutically effective amount of flavopiridol or a pharmaceutically acceptable salt thereof optionally in combination with a pharmaceutically acceptable carrier suitable for bolus infusion and subsequently for infusion is disclosed and claimed. Also disclosed and claimed is a method of treating a variety of cancers in... Agent: Aventis Pharmaceuticals Inc.

20110251241 - Grease-like gel for repelling rodents: Grease-like compositions are provided for repelling rodents. The compositions utilize nontoxic mineral, synthetic, or vegetable oil based gels containing silica, clay, urea, polytetrafluoroethylene, or metallic soap thickeners and capsaicin.... Agent: Pignx, Inc.

20110251242 - Photostabilization of resveratrol with alkoxycrylene compounds: wherein one of R1 and R2 is a straight or branched chain C1-C30 alkoxy radical, preferably C1-C8, more preferably methoxy, and the non-alkoxy radical R1 or R2 is hydrogen; and R3 is a straight or branched chain C1-C30 alkyl radical, preferably C2-C20. The alkoxycrylene compounds of formula (I) significantly increase... Agent: Hallstar Innovations Corp.

20110251243 - Method and kit for assessing a patient's genetic information, lifestyle and environment conditions, and providing a tailored therapeutic regime: A method of determining a personalised therapeutic regime, comprising: receiving genetic information relating to a patient; determining genetic criteria relevant to a personalised therapeutic regime for the patient using the genetic information; receiving personal information relating to the patient; determining personal criteria relevant to the personalised therapeutic regime using the... Agent:

20110251244 - Oral dosage form containing a pde 4 inhibitor as an active ingredient and polyvinylpyrrolidone as excipient: Dosage forms for oral administration of a PDE 4 inhibitor whose solubility is slight are described. They contain PVP as binder.... Agent: Nycomed Gmbh

20110251245 - Solid pharmaceutical composition comprising amlodipine and losartan: The present invention relates to a solid pharmaceutical composition for preventing or treating cardiovascular disorders comprising amlodipine and losartan as active ingredients, and a disintegrant which is a mixture of at least two components selected from the group consisting of sodium starch glycolate, crosscarmellose sodium, and crosspovidone, which exhibits a... Agent: Hanmi Holdings Co., Ltd.

20110251246 - Small molecule inhibitors of muc1 and methods of identifying the same: The invention provides methods for the identification of small molecules that inhibit MUC1 oligomerization, and the functions flowing therefrom. In addition, small molecules that prevent MUC1 oligomerization are disclosed. Identified molecules will find use in treating a variety of MUC1-related inflammatory conditions, including MUC1-related cancers.... Agent:

20110251247 - Substituted isoxazoline derivatives: e

20110251248 - Glucagon receptor antagonist compounds: Glucagon receptor antagonist compounds are disclosed. The compounds are useful for treating type 2 diabetes and related conditions. Pharmaceutical compositions and methods of treatment are also included.... Agent:

20110251249 - Dual-acting antihypertensive agents: wherein: Q, W, Y, Z, r, and Ar are as defined in the specification, and pharmaceutically acceptable salts thereof. These compounds have AT1 receptor antagonist activity and neprilysin inhibition activity. The invention is also directed to pharmaceutical compositions comprising such compounds; methods of using such compounds; and process and intermediates... Agent: Theravance, Inc.

20110251250 - Use of dimiracetam in the treatment of chronic pain: The use of dimiracetam in the treatment of chronic pain is disclosed. At doses higher than those previously disclosed in relation with its cognition enhancing activity (i.e. amelioration of learning and memory), dimiracetam was able to completely revert hyperalgesia or allodynia associated with several animal models of chronic pain. Dimiracetam... Agent:

20110251251 - Polymorph ii of an antifungal compound: The invention relates to a crystalline polymorph of a pharmaceutically acceptable salt of an optically active anti-fungal imidazole compound of formula (III), the pharmaceutical and agricultural compositions containing such polymorph, its use in the treatment or prevention of skin or mucous membrane infections caused by fungi or yeasts in humans... Agent: Ferrer Internacional, S.a

20110251252 - Biomarkers for mdm2 inhibitors for use in treating disease: Provided herein are methods for selecting and treating a subject with leukemia, wherein the subject is selected for treatment and is treated with an MDM2 inhibitor because said subject's cells contain an FLT3-ITD mutation.... Agent: The Regents Of The University Of Michigan

20110251253 - Solid forms of (r)-1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl)-n-(1-(2,3-dihydroxypropyl)-6-fluoro-2-(1-hydroxy-2-methylpropan-2-yl)-1h-indol-5-yl) cyclopropanecarboxamide: The present invention relates to solid forms of (R)-1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl)-N-(1-(2,3-dihydroxypropyl)-6-fluoro-2-(1-hydroxy-2-methylpropan-2-yl)-1H-indol-5-yl)cyclopropanecarboxamide (Compound 1) in substantially crystalline form (Form A) or amorphous form, pharmaceutical compositions thereof, and methods of treatment therewith.... Agent: Vertex Pharmaceuticals Incorporated

20110251254 - Novel salt of tegaserod: The present invention relates to a novel salt of tegaserod, namely tegaserod suberate, and to processes for the preparation thereof. The invention also relates to crystalline forms of the novel salt and to pharmaceutical compositions comprising the novel salt. Further, the invention relates to uses of said compositions in treating... Agent: Generics [uk] Limited

20110251268 - Antioxidant-containing food composition for use in inhibiting histamine pathways in companion animals: The invention encompasses methods for inhibiting histamine release pathways in a companion animal, for example, felines and in treating or preventing idiopathic cystitis or interstitial cystitis. The compositions and methods of the invention include an amount of lipoic acid that is effective in inhibiting histamine release pathways in a companion... Agent: Hill's Pet Nutrition, Inc.

20110251269 - Preparation method of polymeric micelles composition containing a poorly water-soluble drug: Provided is a method for preparing a drug-containing polymeric micelle composition, which includes: dissolving a drug and an amphiphilic block copolymer into an organic solvent; and adding an aqueous solution to the resultant mixture in the organic solvent to form polymeric micelles, wherein the method requires no separate operation to... Agent: Samyang Corporation

20110251270 - Compounds and methods for repelling blood-feeding arthropods and deterring their landing and feeding: This invention relates to a group of compounds for repelling blood-feeding ectoparasitic arthropods, and a method of deterring their landing and feeding on animals including humans, by applying in one or more formulations compounds that incorporate one or more sulfide and one or more hydroxyl groups to the skin, clothing... Agent:

20110251271 - Cosmetic composition with anti-free radical activity: Cosmetic compositions with anti-free radical activity have been developed. Such compositions preferably contain an association of at least the following three substances with anti-free radical activity: idebenone; N-acetylcysteine, and alpha-tocotrienol or an ester thereof with a C2-C4 organic acid.... Agent: Lvmh Recherche

20110251272 - Methods and compositions for predicting drug responses: The present invention relates to methods and compositions for predicting drug responses. In particular, the present invention provides methods and compositions for determining individualized Warfarin dosages based on genotype of DNA polymorphisms and haplotypes derived from them in the VKORC1 gene.... Agent: University Of Washington

20110251273 - composition and method of treating skin conditions: This invention relates to compositions containing a retinoid and use of the compositions for treating skin conditions.... Agent:

20110251274 - Natural vitamin e compositions with superior antioxidant potency: Compositions for increased antioxidant potency of natural vitamin E (d-alpha-tocopherol), comprising alpha-, beta-, delta-, and gamma-forms of tocopherols and tocotrienols are disclosed. All of these compositions provide 400 International Units (IU), based on one mg of d-alpha-tocopherol provides 1.49 IU. These compositions showed antioxidant activities superior to natural d-alpha-tocopherol. These... Agent: Soft Gel Technologies, Inc.

20110251275 - Omega-3 fatty acids for reduction of lp-pla2 levels: Methods are provided for utilizing omega-3 fatty acids, or a combination of a dyslipidemic agent and omega-3 fatty acids, for the reduction of lipoprotein-associated phospholipase A2 (Lp-PLA2) levels. The methods are especially useful in the treatment of patients with primary hypercholesterolemia or hypertriglyceridemia or mixed dyslipidemia, coronary heart disease (CHD),... Agent:

20110251276 - Biological oil composition, formulations comprising the oil composition, and use thereof to prevent or treat cardiovascular disease: This invention relates to a biological oil composition, preferably obtained from a copepod, most preferably the copepod Calanus finmarchicus and the use thereof to prevent or treat formation of atherosclerotic plaques and hence development of coronary heart disease. The composition comprises the same marine n-3 polyunsaturated fatty acids (PUFAs) generally... Agent: Calanus As

20110251277 - Foamed cleanser with suspended particles: One aspect of the invention is a new foam which includes a liquid having a plurality of bubbles therein and a plurality of particles suspended therein. The foam is made in a dispenser that suspends the bubbles in the liquid. The liquid may be a single liquid with particles therein... Agent: DebIPLimited

20110251278 - Microalgae extract containing omega 3-polyunsaturated fatty acids and method for extracting oil from micro-organisms: The present invention relates to a biphasic microalgae extract comprising 15-95 wt. % of an aqueous phase and 5-85 wt. % of an oil phase, said extract containing at least 1% by weight of total fatty acids of ω3-fatty acids selected from the group consisting of eicosapentaenoic acid (EPA), docosahexaenoic... Agent: Feyecon B.v.

20110251279 - Composition of amino acids for sublingual applying for enhanced skin integument repigmentation in vitiligo and method of its administration: e

20110251281 - Composite material comprising high-molecular-weight matrix and low-molecular-weight organic compound and process for producing same: Previously reported composite materials comprising a hydrophilic high-molecular-weight matrix and a low-molecular-weight organic compound involve a problem in that: it is difficult to compound a high load of the low-molecular-weight organic compound in the high-molecular-weight matrix; and thus produced composite material yields a high-molecular-weight matrix component that can form a... Agent: National Institute For Materials Science

20110251280 - Stable aqueous compositions comprising amide-protected bioactive creatine species and uses thereof: The present invention provides amide-protected creatine molecules and compositions, containing one or more bioactive forms of creatine in aqueous compositions, wherein bioactive forms of creatine do not appreciably degrade into creatinine. Also provided are various beneficial effects of administering aqueous compositions having at least one amide-protected creatine molecule.... Agent:

20110251282 - Liquid compositions of calcium acetate: The invention relates to an aqueous liquid composition of calcium acetate, sweetener, and taste masking agent. Also provided is a method for binding phosphorus within the gastrointestinal tract of an individual by administering to the individual an aqueous solution of at least calcium acetate.... Agent: Lyne Laboratories

20110251283 - 1-amino-alkylcyclohexane derivatives for the treatment of mast cell mediated diseases: The present invention relates to the treatment of an individual afflicted with mast cell mediated diseases comprising administering to the individual an effective amount of a 1-amino-alkylcyclohexane derivative.... Agent: Merz Pharma Gmbh & Co., Kgaa

20110251284 - Halo active aromatic sulfonamide organic compounds and uses therefor: Aromatic N-halosulfonamide organic compounds have been known for over one hundred years. The ability of these compounds to release active halogen ions has been utilized in a range of biocidal and fungicidal applications. This disclosure deals with the use of halo active aromatic sulfonamide organic compounds as odor control and/or... Agent:

20110251285 - Combinations of preservatives for ophthalmic compositions: The present invention provides a preservative composition for protecting ophthalmic solutions from microbial attack comprising a combination of benzalkonium ion and polyhexamethylene biguanide (PHMB) wherein the combined concentrations of benzalkonium ion and polyhexamethylene biguanide (PHMB) in said composition is sufficient to provide protection against microbial attack when said composition is... Agent: Allergan, Inc.

20110251286 - Crystalline salts and/or co-crystals of o-desmethyltramadol: Salts and/or co-crystals of (+)-3-[2-(dimethylamino)-methyl-1-hydroxycyclohexyl]-phenol or of (−)-3-[2-(dimethylamino)methyl-1-hydroxy-cyclohexyl]phenol, present in crystalline form, with cinnamic acid, C8- to C10-alkane-monocarboxylic acids, C6- to C10-alkanedicarboxylic acids, C15- to C17-alkane-monocarboxylic acids, fumaric acid, tartaric acid, mandelic acid, hippuric acid and/or embonic acid, a process for their production, and the use of such salts and/or... Agent: Gruenenthal Gmbh

20110251287 - Hci polymorphs of 3-((2-(dimethylamino)methyl (cyclohex-1-yl))phenol: A crystalline salt of 3-[2-(dimethylamino)methyl(cyclohex-1-yl)]phenol and hydrogen chloride, preferably in a 1:1 composition, including various crystalline forms of this salt, processes for preparing the various crystalline forms of this salt, pharmaceutical compositions containing the various crystalline forms of this salt, and the use of this salt as a pharmacologically active... Agent: Gruenenthal Gmbh

20110251288 - Process for the preparation of enantiomerically pure amines: The present invention relates to an improved process for the preparation of (R)-1-aminoindan (2), rasagiline (1) and pharmaceutically acceptable salts of rasagiline.... Agent: Albany Gate

20110251289 - New compounds for the treatment of cancer: The invention provides a method of preparing the stereoisomers of 1,11-diamino-6-aza-undecane-2,4,8,10-tetraol.... Agent: University Of Pretoria

20110251290 - Treatment of hepatic encephalopathy and liver cirrhosis: The compounds D9-tetrahydrocannabinol (THC), cannabidiol (CBD) and capsaicin are useful for prevention, treatment, or both, of hepatic encephalopathy. The compounds capsaicin, 2-arachidonoylglycerol (2-AG), HU-308 and cannabidiol are useful for prevention, treatment, or both, of liver cirrhosis.... Agent: Hadasit Medical Research Services & Development Ltd.

20110251291 - Topical compositions containing cis-6-nonenol and its derivatives and methods for treating skin: Cosmetic compositions comprising cis-6-nonenol and methods of using such compositions to impart anti-aging benefits to the skin are disclosed. Cis-6-nonenol is believed to have modulatory activity against at least one biochemical pathway implicated in skin aging.... Agent: Avon Place

20110251292 - Mixture and method for controlling the insect acrobasis nuxvorella on carya illinoiensis plants: The invention consists of a mixture of organic chemicals avoiding the use of insecticides, and a method for pest control based on the mixture consisting in bringing about the premature eclosion of the hibernating larva and its possible death through inanition; experimentation has demonstrated it to be effective in bringing... Agent: Centro De Investigacion En Alimentacion Y Desarrollo A.c.

20110251293 - Coloured glass particles, method for the production thereof and use thereof: Glass particles colored with at least one colorant, where the colored glass particles are glass platelets with an average diameter of 1 to 500 μm and the colorants comprise or consist of at least one of metallic nanoparticles and metal oxides. The glass platelets are planar and the colorants are... Agent:

20110251294 - Fast recovery of thixotropy by organogels with low molecular weight gelators: Low molecular weight gelators, methods of making such gelators, organogels comprising such gelators and methods of using such organogels are described. In exemplary methods, the gelators can be used in a variety of applications including the delivery of pharmaceutical active pharmaceutical ingredients, in food, cosmetics and consumer products, and in... Agent: Georgetown University

10/06/2011 > 209 patent applications in 143 patent subcategories. categorized by USPTO classification

20110245145 - Methods and reagents for the diagnosis, prevention and treatment of insulin resistance: The present invention provides the use of βarrestin2 protein or its up-regulators for manufacturing a composition for the prevention or treatment of insulin resistance or related disease in mammals. The reagents and the kits for the specific identification of βarrestin2 protein or its coding gene or transcript are also provided... Agent: Shanghai Institutes For Biological Sciences, Cas

20110245146 - Non-viral delivery of compounds to mitochondria: A conjugate comprises: (a) a mitochondrial membrane-permeant peptide; (b) an active agent or compound of interest such as a detectable group or mitochondrial protein or peptide; and (c) a mitochondrial targeting sequence linking said mitochondrial membrane-permeant peptide and said active mitochondrial protein or peptide. The targeting sequence is one which... Agent:

20110245147 - Activation of peptide prodrugs by hk2: The invention provides novel peptide prodrugs that contain cleavage sites specifically cleaved by human kallikrein 2 (hK2). These prodrugs are useful for substantially inhibiting the non-specific toxicity of a variety of therapeutic drugs. Upon cleavage of the prodrug by hK2, the therapeutic drugs are activated and exert their toxicity. Methods... Agent:

20110245148 - Acetic acid and a buffer: The present invention relates to a composition comprising: a) 0.01-20% wt/wt acetic acid and b) a physiologically tolerable buffer capable of maintaining acetic acid at a pH in the range of 2-7; and use of such a composition as an antimicrobial agent.... Agent: Rigshospitalet Copenhagen Univertisy Hospital

20110245149 - Methods to prevent and treat diseases: This invention discloses methods and compositions that can treat a variety of tissue injuries and infections. Tissue-derived leukocyte chemotactic factors are rapidly released after injury to mammalian tissue and can act as the initial signal leading to the initiation and amplification of acute and chronic inflammation associated with injury and... Agent: Nour Heart, Inc.

20110245151 - Bacteriocins and novel bacterial strains: Novel bacteriocins produced by novel bacterial strains are used for at least reducing the levels of colonization by at least one target bacteria in animals, especially poultry.... Agent:

20110245150 - Targets for treatment of chlamydial infections: The present invention relates to a screening method for identification of a compound suitable for the prevention, treatment or/and diagnosis of an infection with Chlamydiaceae.... Agent: Max-planck-gesellschaft Zur Foerderung Der Wissenschaften E.v.

20110245152 - Antibiotic antimicrobial agents and methods of their use: The present invention relates to a novel Paenibacillus polymyxa strain, OSY-DF, and its bioactive mutants. Also provided is a method for using a novel antimicrobial peptide, paenibacillin, isolated from the bacterial strain OSY-DF, and its bioactive variants or fragments. The invention also relates to antimicrobial compositions containing same and methods... Agent: The Ohio State University Research Foundation A Not-for-profit Corporation

20110245153 - Neutralizing agents for bacterial toxins: Stabilized variable regions of the T cell receptor and methods of making the same using directed evolution through yeast display are provided. In one embodiment, the variable region is variable beta. In one embodiment, the stabilized T cell receptor variable regions have high affinity for a superantigen, such as TSST-1... Agent: National Institutes Of Health (nih), U. S. Dept. Of Health And Human Resources (dhhs) U. S. Govt.

20110245154 - Methods and compositions for treating viral or virally-induced conditions: Provided are methods and compositions for the prevention and/or treatment of viral conditions, virally-induced conditions and inflammatory conditions. The methods can comprise administering to a subject a viral inducing agent with an antiviral agent, and optionally an additional agent. The viral inducing agent can be a HDAC inhibitor administered orally.... Agent: Trustees Of Boston University

20110245156 - Novel antiviral compounds, compositions, and methods of use: Compounds are disclosed. Compositions that include the compounds are disclosed. Methods of making and using the compounds are also disclosed.... Agent: Cytokine Pharmasciences, Inc.

20110245155 - Template-fixed beta-hairpin peptidomimetics with cxcr4 antagonizing activity: wherein Z is a template-fixed chain of 12, 14 or 18 α-amino acid residues which, depending on their positions in the chain (counted starting from the N-terminal amino acid), are Gly, NMeGly, Pro or Pip, or of certain types which, as the remaining symbols in the above formula, are defined... Agent: Universit&#xe4 T Z&#xfc Rich

20110245157 - Dimeric 1-arylpyrazole derivatives: or salts thereof, and the use of these compounds against ectoparasites such as insects, arthropods and acarina. The resulting compounds may be used in veterinary formulations such as, for example, spot-on and pour-on formulations, which may be used for treatment, controlling and preventing of parasitic infections in warm-blooded animals and... Agent:

20110245158 - High protein supplement: The present disclosure relates to high protein dietary supplements for treating various symptoms and diseases associated with protein deficiency including weight gain, obesity, catabolic diseases, fibromyalgia, anxiety reactions, posttraumatic stress and chronic fatigue syndrome. Embodiments of dietary supplements comprise combinations of proteins, essential and semi-essential amino acids including L-Lysine, L-Arginine,... Agent:

20110245159 - Salts, solvates and pharmaceutical compositions of macrocyclic ghrelin receptor agonists and methods of using the same: The present invention provides novel salts and solvates of macrocyclic compounds that bind to and/or are functional agonists of the ghrelin (growth hormone secretagogue) receptor. The invention also relates to polymorphs of these salts and solvates, pharmaceutical compositions containing these salts or solvates, and methods of using the pharmaceutical compositions.... Agent:

20110245160 - Unacylated ghrelin fragments as therapeutic agent in the treatment of obesity: A method for treating obesity and more particularly a method for treating diet-induced obesity in a subject comprising administering to said subject an isolated unacylated ghrelin peptide as set forth in SEQ ID NO: 1, a fragment thereof or a cyclic fragment thereof such as a cyclic unacylated ghrelin fragment.... Agent: Alize Pharma Sas

20110245162 - Methods for treating diabetes and reducing body weight: Methods for reducing body weight, altering body composition, treating diabetes, reducing HbA1c and reducing average daily blood glucose by the use of exendins, exendin agonists or exendin analog agonists are provided.... Agent: Amylin Pharmaceuticals, Inc.

20110245161 - Use of ghrelin splice variant for treating hypercholesterolemia and/or high cholesterol and/or high cholesterol complication and/or lipemia and/or lipemia complication and/or coronary heart disease and/or weight management and/or diabetes and/or hyperglyc: The present disclosure relates, in one aspect, to use of ghrelin splice variant or an analogue thereof for the preparation of a medicament for one or more of: treatment and/or prevention of hypercholesterolemia and/or high cholesterol and/or high cholesterol complication and/or lipemia and/or lipemia complication and/or CHD and/or weight management... Agent:

20110245163 - Stabilised insulin compositions: The present invention relates to human insulin analogues having a fast onset of action. These analogues may have amino acid in position B26 substituted with Phe, or be Des(B30) analogues of human insulin. The invention also relates to compositions comprising such insulin analogues, and to compositions comprising a mixture of... Agent: Novo Nordisk A/s

20110245164 - Yl-based insulin-like growth factors exhibiting high activity at the insulin receptor: Insulin-like growth factor analogs are disclosed wherein substitution of the IGF native amino acids, at positions corresponding to positions B16 and B17 of native insulin, with tyrosine and leucine, respectively, increases potency of the resulting analog at the insulin receptor by tenfold. Also disclosed are prodrug and depot formulations of... Agent: Indiana University Research And Technology Corporation

20110245165 - Peptide agonists of glp-1 activity: Novel peptide agonists of GLP-1 activity useful for lowering blood glucose levels. The novel peptides comprise variants of the GLP-1 or the exendin-4 polypeptide sequence and are pharmacologically active and stable. These peptides are useful in the treatment of diseases that benefit from regulation of excess levels of blood glucose... Agent:

20110245166 - Sugar chain added glp-1 peptide: The present invention relates to an oligosaccharide chain added GLP-1 peptide that has higher stability in blood than that of GLP-1 and, preferably, exhibits higher activity of controlling blood-sugar levels than that of GLP-1. The present invention relates to an oligosaccharide chain added GLP-1 peptide having GLP-1 activity, wherein at... Agent: Otsuka Chemical Holdings Co., Ltd

20110245167 - Nak-atpase-derived peptide src inhibitors and ouabain antagonists and uses thereof: A novel Src inhibitor that targets the Na/K-ATPase/Src receptor complex and antagonizes ouabain-induced protein kinase cascades and uses thereof are disclosed.... Agent: The University Of Toledo

20110245168 - Control of growth and repair of gastro-intestinal tissues by gastrokines and inhibitors: A novel group of gastrokines called Gastric Antrum Mucosal Protein is characterized. A member of the group is designated AMP-18. AMP-18 genomic DNA, cDNA and the AMP-18 protein are sequenced for human, mouse and pig. The AMP-18 protein and active peptides derived from it are cellular growth factors. Surprisingly, peptides... Agent: The University Of Chicago

20110245169 - Protection, restoration and enhancement of erythropoietin responsive cells, tissues and organs: Methods and compositions are provided for protecting or enhancing an erythropoietin-responsive cell, tissue, organ or body part function or viability in vivo, in situ or ex vivo in mammals, including human beings, by systemic or local administration of an erythropoietin receptor activity modulator, such as an erythropoietin or a modified... Agent: The Kenneth S. Warren Institute, Inc.

20110245170 - Platelet-derived growth factor compositions and methods for the treatment of tendinopathies: Provided herein are compositions and methods for the treatment of tendinopathies, such as tenosynovitis, tendinosis or tendinitis, including Achilles tendinopathy, patellar tendinopathy, lateral epicondylitis or “tennis elbow,” medial epicondylitis or “golfer's elbow,” plantar fasciitis, and rotator cuff tendinopathy, and in particular to methods for the treatment of tendinopathies by administering... Agent:

20110245171 - Rehydration compositions comprising epidermal growth factor (egf): The invention comprises 1) an oral composition, including an oral rehydration composition or solution, comprising an effective amount of a compound selected from epidermal growth factor (EGF) and agonists to the epidermal growth factor receptor, 2) a kit comprising an oral rehydration composition containing an effective amount of a compound... Agent:

20110245172 - Biocompatible oligomer-polymer compositions: The present invention relates to biocompatible oligomer-polymer compositions for the in situ formation of implants, wherein the implants release a bioactive agent, a metabolite, or a prodrug thereof, at a controlled rate. The sustained release delivery system includes a flowable composition containing a bioactive agent, a metabolite, or a prodrug... Agent: Tolmar Therapeutics, Inc.

20110245174 - Glp-1 fusion polypeptides: We describe nucleic acid molecules that encode fusion polypeptides comprising GLP-1, or a receptor binding part thereof, linked directly or indirectly to a polypeptide that naturally binds GLP-1.... Agent:

20110245173 - Long-acting glp-1 derivatives, and methods of treating cardiac dysfunction: The present invention generally provides polypeptide analogues of GLP-‘(9-34) and GLP-1 (9-36) that have increased in vivo half-lives resulting from reduced susceptibility to proteolytic enzymes. Other aspects of the invention relate to methods of using the polypeptide analogues described herein for treating cardiac dysfunction and other heart-related maladies. Yet another... Agent:

20110245175 - Inhibiting interaction between the hif-1alpha and p300/cbp with hydrogen bond surrogate-based: The present invention relates to peptides having one or more stable, internally constrained α-helices, and that include a sequence that mimics at least a portion of the C-terminal transactivation domain of HIF-1α. Also disclosed are pharmaceutical compositions containing these peptides and methods of using these peptides, for example to reduce... Agent: The Arizona Board Of Regents On Behalf Of The University Of Arizona

20110245176 - Novel peptides that bind to the erythropoietin receptor: The present invention relates to peptide compounds that are agonists of the erythropoietin receptor (EPO-R). The invention also relates to therapeutic methods using such peptide compounds to treat disorders associated with insufficient or defective red blood cell production. Pharmaceutical compositions, which comprise the peptide compounds of the invention, are also... Agent: Affymax, Inc.

20110245177 - Method for topical treatment of eye disease and composition and device for said treatment: A method for the prevention or treatment of an eye disease, which includes topically applying to a patient in need of the treatment an aqueous ophthalmic composition which includes N-acetylcarnosine, a N-acetylcarnosine derivative or a pharmacologically acceptable salt of N-acetylcarnosine, in combination with an amount of a cellulose compound or... Agent:

20110245178 - Exendin fusion proteins: The invention provides fusion proteins comprising an exendin-4 fused to a transferrin (Tf) via a polypeptide linker, as well as corresponding nucleic acid molecules, vectors, host cells, and pharmaceutical compositions. The invention also provides the use of the exendin-4/Tf fusion proteins for treatment of Type II diabetes, obesity, and to... Agent: Biorexis Pharmaceutical Corporation

20110245179 - Composition for prevention or treatment of heart failure: Provided are a composition for preventing or treating heart failure and a method for screening an agent for treating heart failure. The present disclosure demonstrates for the first time that administration of PKCζ inhibitor provides inotropic effect by increasing myocardial contractility. Thus, the present disclosure will contribute greatly to the... Agent:

20110245180 - Modified peptide that reduces pain in peripheral neuropathy: Chemokine signaling is important in neuropathic pain, with microglial cells expressing CCR2 playing a well established key role. DAPTA, a gp120-derived CCR5 entry-inhibitor has been shown to inhibit CCR5-mediated monocyte migration and to attenuate neuroinflammation. We disclose here that as a stabilized analog of DAPTA, the short peptide All D... Agent: Rapid Pharmaceuticals, Ag

20110245181 - Compositions and methods for skin treatment: Compositions for the treatment of the skin. The compositions reduce and/or reverse the visible appearance of skin damage. In the preferred embodiment, the composition includes Retinyl Palmitate Polypeptide; Ascorbylmethylsilanol Pectinate; Tocopheryl Polypeptide; Cholecalciferol Polypeptide; and Niacinamide Polypeptide.... Agent:

20110245182 - Topical uses of szeto-schiller peptides: Provided are methods for improving the appearance aging or of peri-menopausal, menopausal, or post-menopausal skin comprising: applying to the skin tissue of a mammal in need of such regulation, a safe and effective amount of a composition comprising at least one Szeto-Schiller peptide and a dermatologically acceptable carrier. Compositions for... Agent:

20110245183 - Topical uses of szeto-schiller peptides: Provided are methods for improving the appearance aging or of peri-menopausal, menopausal, or post-menopausal skin comprising: applying to the skin tissue of a mammal in need of such regulation, a safe and effective amount of a composition comprising at least one Szeto-Schiller peptide and a dermatologically acceptable carrier. Compositions for... Agent:

20110245184 - Treatment of surgical adhesions: Compositions, articles, devices and methods for the treatment and/or prevention of adhesions in humans and non-human animals.... Agent: Bradford James Duft

20110245185 - Apo-2 ligand/trail formulations: The inventions include Apo2L/TRAIL formulations and methods of using such formulations. Lyophilized and crystal formulations of Apo-2L/TRAIL which are stable and have improved Apo2L/TRAIL trimer formation are provided. Methods of making Apo-2L/TRAIL formulations, as well as devices and kits containing such formulations are also provided.... Agent: Genentech, Inc.

20110245186 - Recombinant e-selectin made in insect cells: The inventive features include recombinant mammalian E-selectin peptides, nucleic acids encoding said peptides, vectors and cells having these nucleic acids, and methods of making the peptides. Further inventive features include methods of treating diseases and conditions associated with inflammation using recombinant mammalian E-selectin peptides to induce mucosal tolerance to E-selectin.... Agent: Novavax, Inc.

20110245187 - Mesenchymal cell proliferation promoter and skeletal system biomaterial: It is found that a SVVYGLR peptide (SEQ ID NO: 1) can promote proliferation of mesenchymal cells such as marrow-derived mesenchymal stem cells and dental pulp cells. A carbonate apatite-collagen sponge containing the SVVYGLR peptide (SEQ ID NO: 1) is useful as a biomaterial for the regeneration of bone marrow... Agent: Hiroshima University

20110245188 - Methods and compositions for the prevention and treatment of inflammatory diseases or conditions: The present invention relates to methods and compositions of treating or preventing inflammatory diseases or conditions in a patient comprising administering to the patient a therapeutically effective amount of a composition comprising a glutathione donor, 5-amino 4-imidazolecarboxamide ribotide (AICAR), a 3-hydroxy-3-methylgluatryl-coenzymeA (HMG-CoA) reductase inhibitor, D-threo-1-Phenyl-2-decanoylamino-3-morpholino-1-propanol HCl (D-PDMP), and/or 1,5-(butylimino)-1,5-dideoxy-D-glucitol (Miglustat),... Agent: Musc Foundation For Research Development

20110245189 - Composition and method for the treatment of eye disease: Embodiments of the invention disclosed herein relate to compositions comprising carnosine and N-acetyl-histitidine in a pharmaceutically acceptable carrier. Other embodiments disclosed herein relate to preventing and/or ameliorating one or more symptoms associated with an eye disease such as dry eye syndrome, cataracts of the eye and nuclear sclerosis of the... Agent:

20110245190 - Method for improving post surgery visual acuity outcome with azithromycin: The present invention relates to a method for treating dry eye disease, comprising the steps of identifying a subject suffering from dry eye disease, and administering to the subject an effective amount of azithromycin. The present invention also relates to a method for reducing contact lens intolerance in a subject,... Agent:

20110245191 - Parasiticidal compositions comprising multiple active agents, methods and uses thereof: This invention relates to compositions for combating ectoparasites and endoparasites in animals, comprising at least one 1-arylpyrazole, at least one macrocyclic lactone, at least one insect growth regulator, and at least one anthelmintic compound in combination with a pharmaceutically acceptable carrier. This invention also provides for an improved methods for... Agent:

20110245192 - New activators for treating and/or preventing diseases or medical conditions which benefit from an increased transport of hyaluronan across a lipid bilayer: The present invention relates in general to a compound (activator) which is characterized by a formula selected from the following formulas A, B and/or C or a pharmaceutically acceptable salt thereof. The present invention further relates to pharmaceutical composition comprising the activator(s) of the invention and to their use in... Agent:

20110245324 - Antimicrobial compounds: The present invention relates to compounds that modulate the shikimate pathway and/or a pathway branching from the shikimate pathway in members of the Amoebida Order. In particular these compounds may be useful in the treatment or prevention of diseases caused or contributed to by members of the Amoebida Order.... Agent: University Of Strathclyde

20110245322 - Methods for identifying and compounds useful for increasing the functional activity and cell surface expression of cf-associated mutant cystic fibrosis transmembrane conductance regulator: The present invention relates to agents, and methods for identifying compounds, which agents and compounds result in the modulation of cellular trafficking of proteins in particular that of CF-associated mutant Cystic Fibrosis Transmembrane Conductance Regulator (CFTR). In addition, the invention relates to compositions and methods for the use thereof in... Agent:

20110245320 - Nuclease resistant double-stranded ribonucleic acid: This invention relates to modified double-stranded oligoribonucleic acid (dsRNA) having improved stability in cells and biological fluids, and methods of making and identifying dsRNA having improved stability, and of using the dsRNA to inhibit the expression or function of a target gene.... Agent: Alnylam Pharmaceuticals, Inc.

20110245325 - Pharmaceutical composition for treatment of cancer and asthma: The object can be solved by a pharmaceutical composition comprising a siRNA molecule that directs cleavage of mRNA of mucin subtype 5 AC via RNA interference, or an antibody against mucin subtype 5AC as an active ingredient. According to the pharmaceutical composition of the present invention, diseases involving an overexpression... Agent: Kureha Corporation

20110245323 - Rig-like helicase innate immunity inhibits vegf-induced tissue responses: The present invention encompasses compositions and compounds as well as methods of their use for the regulation of a VEGF-induced tissue response. A VEGF-induced tissue response may include angiogenesis, inflammation, increased vascular permeability, increased vascular leak, hemorrhage, or mucus metaplasia. As such, the present invention encompasses methods of treating diseases... Agent: Yale University

20110245318 - Rna sequence-specific mediators of rna interference: The present invention relates to a Drosophila in vitro system which was used to demonstrate that dsRNA is processed to RNA segments 21-23 nucleotides (nt) in length. Furthermore, when these 21-23 nt fragments are purified and added back to Drosophila extracts, they mediate RNA interference in the absence of long... Agent:

20110245319 - Rnai-mediated inhibition of rho kinase for treatment of ocular disorders: RNA interference is provided for inhibition of Rho kinase mRNA expression for treating patients with ocular disorders, particularly for treating intraocular pressure, ocular hypertension and glaucoma. Rho kinase mRNA targets include mRNA for ROCK1 and ROCK2.... Agent: Alcon Research, Ltd.

20110245321 - Siderophore-mediated iron uptake in bacterial infection: The present invention relates to methods of inhibiting S. aureus comprising inhibiting siderophore-mediated iron uptake, for example, staphyloferrm-mediated iron uptake Such methods of inhibiting S. aureus include the inhibition of staphyloferrm A- and staphyloferrm B-mediated uptake either by inhibiting expression or activity of staphyloferrm A and B or by inhibiting... Agent:

20110245329 - Double-stranded rna structures and constructs, and methods for generating and using the same: The present invention relates to novel double-stranded RNA (dsRNA) structures and dsRNA expression constructs, methods for generating them, and methods of utilizing them for silencing genes. Desirably, these methods specifically inhibit the expression of one or more target genes in a cell or animal (e.g., a mammal such as a... Agent: Alnylam Pharmaceuticals, Inc.

20110245328 - Hcv ns5a replicon shuttle vectors: The present invention provides for novel HCV NS5A replicon shuttle vectors useful for cloning in HCV polynucleotide sequences from samples of HCV-infected patients and testing the resulting replicons for drug susceptibility.... Agent:

20110245331 - Inhibitors of epoxide hydrolases for the treatment of hypertension: wherein Z is oxygen or sulfur, W is carbon phosphorous or sulfur, X and Y is each independently nitrogen, oxygen, or sulfur, and X can further be carbon, at least one of R1-R4 is hydrogen, R2 is hydrogen when X is nitrogen but is not present when X is sulfur... Agent: Government Of The United States, As Represented By The Secretary Of The Department Of Health And Hum

20110245327 - Oligonucleotide analogues: The present invention relates to novel bicyclic and tricyclic nucleoside and nucleotide analogues as well as to oligonucleotides comprising such elements. The nucleotide analogues, LNAs (Locked Nucleoside Analogues), are able to provide valuable improvements to oligonucleotides with respect to affinity and specificity towards complementary RNA and DNA oligomers. The novel... Agent: Exiqon A/s

20110245330 - P185neu-encoding dna and therapeutical uses thereof: Methods for inhibiting the formation and growth of a p185neu positive tumor in a subject, and for treating a subject having a p185neu positive tumor, utilizing a DNA vector coding for a chimeric rat/human Her-2/neu/ErbB-2 protein are provided.... Agent: Indena S.p.a.

20110245326 - Post-transcriptional regulation of rna-related processes using encoded protein-binding rna aptamers: In vitro SELEX has been used to discover high affinity RNA aptamers interacting with the tetracycline repressor protein in a tetracycline-dependent manner. Using in silico RNA folding predictions to guide the design of both aptamer truncations and mutants, minimized tetracycline repressor protein high affinity binding aptamers have been defined. Using... Agent:

20110245194 - Adenosine compounds and their use thereof: The present invention is directed to a benzyloxy cyclopentyladenosine (BCPA) compounds and to their use as selective A1 adenosine receptor agonists. The compounds of the invention are particularly directed to use in subjects for reducing and/or controlling elevated or abnormally fluctuating IOPs in the treatment of glaucoma or ocular hypertension... Agent: Inotek Pharmaceuticals Corporation

20110245193 - Combination compositions for reducing intraocular pressure: Provided herein is a pharmaceutical composition or a kit comprising a combination of a carbonic anhydrase inhibitor analog and an adenosine A1 receptor agonist. Also provided herein is a method of reducing intraocular pressure (IOP) in a subject using such a combination or kit. In a particular embodiment, provided herein... Agent: Inotek Pharmaceuticals Corporation

20110245195 - Method of reducing intraocular pressure in humans: Provided herein is a method of reducing intraocular pressure (IOP) in humans using N6-cyclopentyladenosine (CPA), CPA derivatives or prodrugs or enhanced cornea permeability formulations of CPA. In one embodiment, the invention is directed to CPA derivatives or prodrugs that are permeable to the cornea. In another embodiment, the invention is... Agent: Inotek Pharmaceuticals Corporation

20110245197 - Hypersulfated glucopyranosides: Hypersulfated disaccharides, preferably octasulfated sucrose, with utility in asthma or asthma related disorders are disclosed. The compounds may optionally be formulated with pharmaceutically acceptable excipients or delivery agents. The delivery agents are selected from the group consisting of natural or synthetic polymers, aerosols or other vehicles that facilitate the delivery... Agent: Opko Health, Inc.

20110245196 - Novel sulfated oligosaccharide derivatives: The invention relates to novel compounds that have utility as inhibitors of heparan sulfate-binding proteins; compositions comprising the compounds, and use of the compounds and compositions thereof for the antiangiogenic, antimetastatic, anti-inflammatory, antimicrobial, anticoagulant and/or antithrombotic treatment of a mammalian subject.... Agent:

20110245198 - Enhanced treatments to kill or debilitate pathogenic microorganisms of a mammalian body: Present invention relates to a composition of matter and a method that improves treatments to inactivate, kill and debilitate pathogenic microorganisms that infect on or within a mammal body, such as Helicobacter pylori. The composition of matter comprises anti-adhesive polysaccharide molecules to abolish or reduce the adhesion of H. pylori... Agent:

20110245199 - Sulfated depolymerized derivatives of expolysaccharides (eps) from mesophilic marine bacteria, method for preparing the same, and uses thereof in tissue regeneration: The invention relates to certain low-molecular weight sulphated polysaccharide derivatives of marine native exopolysaccharides (EPSs) excreted by mesophilic marine bacteria from a deep hydrothermal environment, wherein said derivatives can be obtained by means of a method which comprises a step of free radical depolymerisation of said native EPSs followed by... Agent: Universite Rene Descartes Paris 5

20110245200 - Use of idrabiotaparinux for decreasing the incidence of bleedings during an antithrombotic treatment: The invention relates to the use of idrabiotaparinux for the treatment and secondary prevention of thrombotic pathologies, wherein the use of idrabiotaparinux involves a decrease in the incidence of bleedings, in particular major bleedings, during said treatment.... Agent: Sanofi-aventis

20110245201 - Treatment of cancer: Provided are methods relating to compositions that include a CDP-topoisomerase inhibitor, e.g., a CDP-camptothecin or camptothecin derivative conjugate, e.g., CRLX101.... Agent:

20110245202 - Pharmaceutical composition for the treatment of rhinitis: On account of a synergistic combined action of the glycosaminoglycan with the sympathomimetic, drying out and inflammatory irritation of the nasal mucous membranes caused by the sympathomimetic on topical application of the pharmaceutical composition are avoided and a detumescence of the mucous membrane in the nasal cavity and an inhibition... Agent:

20110245203 - Derivatives of 1-amino-2-cyclopropylethylboronic acid: The present invention provides novel compounds useful as proteasome inhibitors. The invention also provides pharmaceutical compositions comprising the compounds of the invention and methods of using the compositions in the treatment of various diseases.... Agent: Millennium Pharmaceuticals, Inc.

20110245204 - Cycloalkane-containing sphingosine 1-phosphate agonists: The present invention provides sphingosine-1-phosphate analogs that are potent, and selective agonists at one or more S1P receptors, specifically the S1P1 receptor type. The compounds invention include compounds having a phosphate moiety as well as compounds with hydrolysis-resistant phosphate surrogates such as phosphonates, alpha-substituted phosphonates, and phosphothionates.... Agent: University Of Virginia Patent Foundation

20110245205 - Aminopyrimidines as syk inhibitors: The present invention provides novel pyrimidine amines of formula (I) which are potent inhibitors of spleen tyrosine kinase, and are useful in the treatment and prevention of diseases mediated by said enzyme, such as asthma, COPD and rheumatoid arthritis.... Agent:

20110245206 - Antioxidant inflammation modulators: c-17 homologated oleanolic acid derivatives: e

20110245207 - Method for moderately increasing the proton conductivity of biological membranes with the aid of mitochondria-targeted delocalized cations: The invention relates to biology and medicine, in particular, can be used in medicine for preparation of a pharmaceutical composition for specific, self-regulating uncoupling of mitochondria. The invention may be useful in treatment of diseases and conditions associated with violation of cellular metabolism, in treatment of obesity including its pathological... Agent: Mitotech Sa

20110245208 - Compositions and methods for the treatment of somatosensory disorders: A method of combating a somatosensory disorder in a subject, comprising administering to the subject an effective amount of a composition comprising bupranolol and/or pharmaceutically acceptable derivative(s) thereof. Compositions useful for such administration are described, including salts, esters, solvates, etc. of tert-butyl[3-(2-chloro-5-methylphenoxy)-2-hydroxypropyl]amine, in which such salt, ester, solvate, etc. compound... Agent: Algynomics Inc.

20110245209 - Pyridopyrimidine derivatives and methods of use thereof: The present invention relates to Pyridopyrimidine Derivatives of formula (I), compositions comprising a Pyridopyrimidine Derivative and methods for using the Pyridopyrimidine Derivatives for treating or preventing a metabolic disorder, dyslipidemia, a cardiovascular disease, a neurological disorder, a hematological disease, cancer, inflammation, a respiratory disease, a gastroenterological disease, diabetes, a diabetic... Agent: Schering Corporation

20110245210 - Thalidomide analogs: Thalidomide analogs that modulate tumor necrosis factor alpha (TNF-α) activity and angiogenesis are disclosed. In particularly disclosed embodiments, the thalidomide analogs are isosteric sulfur-containing analogs. Also disclosed are methods of treating a subject with the analogs.... Agent: The Department Of Health And Human Services

20110245211 - Method for contraception: The invention relates to a method of contraception, which method comprises administering to a woman in need thereof an emergency contraception during one or two days, followed by a prolonged low dosage contraceptive treatment until next menstrual period.... Agent:

20110245212 - Methods of alleviating the symptoms of premenstrual syndrome/late luteal phase dysphoric disorder: The present invention is a method of a non-continuous administration of a pharmaceutical to a female for a condition associated with the female's menstrual cycle, compromising in the administration of either 7α-Acetylthio-3-oxo-17α-pregn-4-ene-21,17-carbolactone, (+)-(S)-2-(6-methoxynaphthalen-2-yl) propanoic acid or RS)-2-(4-(2-methylpropyl) phenyl) propanoic acid. The active ingredients to be manufactured into a tablet or... Agent:

20110245214 - Organic compounds: Optionally substituted 3-(thio, sulfonyl or sulfonyl)-7,8-dihydro-(1H or 2H)-imidazo[1,2-a]pyrazolo[4,3-e]pyrimidin-4(5H)-one or a substituted 3-(thio, sulfinyl or sulfonyl)-7,8,9-trihydro-(1H or 2H)-pyrimido[1,2-a]pyrazolo[4,3-e]pyrimidin-4(5H)-one compounds or Compounds of Formula (I), processes for their production, their use as pharmaceuticals and pharmaceutical compositions comprising them.... Agent:

20110245213 - Treatment: The present invention concerns compositions that may be used in the prevention or treatment of medical conditions characterised by having an inflammatory component. The compositions comprise a therapeutically effective amount of an isothiocyanate (ITC). The composition may comprise further anti-inflammatory agents (e.g. plant-derived polyphenols).... Agent: Plant Bioscience Limited

20110245215 - Transdermal delivery systems for active agents: A formulation for transdermal or transmucosal administration of an active agent. The formulation includes an active agent and a delivery vehicle comprising a C2 to C4 alkanol, a polyalcohol, and a permeation enhancer of monoalkyl ether of diethylene glycol present in an amount sufficient to provide permeation enhancement of the... Agent: Antares Pharma, Ipl, Ag

20110245216 - Use of dhea derivatives for enhancing physical performance: A method is disclosed for administering a DHEA derivative or a physiologically acceptable salt, ester or ether thereof for one of decreasing body weight, reducing adipose tissue, increasing endurance, as an anti-aging compound and generating production of red blood cells.... Agent: Proprietary Wellness LLC

20110245217 - Methods for diagnosing and treating asthma: The present invention relates to asthma. Particularly, the present invention relates to clinical screening, diagnosis, prognosis, therapy and prophylaxis, as well as for drug screening and drug development for the treatment of asthma. The present invention relates to a new paradigm in diagnosing, screening, and treating asthma by affecting airway... Agent: The Children's Research Institute

20110245218 - Use of maleimide salts to control phytopathogenic fungi: The present invention relates to the use of new and known maleimide salts for controlling phytopathogenic fungi, and also to methods for controlling phytopathogenic fungi in crop protection, in the household and hygiene sectors and in materials protection, and also to crop protection compositions comprising these maleimide salts.... Agent: Bayer Cropscience Ag

20110245219 - Virucidal disinfectant: A virucidal alcohol-based disinfectant, in particular for sanitary and/or surgical disinfection of hands, wherein at least one acid compound is present, is distinguished in that urea is present.... Agent: Oro Clean Chemie Ag

20110245224 - Fused, spirocyclic heteroaromatic compounds for the treatment of bacterial infections: The present invention relates to compounds of Formula (I); to pharmaceutically acceptable salts thereof, to methods of using them to treat bacterial infections, and to methods for their preparation.... Agent:

20110245223 - Heterocyclic compounds: e

20110245226 - Piperidinyl derivatives as modulators of chemokine receptor activity: The present application describes substituted piperidinyl modulators of MIP-1α or CCR-1 or stereoisomers or pharmaceutically acceptable salts thereof. In addition, methods of treating and preventing inflammatory diseases such as asthma and allergic diseases, as well as autoimmune pathologies such as rheumatoid arthritis and transplant rejection using said modulators are disclosed.... Agent: Bristol-myers Squibb Company

20110245227 - Pyridone gpr119 g protein-coupled receptor agonists: Novel compounds are provided which are GPR119 G protein-coupled receptor modulators. GPR119 G protein-coupled receptor modulators are useful in treating, preventing, or slowing the progression of diseases requiring GPR119 G protein-coupled receptor modulator therapy. These novel compounds have the structure Formula I or Formula IA.... Agent: Bristol-myers Squibb Company

20110245225 - Quinazolinamide derivatives: Novel quinazolinamide derivatives of the formula (I), in which R1-R5 and X have the meanings indicated in Claim 1, are HSP90 inhibitors and can be used for the preparation of a medicament for the treatment of diseases in which the inhibition, regulation and/or modulation of HSP90 plays a role.... Agent: Merck Patent Gesellschaft Mit Beschrankter Hafting

20110245228 - Protein kinase c activity enhancer containing alkyl ether derivative or salt thereof: (In the formula, R1 and R2 may be the same or different and represent one or more groups selected from a hydrogen atom, a halogen atom, an alkyl group, an aryl group, an aralkyl group, an alkoxy group, an aryloxy group, an alkenyl group, an amino group, a heterocyclic group,... Agent: Toyama Chemical Co., Ltd.

20110245221 - Aryl isoxazole compounds with antitumoural activities: The present invention relates to formula I compounds having antitumoural activities through, as one possible biological target, the molecular chaperone heat shock protein 90 (Hsp90) inhibition. The invention includes the use of such compounds in medicine, in relation to cancer disease as well as other diseases where an inhibition of... Agent: Sigma-tau Research Switzerland S.a.

20110245220 - Compounds and compositions as modulators of gpr119 activity: The invention provides compounds, pharmaceutical compositions comprising such compounds and methods of using such compounds to treat or prevent diseases or disorders associated with the activity of GPR119.... Agent: Irm LLC

20110245222 - Methods for using carboxamide, sulfonamide and amine compounds: Disclosed are uses of carboxamide, sulfonamide and amine compounds for the treatment and amelioration of disorders and conditions related to oxidative stress, mitochondrial dysfunction, free radical damage and metabolic inefficiency, among others. Also described are methods for increasing exercise endurance, exercise efficiency and aerobic workload using the compounds described herein.... Agent: Rigel Pharmaceuticals, Inc.

20110245229 - Dihydropyrazolopyrimidinone derivatives: The invention relates to compounds represented by the general formula (I) and the like. In the formula, Ar1 denotes an aryl or heteroaryl group which may have a substituent; R1 denotes a hydrogen atom, or denotes a C1-C6 alkyl, aryl, aralkyl or heteroaryl group which may have a substituent; R2... Agent:

20110245230 - Pyrimidyl cyclopentanes as akt protein kinase inhibitors: e

20110245231 - Active substance and pharmaceutical composition for treating alcohol dependence, and a method for obtaining and the use of said active substance: wherein: W represents S or S═0 group; R1 represents one or more substituent selected from hydrogen, halogen, C1-C4 alkyl, C1-C4 alkoxy, optionally substituted azaheterocyclyl; R2 represents hydrogen or optionally substituted C1-C4 alkyl; R3 and R4 independently represent optionally identical substituents selected from hydrogen or optionally substituted C1-C4 alkyl; R5 represents... Agent: Alla Chem, LLC

20110245232 - Novel small molecule potentiators of metabotropic glutamate receptors i: wherein X2 is N or C—R2, X3 is N or C—R3, X4 is N or C—R4 provided that none or one of X2, X3 or X4 is N; Y1 is N, C or C—R5, Y2 is N, C or C—R6, Y3 is N, C or C—R7, Y4 is N, C... Agent: Abbott Gmbh & Co. Kg

20110245233 - Antioxidant inflammation modulators: oleanolic acid derivatives with saturation in the c-ring: e

20110245234 - Crystalline forms of sodium 4--2-methoxybenzoate: or a crystalline form thereof, or a solvate thereof; to a solid pharmaceutical composition comprising a pharmaceutically effective amount of the compound of formula (I), or a crystalline form thereof, or a solvate thereof, and at least one pharmaceutically acceptable carrier or diluent, and to the use of a compound... Agent: Millennium Pharmaceuticals, Inc.

20110245235 - Systems, methods, and devices for rehabilitation of auditory system disorders using pharmaceutical agents and auditory devices: The present inventions provide combination therapies, kits, and methods for providing relief and/or for improving one or more symptoms associated with an auditory system disorder in a subject diagnosed with the auditory system disorder, comprising an effective amount of at least one pharmaceutical agent and at least one auditory system... Agent:

20110245236 - Substituted benzo-pyrido-triazolo-diazepine compounds: The present invention relates to substituted benzo-pyrido-triazolo-diazepine compounds and methods of synthesizing these compounds. The present invention also relates to pharmaceutical compositions containing substituted benzo-pyrido-triazolo-diazepine compounds and methods of treating cell proliferative disorders, such as cancer, by administering these compounds or pharmaceutical compositions to subjects in need thereof.... Agent: Arqule, Inc.

20110245237 - Aryl-cyclohexyl-tetraazabenzo[e]azulenes: wherein R1, R2 and R3 are as described herein. The invention further provides methods for the manufacture of such compounds and pharmaceutical compositions containing them. The compounds according to the invention act as V1a receptor modulators, and in particular as V1a receptor antagonists. The compounds are useful as therapeutics acting... Agent:

20110245238 - Novel soluble 1,4 benzodiazepine compounds and stable salts thereof: The present invention relates to novel chemical compounds, methods for their discovery, and their therapeutic use. In particular, the present invention provides benzodiazepine derivatives and related compounds and methods of using benzodiazepine derivatives and related compounds as therapeutic agents to treat a number of conditions associated with the faulty regulation... Agent: The Regents Of The University Of Michigan

20110245239 - Organic compounds: Novel isoxazoline compounds and compositions containing the compounds are disclosed. The compounds have pesticidal properties and are suitable for use on non-human animals.... Agent:

20110245240 - Cgrp receptor antagonists: Compounds of Formula (I): (wherein variables A1, A2, A3, A4, A5, A6, A7, A8, J, Q, R4, Ea, Eb, Ec, R6, R7, Re, Rf, RPG and Y and Z are as described herein) useful as antagonists of CGRP receptors, and useful in the treatment or prevention of diseases in which... Agent:

20110245241 - Hiv integrase inhibitors: The disclosure generally relates to the novel compounds of formula I, including their salts, which inhibit HIV integrase and prevent viral integration into human DNA. This action makes the compounds useful for treating HIV infection and AIDS. The invention also encompasses pharmaceutical compositions and methods for treating those infected with... Agent: Bristol-myers Squibb Company

20110245242 - Heterocyclically substituted anilinopyrimides: in which R1 to R10 and L1, L2, E1, E2, E3, Y and Z have the meanings given in the description, and agrochemically active salts thereof, their use and also methods and compositions for controlling phytopathogenic harmful fungi in and/or on plants or in and/or on seed of plants, processes... Agent: Bayer Cropscience Ag

20110245243 - Compounds and compositions as cathepsin s inhibitors: The invention provides compounds, pharmaceutical compositions comprising such compounds and methods of using such compounds to treat or prevent diseases or disorders associated with the activity of Cathepsin S.... Agent: Novartis Ag

20110245244 - Phenoxy acetic acids as ppar delta activators: Novel compounds of the general formula (I), the use of these compounds as pharmaceutical compositions, pharmaceutical compositions comprising the compounds and methods of treatment employing these compounds and compositions. The present compounds are activators of PPARδ and should be useful for treating conditions mediated by the same.... Agent: High Point Pharmaceuticals, LLC

20110245245 - Methods of treatment comprising the administration of heteroaryl compounds: wherein R1, R2, L, X, Y, Z, Q, A and B are as defined herein, compositions comprising an effective amount of a Heteroaryl Compound and methods for treating or preventing cancer, inflammatory conditions, immunological conditions, metabolic conditions and conditions treatable or preventable by inhibition of a kinase pathway comprising administering... Agent: Signal Pharmaceuticals, LLC

20110245246 - Quinazoline derivatives useful as anti-tumor medicament: he present invention has disclosed a compound of formula I and a pharmaceutically acceptable salt or a solvate thereof, wherein the substituents are as defined in the description. The invention has also disclosed a method for preparing the compound of formula I, the pharmaceutical compositions comprising the same and their... Agent: Shanghai Allist Pharmaceuticals, Inc.

20110245248 - Isoquinoline derivatives:

20110245247 - Novel small molecule potentiators of metabotropic glutamate receptors: wherein X1 is N or C—R1, X2 is N or C—R2, X3 is N or C—R3, X4 is N or C—R4 provided that none or one of X1, X2, X3 or X4 is N; Y1 is N, C or C—R5, Y2 is N, C or C—R6, Y3 is Y1, Y2,... Agent: Abbott Gmbh & Co. Kg

20110245249 - Heterocyclically substituted anilinopyrimidines: in which R1 to R12 and E1, E2, E3, L1, Y, Z and L2 have the meanings given in the description, and agrochemically active salts thereof, their use and also methods and compositions for controlling phytopathogenic harmful fungi in and/or on plants or in and/or on seed of plants, processes... Agent: Bayer Cropscience Ag

20110245250 - Potassium ion channel modulators & uses thereof:

20110245251 - Modulators of the prostacyclin (pgi2) receptor useful for the treatment of disorders related thereto: Cyclohexane derivatives of Formula Ia and pharmaceutical compositions thereof that modulate the activity of the PGI2 receptor. Compounds of the present invention and pharmaceutical compositions thereof are directed to methods useful in the treatment of: pulmonary arterial hypertension (PAH) and related disorders; platelet aggregation; coronary artery disease; myocardial infarction; transient... Agent: Arena Pharmaceuticals, Inc.

20110245253 - Method for treating a pulmonary hypertension condition: A method for treating a pulmonary hypertension condition such as pulmonary arterial hypertension (PAH) in a subject comprises administering to the subject a therapeutically effective amount of ambrisentan, wherein, at baseline, time from first diagnosis of the condition in the subject is not greater than about 2 years.... Agent:

20110245252 - Pyrrolotriazine kinase inhibitors: m

20110245254 - Heterocyclic compounds as inhibitors of beta-lactamases: This invention discloses and claims methods for inhibiting bacterial β-lactamases and treating bacterial infections by inhibiting bacterial β-lactamases in man or an animal comprising administering a therapeutically effective amount to said man or said animal of a compound, or pharmaceutically acceptable salt thereof, of formula (I) either alone or in... Agent: Forest Laboratories Holdings Limited

20110245259 - 5-amino-2-(1-hydroxy-ethyl)-tetrahydropyran derivatives: i

20110245257 - Heterocyclic compounds and their uses: Substituted bicyclic heteroaryls and compositions containing them, for the treatment of general inflammation, arthritis, rheumatic diseases, osteoarthritis, inflammatory bowel disorders, inflammatory eye disorders, inflammatory or unstable bladder disorders, psoriasis, skin complaints with inflammatory components, chronic inflammatory conditions, including but not restricted to autoimmune diseases such as systemic lupus erythematosis (SLE),... Agent: Amgen Inc.

20110245258 - Novel antimicrobials: The present invention relates to novel phenyl oxazolidinone compounds of formula I, their pharmaceutically acceptable analogs, tautomeric forms, stereoisomers, polymorphs, prodrugs, metabolites, salts or solvates thereof. The invention also relates to the processes for the synthesis of novel compounds of formula I or their pharmaceutically acceptable analogs, tautomeric forms, stereoisomers,... Agent: Panacea Biotec Ltd.

20110245255 - Purine compounds: e

20110245256 - Use of a pkc inhibitor: The present invention demonstrates that chronic active BCR signaling through CD79A/B confers a strong dependence on downstream PKCb kinase signaling. Hence, provided herein is a method for inhibiting the growth of B-cell lymphoma having chronic active B-cell-receptor signaling, or inhibiting the growth of cancers with molecular lesions that lead to... Agent: Novartis Ag

20110245260 - Analogs of dehydrophenylahistins and their therapeutic use: e

20110245261 - Antiprolactinic veterinary composition for ruminants: This present invention relates to an antiprolactinic veterinary composition to be administered to ruminants. Said composition comprises at least one antiprolactinic compound which is an agonist of dopamine receptors, and is particularly useful for promoting a substantial reduction of lactation, mammary involution, and for treating and/or intra-mammary diseases or infections... Agent: Ceva Sante Animale Sa

20110245262 - Compounds for treating proliferative disorders: Disclosed are compounds and methods of using compounds of the invention for treating a subject with a proliferative disorder, such as cancer, and methods for treating disorders responsive to Hsp70 induction and/or natural killer induction. Also, disclosed are pharmaceutical compositions comprising compounds of the invention and a pharmaceutically acceptable carrier.... Agent: Synta Pharmaceuticals Corp.

20110245263 - 2-heteroaryl-pyrrolo[3,4-c]pyrrole derivatives and their use as scd: s

20110245265 - Cxcr4 antagonists for kidney injury: Methods to treat or prevent acute kidney injury and chronic kidney injury in subjects using CXCR4 antagonists are disclosed.... Agent: Genzyme Corporation

20110245264 - Modulators of g protein-coupled receptor 88: The present disclosure is generally directed to compounds which can modulate G-protein coupled receptor 88, compositions comprising such compounds, and methods for modulating G-protein coupled receptor 88.... Agent: Bristol-myers Squibb Company And Lexicon Pharmaceuticals, Inc.

20110245266 - Pyridin-2-one compounds and their use as modulators of the dopamine d3 receptor: The invention relates to novel pyridin-2-one compounds of general formula (I), in which A represents a 4- to 6-membered hydrocarbon chain that can have 1 or 2 methyl groups as substituents, wherein 1 or 2 carbon atoms can be replaced by oxygen, a carbonyl group or sulfur, and the hydrocarbon... Agent:

20110245268 - Pharmaceutical formulations of substituted azaindoleoxoacetic piperazine derivatives with protease inhibitors: This invention provides compounds having drug and bio-affecting properties, their pharmaceutical compositions and method of use. In particular, the invention is concerned with azaindoleoxoacetyl piperazine derivatives. These compounds possess unique antiviral activity, whether used alone or in combination with other antivirals, antiinfectives, immunomodulators or HIV entry inhibitors. More particularly, the... Agent: Bristol-myers Squibb Company

20110245267 - Piperidine and piperazine derivatives and methods of use thereof: The present invention relates to novel Piperidine and piperazine Derivatives, pharmaceutical compositions comprising the Piperidine and piperazine Derivatives and the use of these compounds of formula (I) for treating or preventing treating allergy, an allergy-induced airway response, congestion, a cardiovascular disease, an inflammatory disease, a gastrointestinal disorder, a neurological disorder,... Agent: Schering Plough Corporation

20110245269 - Inhibitors of advanced glycation end products: e

20110245270 - Nicotinic receptor agonists for the treatment of inflammatory diseases: Use of nicotine receptor agonists for treating inflammatory diseases, including a variety of pulmonary diseases. Such agonists have fewer side effects than other anti-inflammatory drugs, such as steroids. Moreover, these agonists can be used alone or in combination with other anti-inflammatory drugs to alleviate pulmonary diseases. For example, a method... Agent: Universite Laval

20110245271 - Triazole-substituted arylamides as p2x3 and p2x2/3 antagonists: e

20110245274 - Isoxazolines derivatives and their use as pesticide: Novel isoxazoline compounds, compositions containing the compounds and methods for making the compounds are disclosed. The compounds and compositions have pesticidal properties and are suitable for controlling ectoparasites on non-human animals.... Agent: Novartis Ag

20110245273 - Novel aliphatically substituted pyrazolopyridines, and the use thereof: The present application relates to novel aliphatically substituted pyrazolopyridines, to processes for their preparation, to their use, alone or in combination, for the treatment and/or prevention of diseases and to their use for preparing medicaments for the treatment and/or prevention of diseases, in particular for the treatment and/or prevention of... Agent: Bayer Schering Pharma Aktiengesellschaft

20110245272 - Pyrido[4,3-b]indoles and methods of use: This disclosure relates to new heterocyclic compounds that may be used to modulate a histamine receptor in an individual. Pyrido[4,3-b]indoles are described, as are pharmaceutical compositions comprising the compounds and methods of using the compounds in a variety of therapeutic applications, including the treatment of a cognitive disorder, psychotic disorder,... Agent:

20110245275 - Treatment of organophosphate exposure with ocinaplon: A method of treating exposure to organophosphate agents and preventing morbidity due to such exposure through the administration of a pyrazolopyrimidine compound such as ocinaplon, zaleplon, indiplon, or divaplon.... Agent:

20110245276 - Photostabilized pharmaceutical compositions: A crosslinking reaction and a reaction for reducing molecular weight that take place in a hyaluronic acid-methotrexate conjugate upon irradiation with light are suppressed to improve the photostability of the conjugate. Specifically, a substance having a quenching effect and/or a radical scaveng effect is added to a pharmaceutical composition containing... Agent: Denki Kagaku Kogyo Kabushiki Kaisha

20110245278 - Compositions of opioid antagonists and methods for treating conditions caused by the varicella-zoster virus therewith: Provided are compositions comprising opioid antagonists, such as naltrexone naloxone, or nalmefene, or their pharmaceutically acceptable salts, and methods for treating conditions caused by the varicella-zoster virus therewith.... Agent: Mustafa Nevzat Ilac Sanayii A.s.

20110245277 - Famciclovir for the treatment of recurrent herpes labialis using a one-day treatment: A method for the treatment of recurrent herpes labialis in mammals, including humans, which method comprises administering to the mammal in need of such treatment, an effective amount of penciclovir or famciclovir, or a pharmaceutically acceptable salt thereof for a period of one day.... Agent:

20110245280 - Frugicidal mixtures based on triazoles: m

20110245279 - Predictive marker for egfr inhibitor treatment: The present invention provides a biomarker which is predictive for the clinical benefit of EGFR inhibitor treatment in cancer patients... Agent:

20110245281 - Dispersible bosentan tablet: The invention relates to dispersible tablets comprising the compound 4-tert-butyl-N-[6-(2-hydroxy-ethoxy)-5-(2-methoxy-phenoxy)-2-(pyrimidin-2-yl)-pyrimidin-4-yl]-benzenesulfonamide.... Agent:

20110245282 - Compounds: The invention provides a compound according to formula (I): wherein: X is O or S; Y is O or S; each Ar and Ar′ is independently a mono-, bi- or tricyclic aryl or heteroaryl group optionally substituted with one or more substituents selected from halo, alkyl, aryl, heteroaryl, hydroxyl, nitro,... Agent: University Court Of The University Of Dundee University Court Of The University Of St. Andrews

20110245284 - Alkoxy- and alkylthio-substituted anilinopyrimidines: in which R1 to R14 and E1, E2, E3, X and Y have the meanings given in the description, and agrochemically active salts thereof, their use, and methods and compositions for controlling phytopathogenic harmful fungi in and/or on plants or in and/or on seeds of plants, processes for preparing such... Agent: Bayer Cropscience Ag

20110245283 - Methods for predicting the response to statins: The invention provides methods for optimizing therapeutic efficacy for treating hypercholesterolemia in a subject having a cardiovascular disease (CVD), comprising (a) determining subject characteristics that affect the likelihood of reaching a goal level of low density lipoprotein (LDL); and (b) obtaining success probabilities of a variety of statin treatments for... Agent:

20110245285 - Process for preparation of rosuvastatin acetonide calcium: The present invention is in relation to a process for preparation of HMG-CoA reductase inhibitor. More particularly, the present invention provides a process for preparation of (3R,5S,6E) 6-{2-[4-(4-Fluoro-phenyl)-6-isopropyl-2-(methanesulfonyl-methyl-amino)-pyrimidin-5-yl]-vinyl}-2,2-dimethyl-[1,3]dioxan-4-yl)-acetic acid, calcium salt (Rosuvastatin acetonide calcium) which is used for treating hypercholesterolemia.... Agent: Biocon Limited

20110245286 - Treatment of inflammation using alpha 7 receptor-binding agonists: Methods of inhibiting release of a proinflammatory cytokine from a macrophage are provided. The methods comprise treating the macrophage with a cholinergic agonist in an amount sufficient to decrease the amount of the proinflammatory cytokine that is released from the macrophage, wherein the cholinergic agonist is selective for an α7... Agent: The Feinstein Institute For Medical Research

20110245287 - Hybrid opioid compounds and compositions: Disclosed are hybrid opioid compounds, mixed opioid salts, compositions comprising the hybrid opioid compounds and mixed opioid salts, and methods of use thereof. More particularly, in one aspect the hybrid opioid compound includes at least two opioid compounds that are covalently bonded to a linker moiety. In another aspect, the... Agent:

20110245288 - Transdermally deliverable opioid prodrugs, abuse-resistant compositions and methods of using opioid prodrugs: Described herein are opioid prodrugs, methods of making opioid agonist-antagonist prodrugs, compositions comprising opioid agonist-antagonist prodrugs, abuse-resistant formulations and dosage forms of opioid agonist-antagonist prodrugs, and methods of using opioid agonist-antagonist prodrugs.... Agent: Alltranz Inc.

20110245289 - Novel substituted imidazoquinolines: Imidazoquinolines of formula I that contain substituted amine or amide functionality at 1-position and that are effective as Toll like Receptor 7 activators are disclosed. These compounds are useful as anticancer agents.... Agent: 4sc Ag

20110245290 - Alternative forms of the phosphodiesterase-4 inhibitor n-cyclopropyl-1--4-oxo-1,4-dihydro-1,8-naphthyridine-3-carboxyamide: The present invention is directed to alternative forms of the title phosphodiesterase 4 inhibitor which has the structural formula shown immediately below:... Agent:

20110245291 - Tricyclic delta-opioid modulators: The invention is directed to delta opioid receptor modulators. More specifically, the invention relates to tricyclic δ-opioid modulators. Pharmaceutical and veterinary compositions and methods of treating mild to severe pain and various diseases using compounds of the invention are also described.... Agent:

20110245292 - 2-hydroxy-ethanesulfonate salt: The invention provides (R)-1-[3-(R)-cyclohexyl-hydroxy-phenyl-methyl)-isoxazol-5-ylmethyl]-3-(3-fluoro-phenoxy)-1-azonia-bicyclo[2.2.2]octane 2-hydroxy ethanesulfonate, pharmaceutical compositions containing the compound and its use as a muscarinic antagonists, for the treatment of chronic obstructive pulmonary disease.... Agent: Pulmagen Therapeutics (synergy) Limited

20110245294 - Methods of improving quality of sleep: Disclosed herein are methods of treating a patient suffering from overactive bladder (OAB) comprising administering to the patient a combination of antimuscarinic or anticholinergic agent and muscarinic agonist for the treatment of poor quality of sleep in the OAB patient.... Agent: Theravida, Inc.

20110245293 - Pharmaceutical product comprising a muscarinic receptor antagonist and a beta-2-adrenoceptor agonist: The invention provides a pharmaceutical product, kit or composition comprising a first active ingredient which is a selected muscarinic receptor antagonist selected, and a second active ingredient which is a β2-adrenoceptor agonist, of use in the treatment of respiratory diseases such as chronic obstructive pulmonary disease and asthma.... Agent: Astrazeneca Ab

20110245295 - Bioactive pre-tubulysins and use thereof: The invention relates to bioactive pre-tubulysin derivatives, their preparation and pharmacological use.... Agent: Universitat Des Saarlandes

20110245296 - Non-nucleoside reverse transcriptase inhibitors: are HIV reverse transcriptase inhibitors, wherein R1, R2, R3, R4 and R5 are defined herein. The compounds of Formula I and their pharmaceutically acceptable salts are useful in the inhibition of HIV reverse transcriptase, the prophylaxis and treatment of infection by HIV and in the prophylaxis, delay in the onset... Agent:

20110245297 - Use quaternary pyridinium salts as vasoprotective agents: wherein R is NH2, CH3, or N(H)CH2OH group, and X is pharmaceutically acceptable counterion, for the preparation of vasoprotective agent for the treatment or prevention of conditions or diseases associated with dysfunction of vascular endothelium, oxidative stress, and/or insufficient production of endothelial prostacyclin PGI2, in particular but not exclusively if... Agent: Pharmena Spolka Akeyjna (pharmena S.a.)

20110245298 - Nicotinic acid compositions for treating hyperlipidemia and related methods therefor: An orally administered antihyperlipidemia composition according to the present invention includes from about 250 to about 3000 parts by weight of nicotinic acid, and from about 5 to about 50 parts by weight of hydroxypropyl methylcellulose. Also, a method of treating hyperlipidemia in a hyper lipidemic having a substantially periodic... Agent:

20110245299 - Nicotinic acid compositions for treating hyperlipidemia and related methods therefor: An orally administered antihyperlipidemia composition according to the present invention includes from about 250 to about 3000 parts by weight of nicotinic acid, and from about 5 to about 50 parts by weight of hydroxypropyl methylcellulose. Also, a method of treating hyperlipidemia in a hyper lipidemic having a substantially periodic... Agent:

20110245300 - Nicotinic acid compositions for treating hyperlipidemia and related methods therefor: An orally administered antihyperlipidemia composition according to the present invention includes from about 250 to about 3000 parts by weight of nicotinic acid, and from about 5 to about 50 parts by weight of hydroxypropyl methylcellulose. Also, a method of treating hyperlipidemia in a hyper lipidemic having a substantially periodic... Agent:

20110245302 - Solid pharmaceutical composition comprising amlodipine and losartan and process for producing same: The present invention relates to a solid pharmaceutical composition for preventing or treating cardiovascular disorders comprising amlodipine or a pharmaceutically acceptable salt thereof and losartan or a pharmaceutically acceptable salt thereof, which exhibits high dissolution rates of amlodipine and losartan even under a low pH condition and improved storage stability.... Agent: Hanmi Holdings Co., Ltd.

20110245301 - Solid pharmaceutical composition comprising amlodipine and losartan with improved stability: The present invention relates to a solid pharmaceutical composition for preventing or treating cardiovascular disorders comprising granular forms of amlodipine and losartan which are separated from each other, and a stabilizing agent, which has improved storage stability due to minimized interaction between amlodipine and losartan.... Agent: Hanmi Holdings Co., Ltd.

20110245303 - Heteroalkyl biphenyl antagonists of prostaglandin d2 receptors: Described herein are antagonists of PGD2 receptors. Also described are pharmaceutical compositions and medicaments that include the compounds described herein, as well as methods of using such antagonists of PGD2 receptors, alone and in combination with other compounds, for treating respiratory, cardiovascular, and other PGD2-dependent or PGD2-mediated conditions or diseases.... Agent: Amira Pharmaceuticals, Inc.

20110245305 - Pharmaceutical compositions for poorly soluble drugs: The invention relates to solid dispersions of poorly soluble compounds formed by co-precipitation and hot melt extrusion, resulting in improved stability and bioavailability. The invention also relates to hot melt extrusion processes used to prepare such solid dispersions.... Agent:

20110245304 - Ribonucleotide reductase inhibitors and methods of use: Provided herein are novel compounds that inhibit ribonucleotide reductase (RR) by binding to RRM2 and interfering with the activity of the RRM1/RRM2 holoenzyme. These inhibitors may be used to inhibit RR activity and to treat various conditions associated with RRM2 expression, such as for example certain cancer types, mitochondrial diseases,... Agent: City Of Hope

20110245306 - Co-crystals: The present invention relates to co-crystals of propiconazole and a co-crystal forming compound.... Agent: Synenta Crop Protection, Inc.

20110245307 - Methods for alzheimer's disease treatment and cognitive enhancement: The present invention relates to compositions comprising a combination of PKC activators and PKC inhibitors and methods to modulate α-secretase activity; improve or enhance cognitive ability; and/or reduce neurodegeneration in individuals suffering from diseases that impair cognitive ability, particularly Alzheimer's Disease. The invention also relates to methods for improving or... Agent: Blanchette Rockefeller Neurosciences Institute

20110245308 - Substituted benzyl and phenylsulfonyl triazolones, and use thereof: The present application relates to new, substituted benzyl-1,2,4-triazolones and phenylsulfonyl-1,2,4-triazolones, to processes for preparing them, to their use alone or in combinations for the treatment and/or prevention of diseases and also to their use for the production of medicaments for the treatment and/or prevention of diseases, more particularly for the... Agent: Bayer Schering Pharma Aktiengesellschaft

20110245309 - N-methylpurine dna glycosylase and polymerase beta as biomarkers for alkylator chemotherapy potentiation: Described herein is the finding that polymerase β (Polβ) and N-methylpurine DNA glycosylase (MPG) can be used as biomarkers to evaluate the sensitivity of a subject to combination therapy that includes treatment with either temozolomide (TMZ) and methoxyamine, or TMZ and a poly(ADP-ribose) polymerase (PARP) inhibitor. Thus, provided herein is... Agent: University Of Pittsburgh - Of The Commonwealth System Of Higher Education

20110245310 - Novel compounds: s

20110245312 - Amino acid based compositions for the treatment of pathological conditions distinguished by insufficient mitochondrial function: The present invention relates to compositions suitable for the treatment of pathological conditions distinguished by insufficient or reduced mitochondrial function. The compositions comprise, as principal active ingredients, the amino acids leucine, isoleucine and valine. The compositions may also comprise, as further active ingredients, amino acids threonine and lysine, and optionally,... Agent: Professional Dietetics S.r.i.

20110245313 - Amino acid based compositions for the treatment of pathological conditions distinguished by insufficient mitochondrial function: The present invention relates to compositions suitable for the treatment of pathological conditions distinguished by insufficient or reduced mitochondrial function. The compositions comprise, as principal active ingredients, the amino acids leucine, isoleucine and valine. The compositions may also comprise, as further active ingredients, amino acids threonine and lysine, and optionally,... Agent: Professional Dietetics S.r.i.

20110245311 - Histidine derivatives: Disclosed herein are the compositions and methods for a compound of Formula Ia or Ib.... Agent:

20110245314 - Extended release formulation and methods of treating adrenergic dysregulation: A composition and method of treating adrenergic dysregulation by administering the composition is disclosed, wherein the composition comprises a α2-adrenergic receptor agonist; a pharmaceutically acceptable hydrophilic matrix and a release-retardant of a metal alkyl sulfate. In embodiments, the composition provides a sustained release of the agonist, wherein after administration of... Agent:

20110245315 - Indolyl or indolinyl hydroxamate compounds: c

20110245316 - Prevention or delay of onset of oral mucositis: The present invention provides a method for preventing or delaying the onset of oral mucositis, including the onset of ulcerative or severe OM, in a patient receiving cancer therapy. The method comprises administering to the patient an effective regimen of γ-D-glutamyl-L-tryptophan (SCV-07) over the course of therapy. The regimen, which... Agent: Sciclone Pharmaceuticals, Inc.

20110245317 - Use of organic compounds: This application is directed to methods for improving glucose control by administering metformin in combination with a DPP-IV inhibitor to a patient in need thereof, in an amount sufficient to control the glucose level over an extended period of time.... Agent:

20110245332 - Injectable formulations of taxanes for cad treatment: Medical devices, and in particular implantable medical devices, may be coated to minimize or substantially eliminate a biological organism's reaction to the introduction of the medical device to the organism. The medical devices may be coated with any number of biocompatible materials. Therapeutic drugs, agents or compounds may be mixed... Agent:

20110245333 - Identification of free-b-ring flavonoids as potent cox-2 inhibitors: The present invention provides a novel method for inhibiting the cyclooxygenase enzyme COX-2. The method is comprised of administering a composition containing a Free-B-Ring flavonoid or a composition containing a mixture of Free-B-Ring flavonoids to a host in need thereof. The present also includes novel methods for the prevention and... Agent: Unigen, Inc.

20110245334 - Use of racemates of pinocembrin in preparing medicaments for treating stroke: Use of a racemate of pinocembrin, a racemate of pinocembrin salt, a racemate of pinocembrin precursor or a racemate of pinocembrin hydrate in manufacture of a medicament for prophylaxis and treatment of stroke. Particularly, use of pinocembrin racemate in manufacture of a medicament for treatment of acute ischemic stroke.... Agent: Cspc Zhonggi Pharmaceutical Technology (shijiazhuang) Co. Ltd.

20110245335 - New inhibitors for treating diseases associated with an excess transport of hyaluronan: The present invention relates in general to a compound which is characterized by a formula selected from the following formulas A, B, C, D, E or F; or a pharmaceutically acceptable salt thereof. The present invention further relates to pharmaceutical composition comprising the inhibitor(s) of the invention and to their... Agent:

20110245336 - Colchicine solid complex; methods of making; and methods of use thereof: Disclosed are new colchicine solid complexes, methods of making the solid complexes as well as formulations prepared therefrom and uses thereof.... Agent:

20110245338 - Chiral intermediate, process for producing the same and its use in the manufacture of tolterodine, fesoterodine, or the active metabolite thereof: The compound of formula (I): is provided. It may be produced by subjecting a compound of formula (IV) to a reduction reaction wherein R represents hydrogen, straight or branched C1-C6 alkyl. This compound is a valuable intermediate which may be used in the synthesis of fesoterodine, tolterodine, its active metabolite,... Agent: Ucb Pharma Gmbh

20110245337 - Method for enhancing the dna repair process, treating disorders associated with the dna repair process, enhancing antitumor response and treating disorders associated with anti-tumor response in mammals by administering purified quinic acid and/or carboxy: For use in mammals, methods for enhancing the anti-tumor response and treating disorders associated with anti-tumor response. The methods generally comprise non-topical administration of purified, isolated quinic acid alkyl acid or a carboxy alkyl ester with a non-toxic carrier or diluent.... Agent: Optigenex, Inc.

20110245339 - Prodrugs of short-chain fatty acids and treatment methods: Prodrugs made up of biologically-active short-chain fatty acids or derivatives thereof conjugated to neutral or cationic amino acids capable of intracellular transport by ATB0,+ are provided. The short-chain fatty acid or derivative thereof can be attached to the amino acid through a hydroxyl group of the amino acid to form... Agent: Medical College Of Georgia Research Institute, Inc

20110245341 - Process for the preparation of non-genotoxic diacetylrhein (diacerein) and formulations comprising non-genotoxic diacetylrhein: The present invention is directed to a process for producing non-genotoxic Diacetylrhein (Diacerein), comprising: i) transformation of raw Diacerein (or raw Rhein), into a water-soluble salt; ii) adsorption of the salt Diacerein (or Rhein) solution on a hydrophobic resin; iii) washing with an appropriate solvent to eliminate the impurities (in... Agent: Evultis Sa

20110245340 - Screening method for identifying patients at risk of adverse hepatologic events: This present invention provides methods and kits for identifying patients at risk of suffering from a drug induced liver injury, particularly for an antioxidant drug, or for identifying patients who are suffering from early stages of a liver disorder by assessing the levels of apolipoprotein in a sample of the... Agent:

20110245342 - 3,5,3'-triiodothyronine sulfate as thyromimetic agent and pharmaceutical formulations thereof: The invention regards the use of triiodothyronine sulfate, commonly named T3S, as a medicament having thyromimetic activity for the treatment of pathologies due to organic deficiency of triiodothyronine (T3), as such or in association with thyroxine (T4), and pharmaceutical formulations for oral administration thereof.... Agent: Bracco S.p.a.

20110245343 - Anti-wrinkle agents: Provided are anti-wrinkle agents having a novel scaffold that is suitable as components for external skin preparations such as cosmetics. The anti-wrinkle agents comprise compounds represented by general formula (1), stereoisomers thereof, or pharmacologically acceptable salts thereof. Said anti-wrinkle agents have excellent efficacy in improving wrinkles and sagging that are... Agent:

20110245344 - Arginine derivative and cosmetic containing the same: wherein R1 and R2 are a hydrogen atom or a linear or branched monohydroxyalkyl group having 2 to 3 carbon atoms and at least one of R1 and R2 represents a linear or branched monohydroxyalkyl group having 2 to 3 carbon atoms; and R3 represents a hydrogen atom, an alkali... Agent: Nof Corporation

20110245345 - Topical treatment formulation of natural ingredients for enhancing sexual response: The present invention relates to a topical composition to enhance sexual response. The composition includes L-arginine, trans-resveratrol, and a topical carrier wherein L-arginine is present in an amount not greater than about 10% and trans-resveratrol is present in an amount not greater than about 10% based upon the weight of... Agent:

20110245346 - Novel polymorphs and salts: Novel polymorphic forms and salts of 1-(3′,4′-dichloro-2-fluorobiphenyl-4-yl)cyclopropanecarboxylic acid are useful for the prevention or treatment of Alzheimer's Disease.... Agent: Chiesi Farmaceutici S.p.a.

20110245347 - Method for selectively crystallizing a z isomer of iopromide: The present invention relates to a method for selectively crystallizing Z isomer of iopromide of formula (I) comprising a) dissolving a crude iopromide comprising a mixture of E and Z isomers or a concentrate thereof in an alcohol, and b) heating the resulting alcohol solution to obtain crystalline of Z... Agent: Daewoong Pharmaceutical Co., Ltd.

20110245348 - Method of treating type i diabetes: The method of treating type I diabetes includes the treatment of diabetic patients with choline in order to control the patient's lipid profile. The treatment method includes the step of administering to the patient a therapeutically effective dosage of choline or a pharmaceutically acceptable salt thereof. In human patients, the... Agent:

20110245349 - Benzyl alcohol mixture for treating premature ejaculation: A penile desensitizing formulation for treating premature ejaculation, comprising benzyl alcohol at a concentration between 1% and 10% by weight of the total formulation, and additionally menthol at a concentration between 0.05% and 1% by weight of the total formulation, prepared as solution, gel, cream or ointment.... Agent: Panaxia Ltd.

20110245350 - Processes for producing and compositions comprising 2,3,3,3-tetrafluoropropene and/or 1,2,3,3- tetrafluoropropene: p

20110245351 - Medical adhesive for surgery: The invention relates to novel rapidly-curing adhesives made from hydrophilic polyisocyanate prepolymers for application in surgery.... Agent: Bayer Materialscience Ag

20110245352 - Composition for permeabilizing the walls of microorganisms comprising the combination of ethylenediaminetetraacetic acid (edta) and polyethyleneimine (pei): The present invention relates to a composition for permeabilizing the walls of microorganisms, comprising the combination of polyethyleneimine (PEI) and ethylenediaminetetraacetic acid (EDTA), and to a method using said composition for counting and detecting, in a targeted manner, the microorganisms on a membrane. The invention also relates to a kit... Agent: Millipore Corporation

20110245353 - Sweet flavor modifier: The present invention includes compounds having structural formula (I), or pharmaceutically acceptable salts, solvate, and/or ester thereof. These compounds are useful as sweet flavor modifiers. The present invention also includes compositions comprising the present compounds and methods of enhancing the sweet taste of ingestible compositions. Furthermore, the present invention provides... Agent: Senomys, Inc.

Previous industry: Perfume compositions
Next industry: Colloid systems and wetting agents; subcombinations thereof; processes of


RSS FEED for 20150611: xml
Integrate FreshPatents.com into your RSS reader/aggregator or website to track weekly updates.
For more info, read this article.


Thank you for viewing Drug, bio-affecting and body treating compositions patents on the FreshPatents.com website. These are patent applications which have been filed in the United States. There are a variety ways to browse Drug, bio-affecting and body treating compositions patent applications on our website including browsing by date, agent, inventor, and industry. If you are interested in receiving occasional emails regarding Drug, bio-affecting and body treating compositions patents we recommend signing up for free keyword monitoring by email.

Advertise on FreshPatents.com - Rates & Info


FreshPatents.com Support - Terms & Conditions

Results in 1.0746 seconds