Drug, bio-affecting and body treating compositions patents - Monitor Patents
FreshPatents.com Logo    FreshPatents.com icons
Monitor Keywords Patent Organizer File a Provisional Patent Browse Inventors Browse Industry Browse Agents

USPTO Class 514  |  Browse by Industry: Previous - Next | All     monitor keywords
06/2010 | Recent  |  14:  | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | 13: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | 12: Dec | Nov | Oct | Sep | Aug | July | June | May | April | Mar | Feb | Jan | 11: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | 10: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan |  | 09: Dec | Nov | Oct | Sep | Aug | Jl | Jn | May | Apr | Mar | Fb | Jn |  | 2008 | 2007 |

Drug, bio-affecting and body treating compositions June invention type 06/10

Below are recently published patent applications awaiting approval from the USPTO. Recent week's RSS XML file available below.
Listing for abstract view: USPTO application #, Title, Abstract excerpt,Patent Agent. Listing format for list view: USPTO National Class full category number, title of the patent application.
06/24/2010 > patent applications in patent subcategories. invention type

20100160207 - Feedback prodrug: Compounds and methods for use in selectively inhibiting a lytic enzyme based on feedback inhibition. The conjugated compound serves as a substrate for a lytic enzyme. Cleavage of the conjugated compound by the lytic enzyme releases an inhibitor of the enzyme.... Agent: Mueting, Raasch & Gebhardt, P.A.

20100160208 - Pharmaceutical composition: The invention concerns a pharmaceutical composition comprising at least one stimulator of the immune cell functions and at least one substance inhibiting the cell proliferation and/or inducing cell death. In a preferred embodiment the stimulator of the function of the immune system and/or the immune cells are antagonists of TGF-beta... Agent: Jacobson Holman PLLC

20100160209 - Composition and method for increasing cell permeability of a compound: The invention provides for a cell permeable peptide conjugated to an insulin compound for improved cell penetration of the insulin moiety. The composition may be delivered by intravenous, intramuscular, subcutaneous, intranasal, oral inhalation, intrarectal, intravaginal or intraperitoneal means for the treatment, including prophylaxis of Type I, Type II diabetes, prediabetes... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100160210 - Guanidinium delivery carriers: Disclosed herein are transmembrane transporter compounds containing guanidinium groups. Also disclosed herein are methods for transporting a biologically active moiety across a biological membrane using the transmembrane transporter compounds. Particularly, this invention provides a method for the delivery of a biologically active moiety across the biological membranes of such membranes... Agent: Knobbe Martens Olson & Bear LLP

20100160211 - Glycopeptide phosphonate derivatives: Disclosed are glycopeptides that are substituted with one or more substituents each comprising one or more phosphono groups; and pharmaceutical compositions containing such glycopeptide derivatives. The disclosed glycopeptide derivatives are useful as antibacterial agents.... Agent: Theravance, Inc.

20100160212 - Modified human plasma polypeptide or fc scaffolds and their uses: Modified human plasma polypeptides or Fc and uses thereof are provided.... Agent: Attn: John W. Wallen, Iii Ambrx, Inc.

20100160213 - Antimicrobial and anticancer lipopeptides: The invention provides lipophilic conjugates comprising a peptide coupled to a fatty acid, the peptide comprising at least two positively charged amino acid residues, said peptide after conjugation to the fatty acid possessing antibacterial, antifungal, and/or anticancer activity higher than prior to conjugation. The lipophilic conjugates are suitable for treatment... Agent: Winston & Strawn LLP Patent Department

20100160215 - Antibiotic compositions for the treatment of gram negative infections: Provided herein are novel compounds and novel protected compounds that can be derived from polymyxin, including, e.g., polymyxin B1 and [Il7] polymyxin B1. The novel compounds have antibacterial properties against a diverse range of gram negative bacteria and reduced toxicity compared to polymyxins such as polymyxin B. Also provided are... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20100160214 - Desmopressin composition: Disclosed is a pharmaceutical formulation that may be used in the treatment of nocturia, primary nocturnal enuresis, incontinence, urinary frequency, diabetes insipidus, or any disease or syndrome where desmopressin therapy is useful or where safe temporary suppression of urine production may lead to beneficial health effects or increased convenience in... Agent: Axinn, Veltrop & Harkrider LLP Attn. Michael A. Davitz

20100160217 - Acetylycholine gated ion channel chaperons and methods of using the same: The present invention provides receptor chaperons and means for producing cells having increased and/or decreased expression of nAChR subunit combinations and/or nAChR subtypes, which provide useful models for investigating pharmacological properties of the receptors and regulation of the binding sites of potential nAChR subtypes.... Agent: Ballard Spahr LLP

20100160218 - Airway administration of tissue factor pathway inhibitor in inflammatory conditions affecting the respiratory tract: The present invention provides methods for the local treatment of acute and chronic extravascular pulmonary fibrin deposition and/or reducing unwanted effects associated with systemic administration of natural anticoagulants to a subject via airway administration to the subject by intratracheal, intrabronchial or intraalveolar routes of natural anticoagulants or biologically active derivatives... Agent: Licata & Tyrrell P.C.

20100160233 - Antitumour combinations containing a vegf inhibiting agent and irinotecan: Disclosed are antitumor combinations of VEGF inhibitors with Irinotecan and the use thereof in the treatment of neoplastic diseases.... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20100160231 - Axmi-150 delta-endotoxin gene and methods for its use: Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions including a coding sequence for pesticidal polypeptides are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also include... Agent: Alston & Bird LLP

20100160234 - Cell-proliferation inhibiting vpg proteins, fragments or analogs thereof and their applications: Use of VPg proteins, fragments or analogs thereof having the ability to bind an eukaryotic initiation factor eIF4E, for inhibiting cell-proliferation.... Agent: Alston & Bird LLP

20100160220 - Compositions and methods for improving bone mass through modulation of novel receptors of pth and fragments thereof: The present invention relates to the discovery of novel receptors for the signaling of PTH and/or fragments of PTH, and the role of cPTH in bone development. The novel PTH receptors identified are selected from the group consisting of LRP5/6, TGFβRII, BMPRII (long form and short form), ActRIIA, and ActRIIB.... Agent: Sutherland Asbill & Brennan LLP

20100160237 - Dry feedstuff for controlling excess weight and obesity of dogs: The invention concerns a dry feedstuff designed to feed dogs containing at least 35% of proteins relative to dry matter, and/or a protein input more than 110 grams per 1 000 kcal of metabolizable energy, and its use as food, additive or veterinary medicine in particular for controlling excess weight... Agent: Jones Day

20100160221 - Effect of tula on hiv: A method of inhibiting a retrovirus production, the method includes administering a retrovirus inhibitor selected from at least one of a TULA protein, a fragment of TULA containing a UBA domain, a UBA domain of TULA, a peptide mimicking TULA, a peptide mimicking a fragment of TULA containing a UBA... Agent: Caesar, Rivise, Bernstein, Cohen & Pokotilow, Ltd.

20100160216 - Enhanced transport using membrane disruptive agents: Compositions and methods for transport or release of therapeutic and diagnostic agents or metabolites or other analytes from cells, compartments within cells, or through cell layers or barriers are described. The compositions include a membrane barrier transport enhancing agent and are usually administered in combination with an enhancer and/or exposure... Agent: Christensen, O'connor, Johnson, Kindness, PLLC

20100160235 - Fgf homologs compositions and uses thereof: The present invention relates to methods of using zFGF5 compositions to proliferate chondrocytes and their progenitors, and to induce deposition of cartilage. zFGF5 compositions are disclosed for treating disorders associated with chondrocytes, such as cartilage injuries and defects. In addition, methods for treating neurological disorders, such as stroke, are disclosed,... Agent: Woodcock Washburn LLP

20100160225 - Lefty, lefty derivatives and uses thereof: The disclosure relates to Lefty derivatives and the uses of Lefty polypeptides as antagonists of the function of certain ligands such as Nodal, GDF-8 (Myostatin), and GDF-11. These derivatives may be fused to other functional heterologous proteins such as IgG, especially the Fc portion of IgG. According to the disclosure,... Agent: Ropes & Gray LLP

20100160228 - Method for inhibiting or stimulating angiogenesis in an individual: The invention concerns a method for inhibiting vascular endothelial growth factor receptor 2 (VEGFR2) signalling in an individual by administering an effective amount of an agent capable of activating T cell protein tyrosine phosphatase (TCPTP), and a method for inhibiting angiogenesis and treating or preventing diseases related thereto. Furthermore, this... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20100160236 - Method for preventing formation of trisulfide derivatives of polypeptides: A method for reducing or substantially preventing formation of a trisulfide derivative of a polypeptide in a liquid medium containing the polypeptide ijn question comprises stripping the liquid medium with a gas, suitably a chemically unreactive gas such as nitrogen or argon.... Agent: Novo Nordisk, Inc. Intellectual Property Department

20100160219 - Novel polypeptides inducing dendritic cell migration, as well as medicines and pharmaceutical compositions containing same: The invention concerns a polypeptide corresponding to amino acids 26 to 75 of the sequence of GRA5-RH protein of SEQ ID No 1: MASVKRVWAVMIVNVLALIFVGVAGSTRDVGSGGDDSEGARGRE QQQVQQHEQNEDRSLFERGRAAVT-GHPVRTAVGLAAAWAWSLL RLLKRRRRRAIQEESKESATAEEEEVAEEE, its variants acting on dendritic cell migration, homologues acting on dendritic cell migration, and fragments thereof acting on dendritic cell migration, as well as... Agent: Clark & Brody

20100160232 - Physiologically active complex comprising protamine and/or salt thereof and an acidic macromolecular substance, and use thereof: e

20100160224 - Shelf-stable consumable compositions containing probiotic-mimicking elements and methods of preparing and using the same: A shelf-stable consumable composition may comprise one or more Probiotic-Mimicking Elements (PMEs) wherein the median particle size of the one or more PMEs is less than the median particle size of a probiotic from which the one or more PMEs were derived. In some embodiments, the median particle size of... Agent: Cox Smith Matthews Incorporated

20100160227 - Signaling peptides: The present invention provides novel peptides of specified sequence and their use as a signal peptide or a membrane-anchoring peptide. It also relates to chimeric polypeptide comprising one or more such peptides and a polypeptide of interest as well as nucleic acid molecules, vectors, infections vital particles and host cells... Agent: Buchanan, Ingersoll & Rooney PC

20100160223 - Synergetic effects of hgf and antibacterial treatment: A method of treating an infection and/or an injury caused or complicated by an infection in a mammal, comprising providing an antibiotic or fungicide and either HGF or a polypeptide exhibiting HGF activity to said mammal. In one embodiment, the injury is not a chronic skin ulcer.... Agent: Porter Wright Morris & Arthur, LLP Intellectual Property Group

20100160229 - Treatment of early-stage osteoarthritis: A method for treating early-stage osteoarthritis in an animal is provided. The method comprises delivery of a therapeutically effective amount of a parathyroid hormone (PTH) or a PTH derived substance to an affected joint cavity of the patient. Methods for inhibiting articular chondrocytes apoptosis and for inhibiting a degenerative process... Agent: Dechert LLP

20100160222 - Treatment of psoriasis through down-regulation of the egf-receptor with topically applied egf: A topical formulation containing epidermal growth factor for treating psoriasis is described.... Agent: Mdip LLC

20100160230 - Ubiquitin and ubiquitin related molecules for treatment and prevention of harmful activation of the immune system: Compositions and methods for suppressing the immune system of a mammal using ubiquitin and derivatives and analogs thereof.... Agent: Venable LLP

20100160226 - Y-receptor agonists: Human Pancreatic Polypeptide mutants are provided which have utility, inter alia, for regulation of energy intake or energy metabolism, control of intestinal secretion, decrease of gastrointestinal tract motility, decrease of rate of gastric emptying, treatment of obesity or overweight, or conditions in which obesity or overweight is a contributory factor.... Agent: Banner & Witcoff, Ltd.

20100160239 - Peptide nucleic acid based guanidinium compounds: Disclosed herein are transmembrane transporter compounds containing guanidinium groups to enhance transport across biomembranes. Therapeutic and other biologically active moieties may be attached to the compounds. The transmembrane transporter compounds may include peptide nucleic acid monomer units.... Agent: Knobbe Martens Olson & Bear LLP

20100160238 - Tgfp-cap peptide and its uses: The present invention relates to a GFP-CAP peptide having an amino acid sequence derived from TGF-β1 (transforming growth factor-β1) and a cell adhesion sequence, wherein the amino acid sequence derived from TGF-β1 consists of the amino acid sequence of SEQ ID NO:1 and the TGFP-CAP peptide is represented by the... Agent: Clark & Elbing LLP

20100160240 - Treatment for epilepsy: The invention provides methods of treating a patient having epilepsy in which an effective regime of an agent that inhibits specific binding of PSD-95 to an NMDA receptor is administered to a patient.... Agent: Townsend And Townsend And Crew, LLP

20100160241 - Novel compound having gpr54 agonistic activity: e

20100160242 - Antibacterial deodorant: By selecting one or more deodorizing agents from among glycine, cysteine and glycylglycine, and incorporating the selected deodorizing agent(s) and a surfactant, the toxicity of the surfactant to men and beasts is controlled without inhibiting the antibacterial actions that the surfactant has inherently. Glycine, cysteine, and glycylglycine each have a... Agent: Flynn Thiel Boutell & Tanis, P.C.

20100160243 - Compounds and methods for enhancing erythropoiesis: Compounds and methods for enhancing erythropoiesis. The compound contains a chemical structure of the formula (I) indicated below, in which R is a glucosyl group. In addition to having an erythropoiesis effect, the compound of the formula (1) is effective in enhancing erythropoietin formation, and increasing kidney function and expression... Agent: Ipc Intellectual Property Connections, Inc.

20100160244 - Methods and compositions for enhancing collagen, proteoglycan, and glutathione synthesis in the skin: A composition for application to the skin can stimulate the in vivo synthesis of collagen and proteoglycans and improve the appearance of the skin, increasing its elasticity and fullness. In general, a composition according to the present invention comprises: (1) an antioxidant compound in a quantity sufficient to enhance collagen... Agent: Law Offices Of Michael B. Farber

20100160245 - Quercetin-containing compositions: This invention relates to a composition containing quercetin, vitamin B3, and vitamin C. Also disclosed is a method of using the composition for enhancing physical or mental performance or treating various diseases or disorders.... Agent: Occhiuti Rohlicek & Tsao, LLP

20100160246 - Microspheres for treatment of brain tumors: There is provided a new use of microspheres comprising a water-insoluble, water-swellable polymer which is anionically charged at pH7, and electrostatically associated with the polymer, in releasable form, a cationically charged chemotherapeutic agent, in the manufacture of a composition for use in the treatment of a brain tumour, wherein in... Agent: Sughrue Mion, PLLC

20100160247 - Synthesis of deuterated morpholine derivatives: e

20100160413 - Double-stranded ribonucleic acids with rugged physico-chemical structure and highly specific biologic activity: The invention relates to our discovery of a novel double-stranded ribonucleic acid (dsRNA) having specific biological activities, which includes acting as a selective agonist for activation of the Toll-like receptor 3. Its “rugged” molecular structure as measured by physico-chemical techniques is resistant to molecular unfolding (i.e., denaturation). This structure appears... Agent: Nixon & Vanderhye, PC

20100160412 - Methods of modulating metabolic memory: Described are methods of identifying modulators of metabolic memory, for the treatment of microvascular complications of diabetes, as well as methods of use thereof. Also described are methods of treating microvascular complications of diabetes by decreasing expression and/or activity of SHP-1.... Agent: Fish & Richardson PC

20100160414 - Treating picornavirus infection by targeting microrna mir-141: Treatment of picornavirus infection by inhibiting miR-141 activity. Also disclosed herein are a method for identify miR-141 inhibitory compounds and a method for identifying a target viral infection to be treated by anti-miR-141 therapy.... Agent: Occhiuti Rohlicek & Tsao, LLP

20100160417 - Chromosome therapy: The present invention features compositions and methods for introducing, into cells, nucleic acids whose expression results in chromosomal silencing. The nucleic acids are targeted to specific chromosomal regions where they subsequently reduce the expression of deleterious genes, or cause the death of deleterious cells. Where the nucleic acid sequence is... Agent: Fish & Richardson PC

20100160415 - Compositions and methods for treatment of autoimmune disease: Disclosed are improved methods for the treatment or prevention of an autoimmune disease comprising administration of a modified self-vector encoding and capable of expressing a self-polypeptide that includes one or more pathogenic epitopes associated with the autoimmune disease. The improved method of the present invention includes the administration to a... Agent: Townsend And Townsend And Crew, LLP

20100160418 - Compositions and methods for vaccinating against hsv-2: This invention relates to a method for systemic immune activation which is effective for eliciting both a systemic, non-antigen specific immune response and a strong antigen-specific immune response in a mammal. The method is particularly effective for protecting a mammal from herpes simplex virus. Also disclosed are therapeutic compositions useful... Agent: Sughrue Mion , PLLC

20100160419 - Compositions and methods for vaccinating against hsv-2: This invention relates to a method for systemic immune activation which is effective for eliciting both a systemic, non-antigen specific immune response and a strong antigen-specific immune response in a mammal. The method is particularly effective for protecting a mammal from herpes simplex virus. Also disclosed are therapeutic compositions useful... Agent: Sughrue Mion, PLLC

20100160421 - Influenza vaccines: Described herein are vaccines and the use of naked DNA and/or RNA encoding hemagglutinin (HA) from pandemic influenza, e.g., the 1918 H1N1 and/or the 1957 H2N2 and/or the 1968 H3N2 influenza A virus, as a vaccine component against present day and coming H1, H2, H3, H5, N1, N2 containing influenza... Agent: Howson & Howson LLP

20100160420 - Novel simian t-cell lymphotropic virus: Disclosed are the simian T-cell lymphotropic virus type 3 subtype D (STLV-3 subtype D), isolated nucleic acid molecules encoding STLV-3 subtype D polypeptides, such as STLV-3 subtype D envelope, protease, polymerase, tax, rex, and capsid polypeptides, isolated polypeptides encoded by such nucleic acids. Methods are also disclosed for detecting STLV-3... Agent: Klarquist Sparkman, LLP

20100160416 - Use of pol iii promoters for controlled expression of therapeutic proteins: The present invention relates generally to the field of molecular biology. More specifically, the present invention relates to expression systems for use in modulating the expression of protein coding target genes in vivo or in vitro. More specific, this invention relates to RNA polymerase III-based methods and systems for expression... Agent: Joyce Von Natzmer Pequignot + Myers LLC

20100160248 - Isotopically modified compounds and their use as food supplements: A nutrient composition comprises an essential nutrient in which at least one exchangeable H atom is 2H and/or at least one C atom is 13C. The nutrient is thus protected from, inter alia, reactive oxygen species.... Agent: Knobbe Martens Olson & Bear LLP

20100160249 - Nanoparticle derivatives of gemcitabine: The use of squalenic acid or a derivative thereof in formulating at least one polar active principle with a molecular weight of 100 Da or more, in the form of nanoparticles, and pharmaceutical compositions thereof.... Agent: Young & Thompson

20100160250 - Method for treating inflammatory conditions: This invention provides a method for inhibiting the release of interleukin-1β in a mammal. This invention also provides a method for preventing or treating pulmonary diseases, ophthalmic diseases, and autoimmune diseases that are associated with inflammation or inflammatory conditions. The invention also provides a method for preventing or treating neurodegenerative... Agent: Howery LLP

20100160251 - Imidazo compounds: i

20100160252 - Ophthalmic compositions containing mucoadhesive polysaccharides able to promote corneal re-epithelization:

20100160253 - Sulphated xylans for treatment or prophylaxis of respiratory diseases: The present invention relates generally to agents and medicinal protocols useful in the prophylaxis and/or treatment of respiratory diseases or conditions such as asthma, allergic rhinitis and chronic obstructive pulmonary disease (COPD). More particularly, the present invention relates to the use of a sulfated xylan or a derivative or homolog... Agent: Brooks Kushman P.C.

20100160254 - Cellulose sulfate for the treatment of rhinovirus infection: The present invention provides the use of a polymer for the manufacture of an antiviral pharmaceutical composition for the treatment of a rhinovirus infection, wherein the polymer is cellulose sulfate.... Agent: Fulbright & Jaworski L.L.P.

20100160256 - Indazole compounds: Provided are compounds represented by the following formula (A-1) and formula (1), or salts thereof. The compounds of formula (A-1) and formula (1) or salts thereof have 133 adrenergic receptor agonist activity, and thus are useful as therapeutic and prophylactic agent for diabetes mellitus, obesity, hyperlipidemia, depression, diseases caused by... Agent: Greenblum & Bernstein, P.L.C

20100160255 - Spiro-cyclic compound: or a salt thereof. The compound of the present invention has an ACC inhibitory activity, is useful for the prophylaxis or treatment of obesity, diabetes, hypertension, hyperlipidemia, cardiac failure, diabetic complications, metabolic syndrome, sarcopenia and the like, and has superior properties in the efficacy, duration of activity, specificity, low toxicity... Agent: Sughrue Mion, PLLC

20100160257 - Use of hdac inhibitors for the treatment of myeloma: wherein the radicals and symbols have the meanings as defined in the specification, for the preparation of a medicament for the treatment of myeloma, in particular, multiple myeloma, especially myeloma which is resistant to conventional chemotherapy; to a combination comprising an HDAC inhibitor and a compound effecting apoptosis of myeloma... Agent: Novartis Corporate Intellectual Property

20100160258 - Bicyclic aryl sphingosine 1-phosphate analogs: Compounds that have agonist activity at one or more of the S1P receptors are provided. The compounds are sphingosine analogs that, after phosphorylation, can behave as agonists at S1P receptors.... Agent: Steptoe & Johnson LLP

20100160259 - Dosage regimen for a s1p receptor agonist: S1P receptor modulators or agonists are administered following a dosage regimen whereby during the initial days of treatment the daily dosage is lower than the standard daily dosage... Agent: Novartis Corporate Intellectual Property

20100160260 - Trbd-binding effectors and methods for using the same to modulate telomerase activity: The present invention embraces compounds selected for interacting with the T-pocket of telomerase and use thereof for modulating the activity of telomerase and preventing or treating diseases or conditions associated with telomerase.... Agent: Jane Massey Licata Licata & Tyrrell P.C.

20100160261 - Polyunsaturated fatty acid monoglycerides, derivatives, and uses thereof: There are provided various polyunsaturated fatty acid monoglycerides and derivatives thereof. These compounds can be useful as cancer chemopreventive agents, cancer treating agent, inhibiting tumor growth or cell proliferation, reducing tumor growth or as radioenhencers for radiotherapy of cancer.... Agent: Bereskin And Parr LLP/s.e.n.c.r.l., S.r.l.

20100160262 - Compositions and methods for modulating sirtuin activity: The present invention provides treatment methods involving modulating a sirtuin activity and/or a sirtuin mRNA and/or a sirtuin polypeptide level. In some embodiments, the present invention provides treatment methods involving modulating SIRT1 activity and/or SIRT mRNA and/or polypeptide level. The present invention provides methods of inhibiting SIRT1 Tat deacetylase activity.... Agent: Bozicevic, Field & Francis LLP

20100160265 - 7, 8 and 9-substituted tetracycline compounds: 7, 8 and 9-substituted tetracycline compounds, methods of treating tetracycline responsive states, and pharmaceutical compositions containing the 7, 8 and 9-substituted tetracycline compounds are described.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100160263 - 7,9-substituted tetracycline compounds: The present invention pertains to novel 7,9-substituted tetracycline compounds. These tetracycline compounds can be used to treat numerous tetracycline compound-responsive states, such as bacterial infections and neoplasms, as well as other known applications for minocycline and tetracycline compounds in general, such as blocking tetracycline efflux and modulation of gene expression.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100160264 - Crystalline solid forms: The present invention relates to the new crystalline solid form VI and VIII of tigecycline and processes for the production of form VI and VIII. It further relates to a new method for preparing Form I and Form III in high polymorphic purity.... Agent: Manelii Denison & Selter PLLC

20100160266 - Organic compounds: A pleuromutilin in the form of a salt with salicylic acid, azelaic acid, sebacic acid or 2-[(2,6-dichlorophenyl)amino]benzeneacetic acid.... Agent: Workman Nydegger 1000 Eagle Gate Tower

20100160267 - Treatment of inflammatory bowel disease with 2-methylene-19-nor-vitamin d compounds: A method of preventing and/or treating inflammatory bowel disease, particularly ulcerative colitis and Crohn's disease, is disclosed. The method involves administering a 2-methylene-19-nor-vitamin D compound in an amount effective to treat the disease. The administration of a 2-methylene-19-nor-vitamin D compound also prevents the development of or delays the onset of... Agent: Andrus, Sceales, Starke & Sawall, LLP

20100160268 - Isoflavonoid analogs and their metal conjugates as anti-cancer agents: A pharmacologic agent for treating and/or preventing cancer, among other diseases and conditions, and particularly breast, prostate, and pancreatic cancer, in humans and animals. The novel pharmacologic agent is an isoflavonoid or isoflavonoid mimetic covalently attached to a cytotoxic pharmacophore that, preferably has the ability to conjugate with a metal... Agent: Rohm & Monsanto, PLC

20100160271 - Bicyclic modulators of h1 receptors: The present invention relates to new bicyclic modulators of H1 receptor activity, pharmaceutical compositions thereof, and methods of use thereof... Agent: Global Patent Group - Apx

20100160273 - Controlled delivery system of antifungal and keratolytic agents for local treatment of fungal infections of the nail and surrounding tissues: A topical sustained release delivery system for delivery of antifungal agents to the finger or toenails achieving high penetration through the nails by combining the antifungal agent with a keratolytic agent and a humectant. The pharmaceutical sustained release topical preparation is provided in a varnish or spray form for treating... Agent: Taro Pharmaceuticals U.s.a., Inc. C/o Venable LLP

20100160272 - Oxepine modulators of h1 receptors and/or inhibitors of mast cell degranulation: The present invention relates to new oxepine modulators of H1 receptors and/or inhibitors of mast cell degranulation, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20100160269 - Use of n-(dibenz(b,f)oxepin-10-ylmethyl)-n-methyl-n-prop-2-ynylamine or a pharmaceutically acceptable addition salt thereof for the prophylaxis and/or treatment of muscular dystrophy: e

20100160270 - Use of testosterone and a 5-ht1a agonist in the treatment of sexual dysfunction: The invention relates to the field of male and/or female sexual dysfunction. The invention specifically relates to the use of testosterone and a 5-HT1A agonist.... Agent: Morrison & Foerster LLP

20100160274 - 7-keto dhea for psychiatric use: The present invention relates to the use of 3-acetyl-7-oxo-dehydroepiandrosterone (7-keto DHEA) in the preparation of a medicament to treat or ameliorate psychiatric conditions. The present invention relates to methods of using compositions comprising 7-keto DHEA to treat or ameliorate psychiatric conditions. These methods include administering an effective amount of a... Agent: John S. Pratt, Esq Kilpatrick Stockton, LLP

20100160275 - Methods and compositions for cancer prevention and treatment: The present invention relates to methods and compositions for cancer prevention and treatment. In particular, the present invention provides methods and compositions for modulating, studying, preventing and treating progesterone receptor related carcinogenesis with anti-progesterones and anti-estrogens.... Agent: Casimir Jones, S.c.

20100160276 - Synthetic bile acid compositions and methods: Bile acids and related compositions and methods of synthesis and use. More specifically, deoxycholic acid and related compositions, said compositions being free of all moieties of animal origin and free of pyrogenic moieties.... Agent: Kythera Biopharmaceuticals, Inc. C/o Swiss Tanner, P.C.

20100160277 - Compositions for combating beta-lactamase-medicated antibiotic resistance using beta-lactamase inhibitors useful for injection: The invention describes a composition for combating beta-lactamase-mediated antibiotic resistance using beta-lactamase inhibitor useful for injection, capable of pharmaceutical application. The invention relates to pharmaceutical composition containing ceftriaxone (normally as ceftriaxone sodium) and sulbactam (normally as sulbactam sodium). Such compositions are found to be useful for intramuscular or intravenous administration... Agent: Amin Talati, LLC

20100160278 - Stabilized freeze-dried formulation for cephalosporin derivatives: The present invention relates to a freeze-dried formulation for cephalosporin derivatives having increased stability, a solution for obtaining and a method for preparing such a formulation, as well as the use of certain compounds for stabilizing cephalosporin derivatives in freeze-dried formulations. The compounds preferably used as stabilizers according to the... Agent: Gibbons P.C.

20100160279 - Azetidine derivatives as muscarinic receptor antagonists: The invention relates to compounds of formula (I) processes and intermediates for their preparation, their use as muscarinic antagonists and pharmaceutical compositions containing them.... Agent: Pfizer Inc. Patent Department

20100160283 - Heteroaryl-substituted alkyne compounds and method of use: wherein A1, A2, A3, A4, R1 and R2 are defined herein. Accordingly, the invention also comprises pharmaceutical compositions comprising the compounds of the invention, methods for the prophylaxis and treatment of kinase mediated diseases using the compounds and compositions of the invention, and intermediates and processes useful for the preparation... Agent: Amgen Inc.

20100160281 - Monocarbams: e

20100160282 - Novel diphenylazetidinones, process for their preparation, medicaments comprising these compounds and their use:

20100160284 - Carbapenem antibacterials with gram-negative activity and processes for their preparation: The present invention provides β-methyl carbapenem compounds and pharmaceutical compositions useful in the treatment of bacterial infections and methods for treating such infections using such compounds and/or compositions. The invention includes administering an effective amount of a carbapenem compound or salt and/or prodrug thereof to a host in need of... Agent: King & Spalding

20100160285 - Biphenyloxyacetic acid derivatives for the treatment of respiratory disease: The invention relates to substituted phenoxyacetic acids of formula (I), where the variables are as defined in claim 1, as useful pharmaceutical compounds for treating respiratory disorders, pharmaceutical compositions containing them, and processes for their preparation.... Agent: Fish & Richardson P.C.

20100160287 - Compounds useful as inhibitors of janus kinases: The present invention relates to compounds useful as inhibitors of protein kinases, particularly of JAK family kinases. The invention also provides pharmaceutically acceptable compositions comprising said compounds and methods of using the compositions in the treatment of various disease, conditions, or disorders.... Agent: Vertex Pharmaceuticals Inc.

20100160286 - Heteroarylcarbamoylbenzene derivatives for the treatment of diabetes: e

20100160288 - Purine compounds:

20100160289 - Sulfonamides as trpm8 modulators:

20100160280 - Aminopyridine and carboxypyridine compounds as phosphodiesterase 10 inhibitors: or a pharmaceutically acceptable salt thereof, wherein m, n, y, R2, R3, R4, R5, R6, R7, R9, X1, X2, and ring A are as defined in the specification; compositions containing them, and processes for preparing such compounds. Provided herein also are methods of treating disorders or diseases treatable by inhibition... Agent: Amgen Inc.

20100160290 - Pharmaceutical composition for treating alzheimer's disease:

20100160291 - Tricyclic spiro-oxindole derivatives and their uses as therapeutic agents: This invention is directed to tricyclic spiro-oxindole derivatives of formula (I), wherein j, k, m, n, w, q, Y, Q, X, R1, R2 and R3 are as defined herein, as a stereoisomer, enantiomer, tautomer thereof or mixtures thereof; or a pharmaceutically acceptable salt, solvate or prodrug thereof, which are useful... Agent: SeedIPLaw Group PLLC

20100160292 - Kinase inhibitors, and methods of using and identifying kinase inhibitors: Methods of inhibiting BTK activity by inhibiting phosphorylation of Y551 of BTK, methods of treating patients by inhibiting BTK activity by inhibiting phosphorylation of Y551 of BTK, chemical entities that bind to BTK and inhibited complexes are provided.... Agent: Millen, White, Zelano & Branigan, P.C.

20100160293 - Solid ophthalmic drug for external use: An ophthalmic solid pharmaceutical preparation for external use is disclosed which can be used to continuously administer with ease a pharmacologically active agent to ocular local tissues. The pharmaceutical preparation is a solid pharmaceutical preparation containing a pharmacologically active ingredient in a base, which may comprise an oily base, and... Agent: Hamre, Schumann, Mueller & Larson, P.C.

20100160294 - Tolerability of mirtazapine and a second active by using them in combination: A reduction in the side effects of treating with an agent having combined 5HT2/5HT3 and alpha-2 antagonistic activity is obtained by administering an agent having selective norepinephrine reuptake inhibitory or histamine H1 agonist activity. A combined dosage form comprising an agent having 5HT2/5HT3 and alpha-2 antagonistic activity and an agent... Agent: Wilson, Sonsini, Goodrich & Rosati

20100160295 - Treatment of restless leg syndrome and sleep disorders: Methods of preventing and/or treating at least one symptom of Restless Leg Syndrome (RLS) and its related disorders, including disorders such as periodic limb movements in sleep (PLMS) and periodic limb movement disorder (PLMD), are disclosed. The methods comprise identifying a host, afflicted with Restless Leg Syndrome (RLS) and its... Agent: Morgan, Lewis & Bockius LLP (sf)

20100160296 - Use of imipramine blue and analogs thereof in treating cancers: Compounds, pharmaceutical compositions including the compounds, and methods of preparation and use thereof are disclosed. The compounds are triphenyl methane analogs. The compounds and compositions can be used to treat and/or prevent a wide variety of cancers, including drug resistant cancers, inflammatory, degenerative and vascular diseases, and parasitic infections. The... Agent: Intellectual Property / Technology Law

20100160297 - Compounds for pim kinase inhibition and for treating malignancy: The present invention relates to the compounds of formula I as well as to their use as PIM kinase inhibitors and, thereby, their use for treating oncological diseases, particularly of the hematopoietic system, the liver and the prostate gland.... Agent: Foley And Lardner LLP Suite 500

20100160298 - Method of treating ocular allergy: The topical use of 5,6,7-trihydroxyheptanoic acid and analogs alone or in combination with histamine antagonists and/or mast cell stabilizers is disclosed for the treatment of ocular allergy.... Agent: Alcon

20100160299 - Dendrimer conjugates: The present invention relates to novel therapeutic and diagnostic dendrimers. In particular, the present invention is directed to dendrimer-linker conjugates, methods of synthesizing the same, compositions comprising the conjugates, as well as systems and methods utilizing the conjugates (e.g., in diagnostic and/or therapeutic settings (e.g., for the delivery of therapeutics,... Agent: Casimir Jones, S.c.

20100160300 - Method of treating depression: Methods for treatment of depression-related mood disorders in mammals, particularly humans are disclosed. The methods of the invention include administration of compounds capable of enhancing glutamate transporter activity in the brain of mammals suffering from depression. ATP-sensitive K+ channel openers and β-lactam antibiotics are used to enhance glutamate transport and... Agent: Brookhaven Science Associates/ Brookhaven National Laboratory

20100160301 - Microangiopathy treatment and prevention: t

20100160302 - Novel dipeptidyl peptidase iv inhibitors and processes for their preparation and pharmaceutical compositions containing them: The present invention relates to novel compounds representated by formula (I), where R, R1, R2, R3, X, Y, m, n are as defined. The present invention relates to compounds of the general formula I their derivatives, their analogs, their tautomeric forms, their stereoisomers, their diastereomers, their bioisosteres, their polymorphs, their... Agent: Ladas & Parry LLP

20100160303 - Carbazole carboxamide compounds useful as kinase inhibitors: e

20100160305 - 3, 4, 5 - substituted piperidine compounds:

20100160306 - Acylated piperidine derivatives as melanocortin-4 receptor agonists: Certain novel 4 alkyl substituted N acylated piperidine derivatives are ligands of the human melanocortin receptor(s) and, in particular, are selective ligands of the human melanocortin-4 receptor (MC-4R). They are therefore useful for the treatment, control, or prevention of diseases and disorders responsive to the modulation of MC-4R, such as... Agent: Merck

20100160304 - Aromatic sulfone compound as aldosterone receptor modulator: etc., R1 and R2 each independently represent a hydrogen atom etc., Z represents CR3 etc., W represents CR4 etc., Q represents CR5 etc., R3, R4 and R5 each independently represent a hydrogen atom etc., Y represents an oxygen atom or sulfur atom, X represents an oxygen atom etc. and B... Agent: Sughrue Mion, PLLC

20100160307 - Method for controlling particular insect pests by applying anthranilamide compounds: c

20100160308 - Thiazolyl-benzimidazoles:

20100160309 - Inhibitors of janus kinases and/or 3-phosphoinositide-dependent protein kinase-1: The instant invention provides for compounds that inhibit JAK2 tyrosine kinase and/or PDK1. The invention also provides for compositions comprising such inhibitory compounds and methods of inhibiting JAK2 tyrosine kinase activity and/or PDK1 kinase inhibitory activity by administering the compound to a patient in need of treatment or prevention of... Agent: Merck

20100160310 - 2,4 (4,6) pyrimidine derivatives: e

20100160311 - Fungicidal azolopyrimidines, process for their preparation and their use for controlling harmful fungi, and also compositions comprising them:

20100160312 - Substituted pyridone compounds and methods of use:

20100160313 - Discovery of novel anticancer compounds based on conformational sampling of quinoxalinhydrazide pharmacophore: The present invention relates in general to anti-cancer drug design. More specifically, the invention provides methods of mapping and screening for anti-cancer agents using pharmacophore models. The invention demonstrates that, conformational sampling of a small lead molecule, followed by representative pharmacophore model development, is an efficient approach for rational design... Agent: Hogan & Hartson L.L.P.

20100160317 - 2-(2-oxoindoline-3-ylidene)methyl-5-(2-hydroxy-3-morpholin-4-yl-propyl)-6,7-dihydro-1h-pyrrol[3,2-c]pyridine-4(5h)-one compounds and use as protein kinase inhibitors: Pyrrolo[3,2-c]pyridine-4-one-2-indolinone compounds, especially 2-(2-oxoindoline-3-ylidene)methyl-5-(2-hydroxy-3-morpholin-4-yl-propyl)-6,7-dihydro-1H-pyrrol[3,2-c]pyridine-4(5H)-one compounds. Their preparation and pharmaceutical composition, and pharmaceutical use as protein kinase inhibitors.... Agent: Hedman & Costigan P.C.

20100160315 - Novel 2, 3-diamino-quinazolinone derivatives and their medical use: This invention relates to novel 2,3-diamino-quinazolinone derivatives having medical utility, to use of the 2,3-diamino-quinazolinone derivatives of the invention for the manufacture of a medicament, to pharmaceutical compositions comprising the 2,3-diamino-quinazolinone derivatives of the invention, and to methods of treating a disorder, disease or a condition of a subject, which... Agent: Birch Stewart Kolasch & Birch

20100160316 - Quinazolines useful as modulators of ion channels: The present invention relates to compounds useful as inhibitors of voltage-gated sodium channels and calcium channels. The invention also provides pharmaceutically acceptable compositions comprising the compounds of the invention and methods of using the compositions in the treatment of various disorders.... Agent: Vertex Pharmaceuticals Inc.

20100160314 - Small molecule inhibitors of toll-like receptor 9: Small molecule compounds and compositions containing said compounds useful for inhibiting signaling by certain Toll-like receptors (TLRs), particularly TLR9, are provided. The compounds and compositions can be used to inhibit immune responses, including unwanted immune responses in particular. Compounds, compositions, and methods are provided to treat a variety of conditions... Agent: Pfizer Inc. Patent Department

20100160318 - 3-pyrrolo[b]cyclohexylene-2-dihydroindolinone derivatives and uses thereof: 3-pyrrolo[b]cyclohexylene-2-dihydro-indolinone derivatives of formula (I) or their pharmaceutically acceptable salts and uses thereof. The intermediates of formula (II) for preparing the above compounds. The bioassay shows that the above compounds and their pharmaceutically acceptable salts can modulate the activity of protein kinases (PKs), inhibit the activity of tyrosine kinases (PTKs)... Agent: GlobalIPServices

20100160320 - C5ar antagonists: Compounds are provided that are modulators of the C5a receptor. The compounds are substituted piperidines and are useful in pharmaceutical compositions, methods for the treatment of diseases and disorders involving the pathologic activation of C5a receptors.... Agent: Townsend And Townsend And Crew, LLP

20100160319 - Histamine h3 receptor agents, preparation and therapeutic uses: The present invention discloses novel compounds of Formula I or pharmaceutically acceptable salts thereof which have histamine-H3 receptor antagonist or inverse agonist activity, as well as methods for preparing such compounds. In another embodiment, the invention discloses pharmaceutical compositions comprising compounds of Formula I as well as methods of using... Agent: Eli Lilly & Company

20100160322 - Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases: Disclosed are compounds which inhibit the activity of anti-apoptotic Bcl-2 proteins, compositions containing the compounds and methods of treating diseases during which is expressed anti-apoptotic Bcl-2 protein.... Agent: Paul D. Yasger Abbott Laboratories

20100160321 - Imidazolinone and hydantoine derivatives as novel inhibitors of histone deacetylase: This invention comprises the novel compounds of Formula (I) wherein R1, R2, R3, X, Y and Z have defined meanings, having histone deacetylase inhibiting enzymatic activity; their preparation, compositions containing them and their use as a medicine.... Agent: Philip S. Johnson Johnson & Johnson

20100160323 - Novel piperazine derivatives as inhibitors of stearoyl-coa desaturase: The present invention relates to piperazine derivatives that act as inhibitors of stearoyl-CoA desaturase. The invention also relates to methods of preparing the compounds, compositions containing the compounds, and to methods of treatment using the compounds.... Agent: Forest Laboratories, Inc. Attn: Charles S. Ryan

20100160324 - Pyrazole derivatives as that modulate the activity of cdk, gsk and aurora kinases: The invention provides a compound of the formula (I): for use in medicine: or salts or tautomers or N-oxides or solvates thereof; wherein R1 is an optionally substituted heterocyclic group having from 3 to 12 ring members provided that the cyclic group joined to the pyrazole contains at least one... Agent: Heslin Rothenberg Farley & Mesiti PC

20100160325 - 4-(3-aminopyrazole) pyrimidine derivatives for use as tyrosine kinase inhibitors in the treatment of cancer: This invention relates to novel compounds having the formula (I) and to their pharmaceutical compositions and to their methods of use. These novel compounds provide a treatment for cancer.... Agent: Astrazeneca R&d Boston

20100160326 - Pest control agent containing novel pyridyl-methanamine derivative or salt thereof: wherein R1 is hydrogen, alkyl, alkenyl, alkynyl, aryl, a heterocyclic group, etc.; each of R2 and R3 which are independent of each other, is hydrogen, halogen, cyano, nitro, alkyl, cycloalkyl, alkenyl, alkynyl, aryl, a heterocyclic group, etc.; R4 is trifluoromethyl or chlorodifluoromethyl; R5 is hydrogen, halogen, cyano, nitro, alkyl, etc.;... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20100160327 - Modified malonate derivatives: The present invention relates to a novel class of modified malonate derivatives. The modified malonate compounds can be used to treat cancer. The modified malonate compounds can also inhibit histone deacetylase and are suitable for use in selectively inducing terminal differentiation, and arresting cell growth and/or apoptosis of neoplastic cells,... Agent: Merck

20100160328 - New compounds useful for dpp-iv enzyme inhibition: The present invention relates to the novel compounds of the general formula (I) possessing dipeptidyl peptidase IV enzyme inhibitory activity, pharmaceutical compositions thereof, methods of using said compounds, processes for their preparation and intermediates of the general formulae (II), (IV), (V), (VII), (VIII) and (IX).... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20100160332 - A2-adrenoceptor ligands: The adrenergic receptors or adrenoceptors are a family of G-protein coupled receptors split into α and β subclasses. The adrenoceptors have important roles in regulating a myriad of physiological conditions and their malfunction has been implicated in the pathophysiology of a number of diseases. Disclosed herein are a series of... Agent: Scully Scott Murphy & Presser, PC

20100160333 - Novel 3,9-diazabicyclo[3.3.1]nonane derivatives and their use as monoamine neurotransmitter re-uptake inhibitors: e

20100160330 - Novel bicyclic heterocycles useful as selective androgen receptor modulators: The present invention is directed to novel bicyclic heterocycles, pharmaceutical compositions containing them and their use in the treatment of disorders and conditions modulated by the androgen receptor.... Agent: Philip S. Johnson Johnson & Johnson

20100160331 - Novel carbamoyloxy arylalkan arylpiperazine compound, pharmaceutical compositions comprising the compound and method for treating pain, anxiety and depression by administering the compound: There is provided a novel carbamoyloxy arylalkanoyl arylpiperazine derivative compound having abundant racemic or enantiomeric characteristics, represented by the Formula 1, and pharmaceutically available salts or hydrates thereof. Also, there are provided a pharmaceutical composition for treating pain, anxiety or depression including an effective amount of the compound, and a... Agent: Gibbons P.C.

20100160329 - Use of condensed pyrimidine derivatives for the treatment of autoimmune and inflammatory diseases: The invention relates to the use of a compound of the formula (I), or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for use in modulating an immune or inflammatory response: wherein: Z=O or S; n=1-3; R3=—CO2R8, —C(O)SR8, —C(O)NHR8, —C(S)OR8, —C(S)SR8, —C(S)NHR8, —C(NH)SR8 or —C(NH)NHR8, wherein R8... Agent: Wolf Greenfield & Sacks, P.C.

20100160334 - Tricyclic anilide spirolactam cgrp receptor antagonists: The present invention is directed to compounds of Formula I: I (where A1, A2, B1, B2, B3, B4, D1, D2, J, K, T, U, V, W, X, Y, Z, R4, R5a, R5b, R5c, m and n are defined herein) useful as antagonists of CGRP receptors and useful in the treatment... Agent: Merck

20100160335 - Pyridazinone derivative and pde inhibitor containing the same as active ingredient: e

20100160336 - Azabicyclo (3.1.0) hexane derivatives useful as modulators of dopamine d3 receptors:

20100160337 - Sulfamides as trpm8 modulators:

20100160338 - Benzenesulfonamide modulators of alpha-1a adrenergic receptors: The present invention relates to new benzenesulfonamide modulators of alpha-1A adrenergic receptors, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20100160341 - Heteroaryl, heterocyclic and aryl compounds which inhibit leukocyte adhesion mediated by vla-4: Disclosed are compounds which bind VLA-4. Certain of these compounds also inhibit leukocyte adhesion and, in particular, leukocyte adhesion mediated by VLA-4. Such compounds are useful in the treatment of inflammatory diseases in a mammalian patient, e.g., human, such as asthma, Alzheimer's disease, atherosclerosis, AIDS dementia, diabetes, inflammatory bowel disease,... Agent: Swiss Tanner, P.C. P.o. Box 1749

20100160340 - Protein kinase inhibitors: s

20100160339 - Treating pancreatitis: This document provides methods and materials related to treating pancreatitis. For example, methods and materials relating to the use of a tyrosine kinase inhibitor to pancreatitis are provided.... Agent: Fish & Richardson P.C.

20100160342 - Compositions of topical ocular solutions to deliver effective concentrations of active agent to the posterior segment of the eye: The present invention relates to development of efficacious pharmaceutical compositions comprising an active agent, such as the free base or hydrochloride salt of tandospirone, for topical delivery to the eye for the treatment of retinal disorders.... Agent: Alcon

20100160343 - Heteroaryl, heterocyclic and aryl compounds which inhibit leukocyte adhesion mediated by vla-4: Disclosed are compounds which bind VLA-4. Certain of these compounds also inhibit leukocyte adhesion and, in particular, leukocyte adhesion mediated by VLA-4. Such compounds are useful in the treatment of inflammatory diseases in a mammalian patient, e.g., human, such as asthma, Alzheimer's disease, atherosclerosis, AIDS dementia, diabetes, inflammatory bowel disease,... Agent: Swiss Tanner, P.C. P.o. Box 1749

20100160344 - Novel compounds: This invention relates to imidazopyrimidine substituted piperidine derivatives and their use as pharmaceuticals.... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100160345 - Novel compounds: This invention relates to imidazopyrazine substituted piperidine derivatives and their use as pharmaceuticals.... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100160346 - Neurologically active compounds: The present invention relates to neurologically-active compounds, processes for their preparation and their use as pharmaceutical or veterinary agents, in particular for the treatment of neurological conditions, more specifically neurodegenerative conditions such as Alzheimer's disease.... Agent: Scully, Scott, Murphy & Presser, P.C.

20100160347 - Pyrido[1,2-a]pyrimidin-4-one inhibitors of mast cell degranulation: The present invention relates to new pyrido[1,2-a]pyrimidin-4-one inhibitors of mast cell degranulation, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20100160348 - Materials and methods for detecting and treating peritoneal ovarian tumor dissemination involving tissue transglutaminase: Tissue transglutaminase-2 (TG2) is involved in Ca++-dependent aggregation and polymerization of proteins. TG2 is upregulated in epithelial ovarian cancer (EOC) cells as compared to normal ovarian epithelium. TG2 is also highly expressed in ovarian tumors and secreted in malignant ascites, but it is not detected in non-transformed ovarian epithelium. Furthermore,... Agent: Baker & Daniels LLP

20100160349 - Triazolopyrimidine derivatives as glycogen synthase kinase 3 inhibitors: a N-oxide, a pharmaceutically acceptable addition salt, a quaternary amine and a stereochemically isomeric form thereof, wherein ring A represents phenyl, pyridyl, pyrimidinyl, pyridazinyl or pyrazinyl; R1 represents hydrogen; aryl; formyl; C1-6alkylcarbonyl; C1-6alkyl; C1-6alkyloxycarbonyl; C1-6alkyl substituted with formyl, C1-6alkylcarbonyl, C1-6alkyloxycarbonyl or C1-6alkylcarbonyloxy; X represents a direct bond; —(CH2)n3— or —(CH2)n4—X1a—X1b—;... Agent: Philip S. Johnson Johnson & Johnson

20100160351 - Pharmaceutical compositions and methods for treating hyperuricemia and related disorders: or a pharmaceutically acceptable salt thereof, wherein R1, R2, R3, R4, X and n are as defined herein; (b) a second therapeutic agent, wherein the second therapeutic agent is a uric acid synthesis inhibitor or a uricosuric agent; and (c) a pharmaceutically acceptable diluent or carrier.... Agent: Cooley Godward Kronish LLP Attn: Patent Group

20100160350 - Pyrazolopyrimidinone kinase inhibitor: The present invention provides a novel pyrazolo[3,4-d]pyrimidin-4-one, specifically a derivative of 1-(pyridine-4-yl)-pyrazolo[3,4-d]pyrimidin-4-one. This compound is a kinase inhibitor that shows unexpected anti-proliferative activity against cells, including against tumor cells, and anti-tumor activity in xenograft tumor models. The compound or a suitable salt or prodrug thereof is useful for the treatment... Agent: Leon R. Yankwich

20100160352 - Adenine derivatives: Novel adenine derivatives of the formula (I), in which R1, R2, R3, X and Y have the meanings indicated in Claim 1, are HSP90 inhibitors and can be used for the preparation of a medicament for the treatment of diseases in which the inhibition, regulation and/or modulation of HSP90 plays... Agent: Millen, White, Zelano & Branigan, P.C.

20100160353 - Pharmaceutical composition and beverage composition comprising l-arginine: A pharmaceutical composition and a beverage composition comprising the following three components (A), (B) and (C): (A) L-arginine or a salt thereof; (B) caffeine or a salt thereof; and (C) at least one substance selected from the group consisting of vitamin C or a derivative thereof, vitamin E or a... Agent: Hoffmann & Baron, LLP

20100160354 - Novel compounds: p

20100160355 - Anti-viral compounds: Compounds effective in inhibiting replication of Hepatitis C virus (“HCV”) are described. This invention also relates to processes of making such compounds, compositions comprising such compounds, and methods of using such compounds to treat HCV infection.... Agent: Paul D. Yasger Abbott Laboratories

20100160356 - Novel cyclobutyl compounds as kinase inhibitors: The invention relates to compounds of the formula I, to the preparation and use thereof for the preparation of a medicament for the treatment of diseases, in particular tumours and/or diseases in the formation or course of which protein kinases are involved.... Agent: Millen, White, Zelano & Branigan, P.C.

20100160357 - Heterobicyclic sphingosine 1-phosphate analogs: Compounds that have agonist activity at one or more of the S1P receptors are provided. The compounds are sphingosine analogs that, after phosphorylation, can behave as agonists at S1P receptors.... Agent: Steptoe & Johnson LLP

20100160359 - Modulators of metabolism and the treatment of disorders related thereto: The present invention relates to 4-[5-methyl-6-(2-methyl-pyridin-3-yloxy)-pyrimidin-4-yloxy]-piperidine-1-carboxylic acid isopropyl ester, pharmaceutically acceptable salts, solvates and hydrates thereof that are modulators of glucose metabolism. Accordingly, compounds of the present invention are useful in the treatment of metabolic-related disorders and complications thereof, such as, diabetes and obesity.... Agent: Fish & Richardson P.C.

20100160358 - Pyridylsulfonamidyl-pyrimidines for the prevention of blood vessel graft failure: The present invention relates to the use of a compound of formula (I), wherein R1 is pyridyl or thiazolyl, any of which may optionally be substituted with C1-8alkyl or C2-8alkenyl; and a) R2 is methoxy and n is zero or one; or b) R2 is chlorine and n is zero;... Agent: Wenderoth, Lind & Ponack, L.L.P.

20100160360 - Jnk modulators: e

20100160361 - Treatment of major adverse cardiac events and acute coronary syndrome using secretory phospholipase a2 (spla2) inhibitor or spla2 inhibitor combination therapies: Administration of sPLA2 inhibitors in combination with statins has been found to reduce major adverse cardiac events (MACEs), inflammatory biomarker levels, and LDL-C levels in subjects who have recently experienced an index ACS event to a significantly greater degree than statins alone. These results were unexpected given previous results showing... Agent: Perkins Coie LLP

20100160362 - Spiro (furo [3, 2-c] pyridine-3-3' -indol) -2' (1'h)-one derivatives and related compounds for the treatment of sodium-channel mediated diseases, such as pain: This invention is directed to methods of using spiro-oxindole compounds of formula (I): wherein j, k, m, Q, X, R1, R2a, R2b, R2c, R2d and R3 are as defined herein, as a stereoisomer, enantiomer, tautomer thereof or mixtures thereof; or a pharmaceutically acceptable salt, N-oxide, solvate or prodrug thereof, for... Agent: SeedIPLaw Group PLLC

20100160363 - Extended-release pharmaceutical formulations: The present invention provides matrix-forming, sustained-release pharmaceutical formulations comprising four primary components: i) an effective amount of at least one drug substance; ii) at least one pharmaceutically acceptable, water-swellable, pH independent polymer; iii) at least one pharmaceutically-acceptable, anionic, pH dependent polymer; and (iv) a pharmaceutically-acceptable polymer selected from the group... Agent: Ward And Smith, P.A.

20100160364 - Remedy or preventive for integration dysfunction syndrome: A composition includes a therapeutic or prophylactic agent for schizophrenia, which therapeutic or prophylactic agent can treat especially positive symptoms of schizophrenia and does not cause impaired information processing related to cognitive deficiencies or the like which is a symptom of schizophrenia. The therapeutic or prophylactic agent for schizophrenia includes... Agent: Ip Group Of Dla Piper LLP (us)

20100160365 - Treatment of non-hodgkin's lymphomas with multi-arm polymeric conjugates of 7-ethyl-10-hydroxycamptothecin: The present invention relates to methods of treatment of non-Hodgkin's lymphomas. The present invention includes administering polymeric prodrugs of 7-ethyl-10-hydroxycamptothecin to patients in need thereof.... Agent: Lucas & Mercanti, LLP

20100160366 - Treatment method: Methods of treating and/or preventing a cardiovascular disease in a human suffering from an allergic and/or inflammatory condition or cardiovascular disease by administrating an effective amount of loratadine, in combination with an effective amount of montelukast, for such treating and/or preventing are disclosed.... Agent: Merck Patent Department (k-6-1, 1990)

20100160367 - Pharmaceutical compositions containing pyrroloquinoline quinone and nephroprotectant for treating ischemia reperfusion injuries: The invention includes compositions comprising substantially purified pyrroloquinoline quinone, that are useful in methods for the treatment and prevention of cardiac injury caused by hypoxia or ischemia. The invention also includes methods for the treatment and prevention of cardiac injury comprising contacting a composition of the invention with a human... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100160368 - Methods of treating dermatological disorders and inducing interferon biosynthesis with shorter durations of imiquimod therapy: Pharmaceutical Formulations and Methods for the Topical and/or transdermal delivery of imiquimod, including creams, ointments and pressure-sensitive adhesive compositions to treat dermatological disorders, namely, viral infections, such as Type I or Type II Herpes simplex infections and genital and perianal warts, actinic keratosis and superficial basal cell carcinoma, and to... Agent: Edwards Angell Palmer & Dodge LLP

20100160369 - S1p1 agonists and methods of making and using: a

20100160370 - Method of treatment and pharmaceutical compositions: The present invention relates to methods, uses, and compositions comprising the caspase inhibitor (R)-N-((2S,3S)-2-(fluoromethyl)-2-hydroxy-5-oxo-tetrahydrofuran-3-yl)-5-isopropyl-3-(isoquinolin-1-yl)-4,5-dihydroisoxazole-5-carboxamide, or a pharmaceutically acceptable salt thereof.... Agent: Gilead Sciences Inc

20100160371 - Inhibition of p38 kinase activity by aryl ureas: This invention relates to the use of a group of aryl ureas in treating cytokine mediated diseases other than cancer and proteolytic enzyme mediated diseases other than cancer, and pharmaceutical compositions for use in such therapy.... Agent: Millen, White, Zelano & Branigan, P.C.

20100160372 - Treatment of proteinopathies using a farnesyl transferase inhibitor: Methods and pharmaceutical compositions comprising a low dose of a farnesyl transferase inhibitor useful in the treatment of proteinopathies are provided. These low doses are below the doses used in oncological treatments for which these compounds were initially designed. The treatment includes administering to a subject in need thereof a... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100160373 - Dihydropyridone amides as p2x7 modulators: t

20100160374 - N-(2-hydroxyethyl)-n-methyl-4-(quinolin-8-yl(1-(thiazol-4-ylmethyl)piperidin-4-ylidene)methyl)benzamide: N-(2-hydroxyethyl)-N-methyl-4-(quinolin-8-yl(1-(thiazol-4-ylmethyl)piperidin-4-ylidene)methyl)benzamide, pharmaceutically acceptable salts thereof, and/or mixtures thereof, as well as, pharmaceutical compositions thereof, methods of treatment therewith, and processes of making N-(2-hydroxyethyl)-N-methyl-4-(quinolin-8-yl(1-(thiazol-4-ylmethyl)piperidin-4-ylidene)methyl)benzamide and intermediates thereof.... Agent: Astra Zeneca Pharmaceuticals Lp Global Intellectual Property

20100160375 - Methods and compositions for treating infections comprising a local anesthetic: The present invention is directed to a drug depot useful for reducing, preventing or treating an infection in a patient in need of such treatment. The drug depot includes a polymer and a therapeutically effective amount of a local anesthetic or pharmaceutically acceptable salt thereof. The drug depot is administered... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20100160376 - Nicotine-alternative compositions and methods of producing such compositions: A method for producing a consumable nicotine-alternative composition includes measuring a quantity of a cigarette nicotine-alternative alkaloid and/or a larger quantity of lobeline. The quantities of cigarette nicotine-alternative alkaloid and/or lobeline are diluted into one or more successive intermediate solutions, a last of which constitutes a final solution. The final... Agent: Kelly Lowry & Kelley, LLP

20100160377 - Derivatives of pyrazole 3,5-carboxylates, their preparation and their application in therapeutics: in which R1, R2, R3, R4, R5, X, Y, V, W and n are as defined herein. The invention also relates to salts of these compounds as well as hydrates or of solvates, enantiomers, diastereoisomers and mixtures thereof. Also disclosed are the methods of preparation and application in therapeutics of... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20100160378 - Compositions for drug administration: The present invention provides compositions and methods and for increasing the bioavailability of therapeutic agents in a subject, as well as compositions and methods for providing migraine pain relief. The compositions include at least one alkyl glycoside and at least one therapeutic agent, such as a 5-HT receptor agonist, wherein... Agent: Dla Piper LLP (us)

20100160379 - Heterocycles substituted pyridine derivatives and antifungal agent containing thereof: wherein R1 represents a hydrogen atom, a halogen atom, an amino group, a C1-6 alkyl group, a C1-6 alkoxy group or a C1-6 alkoxy C1-6 alkyl group; R2 represents a hydrogen atom, a C1-6 alkyl group, an amino group or a di C1-6 alkylamino group; one of X and Y... Agent: Birch Stewart Kolasch & Birch

20100160382 - Anti-acid pharmaceutical composition in powder form and process for making it: An anti-acid pharmaceutical composition for the rapid and prolonged neutralization of gastric acidity with mucosa-protecting activity in powder form to prepare, by dispersion in water, a pharmaceutical solution or suspension for oral use characterized in that the composition includes sodium alginate; an anti-acid soluble agent or a combination of anti-acids;... Agent: Bachman & Lapointe, P.C.

20100160381 - Raf inhibitors for the treatment of thyroid cancer: The invention relates to the use of an Raf inhibitor for the manufacture of pharmaceutical compositions for the treatment of thyroid cancer, more specifically papillary thyroid cancer (PTC); the use of a Raf inhibitor in the treatment of thyroid cancer, more specifically PTC; a method of treating warm-blooded animals including... Agent: Novartis Corporate Intellectual Property

20100160380 - Therapeutic salt compositions and methods: Therapeutic salt compositions and methods are disclosed herein.... Agent: Goodwin Procter LLP Patent Administrator

20100160384 - Dihydropyridone amides as p2x7 modulators: e

20100160383 - Pyrazole carboxamide derivatives, pharmaceutical compositions and its preparation: A compound of formula (I) or pharmaceutically acceptable salts and/or solvates or hydrates thereof. A process for preparing the compound, a pharmaceutical composition comprising the compound and an application for resisting cannabinoid CB1 receptor are provided.... Agent: Kelly Lowry & Kelley, LLP

20100160385 - Fungicidal triphenyl-substituted pyridones: c

20100160386 - 4-phenoxy-nicotine acid derivatives and use thereof as ppar-modulators: The present invention relates to novel 4-phenoxy-6-phenyl- and 4-phenoxy-6-pyridylnicotinic acid derivatives, to processes for their preparation, to their use for the treatment and/or prophylaxis of diseases and to their use for producing medicaments for the treatment and/or prophylaxis of diseases, preferably for the treatment and/or prophylaxis of cardiovascular disorders, especially... Agent: Barbara A. Shimei Director, Patents & Licensing

20100160387 - Dihydropyridone amides as p2x7 modulators: e

20100160389 - Dihydropyridone amidesas p2x7 modulators:

20100160388 - Dihydropyridone ureas as p2x7 modulators:

20100160390 - Compounds capable of activating cholinergic receptors: Compounds incorporating aryl substituted olefinic amine are provided. Representative compounds are (4E)-N-methyl-5-(3-pyridyl)-4-penten-2-amine, (4E)-N-methyl-5-(5-pyrimidinyl)-4-penten-2-amine, (4E)-N-methyl-5-(5-methoxy-3-pyridyl)-4-penten-2-amine, (4E)-N-methyl-5-(6-amino-5-methyl-3-pyridyl)-4-penten-2-amine, (2R)-(4E)-N-methyl-5-(3-pyridyl)-4-penten-2-amine, (2R)-(4E)-N-methyl-5-(5-isopropoxy-3-pyridyl)-4-penten-2-amine, (4E)-N-methyl-5-(5-bromo-3-pyridyl)-4-penten-2-amine, (4E)-N-methyl-5-(5-ethoxy-3-pyridyl)-4-penten-2-amine, (2S)-(4E)-N-methyl-5-(3-pyridyl)-4-penten-2-amine, (4E)-N-methyl-5-(5-isopropoxy-3-pyridyl)-4-penten-2-amine and (2S)-(4E)-N-methyl-5-(5-isopropoxy-3-pyridyl)-4-penten-2-amine.... Agent: Womble Carlyle Sandridge & Rice, PLLC

20100160391 - Substituted aminopyridines as fluorescent reporters for amide hydrolases: The present invention provides conjugates comprising a substituted aminopyridine covalently attached to an organic molecule via an amide bond. Such conjugates find utility as substrates for amide hydrolases, where the substituted aminopyridine acts as a fluorescent reporter of amide hydrolase activity. As a result, the conjugates described herein can advantageously... Agent: Townsend And Townsend And Crew, LLP

20100160392 - Histone deacetylase inhibitors: The present invention provides histone deacetylase inhibitors of general formula (I), a process for the preparation of such compounds and uses of the compounds in medicine, especially in the treatment of cancers: in which R1 is an optionally substituted aryl, arylalkyl, heteroaryl, heterocycloalkenyl, cycloalkene ring, cycloalkyl, heterocycloalkyl or a combination... Agent: Pepper Hamilton LLP

20100160393 - Crystal form of epothilone b and use in pharmaceutical compositions: The invention relates to new crystal forms of epothilone B.... Agent: Novartis Corporate Intellectual Property

20100160394 - Use of 4-[(4- thiazolyl)phenoxy]alkoxy-benzamidine derivatives for the prophylaxis and treatment of osteoporosis: This invention relates to a pharmaceutical composition containing 4-[(4-thiazolyl)phenoxyl]alkoxy-benzamidine derivatives expressed by the following formula 1 for the prophylaxis and treatment of osteoporosis and more particularly, to the use of 4-{5-[4-(5-isoproply-2-methyl-1,3-thiazol-4-yl)phenoxyl]pentoxy}-benzamidine or N-hydroxy-4-{5-[4-(5-isopropyl-2-methyl-1,3-thiazol-4-yl)phenoxyl]pentoxy}-benzamidine expressed by the following formula 1 as a pharmaceutical composition for the prophylaxis and treatment of osteoporosis.... Agent: Arent Fox LLP

20100160395 - Cyclopropyl compounds: i

20100160396 - Insecticidal compositions of 2-cyanobenzene sulfonamide compounds and isomeric forms thereof having improved effect:

20100160397 - Oxazole derivatives and their use in the treatment of diabetes and obesity: wherein, for example, R1 is an optionally substituted aryl or optionally substituted heteroaryl group; T is N, CH or CMe; Y is a direct bond, or a defined linking group and R2 is an optionally substituted aryl, an optionally substituted cycloalkyl or an optionally substituted heterocyclic group; together with processes... Agent: Morgan Lewis & Bockius LLP

20100160398 - Farnesoid x receptor agonists: The present invention provides novel substituted isoxazole compounds, pharmaceutical compositions, therapeutic uses and processes for preparing the same.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B482

20100160399 - Fungicidal mixtures: The invention relates to a fungicidal mixture comprising prothioconazole or a salt or adduct thereof with an inorganic acid an organic acid or a metal ion; and at least one further fungicidal compound, selected from the group consisting of thiram, fenoxanil, benthivalicarb, metalaxyl, fludioxonil and prochloraz, in a synergistically effective... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20100160400 - Treatment using dantrolene: Provided are low-volume, safe for injection formulations of dantrolene yielding significant advantages over the currently approved and marketed dantrolene for malignant hyperthermia (MH) threatening anesthetic crisis. Once dantrolene can be made immediately available to patients triggered of MH, the anesthesiologist will be able to focus exclusively on the management of... Agent: Lucas & Mercanti, LLP

20100160401 - 4-phenylimidazole-2-thione tyrosinase inhibitors and treatment or prevention of pigmentary disorders therewith: o

20100160402 - Bisbenzimidazoles as antimalarial agents:

20100160403 - Hcv ns3 protease inhibitors: The present invention relates to macrocyclic compounds of formula (Ia) that are useful as inhibitors of the hepatitis C virus (HCV) NS3 protease, their synthesis, and their use for treating or preventing HCV infections.... Agent: Gilead Sciences Inc

20100160404 - New crystalline forms of perindopril erbumine: Disclosed are two new crystalline forms, δ and ε, of perindopril erbumine. Those forms are suitable as therapeutic active substances for medicaments for the treatment of cardiovascular diseases, especially high blood pressure and heart failure. The ε crystalline form is obtained in the crystallisation of perindopril erbumine at from 30... Agent: Hammer & Associates, P.C.

20100160405 - Methods of using (+)-2-[1-(3-ethoxy-4-methoxyphenyl)-2-methylsulfonylethyl]-4-acetylaminoisoindoline 1,3-dione: Stereomerically pure (+)-2-[1-(3-Ethoxy-4-methoxyphenyl)-2-methylsulfonylethyl]-4-acetylaminoisoindoline-1,3-dione, substantially free of its (−) isomer, and prodrugs, metabolites, polymorphs, salts, solvates, hydrates, and clathrates thereof are discussed. Also discussed are methods of using and pharmaceutical compositions comprising the (+) enantiomer of 2-[1-(3-Ethoxy-4-methoxyphenyl)-2-methylsulfonylethyl]-4-acetylaminoisoindoline-1,3-dione are disclosed. The methods include methods of treating and/or preventing disorders ameliorated by the... Agent: Jones Day

20100160406 - Histamine h3 receptor agents, preparation and therapeutic uses: The present invention discloses novel compounds of Formula (I) or pharmaceutically acceptable salts thereof which have histamine-H3 receptor antagonist or inverse agonist activity, as well as methods and intermediates for preparing such compounds. In another embodiment, the invention discloses pharmaceutical compositions comprising compounds of Formula (I) as well as methods... Agent: Eli Lilly & Company

20100160407 - Therapeutic substituted cyclic lactams: Disclosed and described herein is a compound having a formula (I) therapeutic methods, medicaments, and compositions related thereto are also disclosed.... Agent: Allergan, Inc.

20100160408 - Vildagliptin for treating general peripheral neuropathies: The present invention is directed to use of a Dipeptidyl peptidase IV inhibitor for treating general peripheral neuropathies, in particular, the present invention provides a method for the prevention, delay of progression, or the treatment of general peripheral neuropathies in a patient in need thereof, by administering an effective amount... Agent: Dilworth & Barrese, LLP

20100160409 - Highly branched reagents for modifying biopharmaceuticals, their preparation and use: The invention relates to compounds, which are suitable for coupling to pharmaceuticals, in particular biopharmaceuticals, in addition to conjugates from the compounds comprising biomolecules or pharmaceutically active substances. The inventive compounds are highly cross-linked and can be formed in a simple manner by using a central cross-linking module. The invention... Agent: Fitch Even Tabin & Flannery

20100160410 - Use of pentadienoic acid derivatives for the treatment of hyperuricemia: The use of a pentadienoic acid derivative of formula (I) for the preparation of a medicament for the prevention or treatment of hyperuricemia and/or one or several associated disorders or diseases, and/or for reducing the serum uric acid level of a subject. Medical compositions for these prevention and/or treatment, comprising... Agent: Millen, White, Zelano & Branigan, P.C.

20100160411 - Benzoxathiine and benzoxathiole derivatives and uses thereof: Compounds of formula (I) or pharmaceutically acceptable salts thereof are provided, wherein each of R1, R2, R3, R4, y, n, m, p, and Ar are as defined, and described in classes and subclasses herein, which are agonists or partial agonists of the 2C subtype of brain serotonin receptors. The compounds,... Agent: Choate, Hall & Stewart LLP/wyeth LLC

20100160422 - Halogen-containing organosulfur compound and use thereof: There is provided a halogen-containing organosulfur compound having an excellent controlling effect on arthropod pests represented by the formula (I): wherein, m represents 0, 1 or 2, n represents 0, 1 or 2, A represents optionally substituted C3-C7 cycloalkyl or optionally substituted C5-C7 cycloalkenyl group, Q represents a C1-C5 haloalkyl... Agent: Birch Stewart Kolasch & Birch

20100160423 - Small molecule antagonists of bacterial quorum-sensing receptors: A novel small molecule antagonizes two types of acyl homoserine lactone receptors: membrane-bound and cytoplasmic. A focused library of analogs and derivatives of the original antagonist was synthesized. Analog and derivative molecules harbor a range of activities. The novel small molecule and most potent antagonist protects the eukaryote Caenorhabditis elegans... Agent: Cynthia Soumoff Porzio, Bromberg & Newman, P.C.

20100160424 - Renin inhibitors: Described are compounds that bind to aspartic proteases to inhibit their activity. They are useful in the treatment or amelioration of diseases associated with aspartic protease activity. Also described are methods of use of the compounds described herein in ameliorating or treating aspartic protease related disorders in a subject in... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20100160425 - Anti-allergic agent and beverage/food, preparation for external application or cosmetic comprising the agent: s

20100160426 - Crystalline genistein sodium salt dihydrate: The disclosure relates to a new crystalline form of genistein. The disclosed crystalline form is crystalline genistein sodium salt dihydrate. The disclosure also relates to the novel genistein salt composition represented by this crystalline form. Therapeutic compositions containing crystalline genistein sodium salt and a pharmaceutically acceptable carrier are described. The... Agent: J.a. Lindeman & Co. PLLC

20100160427 - Method of treating vascular injuries induced by an excess of plasma lipids using combinations of vasoprotective agents: Combinations of vasoprotective agents useful for the prevention and the treatment of vascular injuries induced by an excess of plasma lipids comprising polycosanols, tocotriends and/or lycopene, procyanidole oligomers and vegetable oil rich in insaturated fatty acids.... Agent: Young & Thompson

20100160428 - Treatment of mitochondria-related diseases and improvement of age-related metabolic deficits: Treatment of mitochondrial related conditions in mammals with antagonists or chelating agents of copper (II), preferably tetramines or penicillamines. These agents affect TGF-beta, Smad 4, collagen IV, cytochrome C oxidase and erectile dysfunction.... Agent: Greenlee Winner And Sullivan P C

20100160429 - Anti-bacterial plant compositions: The invention provides a pharmaceutical composition which comprises a pharmaceutical carrier and at least one compound selected from the group consisting of cobaltocene-octamethyl, stigmastan-3,5-diene, galoxolide, benzyl salicylate, eucalyptol, and α-pinene. Also provided is a method of preparing a composition having antimicrobial activity comprising extracting a plant material in an organic... Agent: Whiteford, Taylor & Preston, LLP Attn: Gregory M Stone

20100160430 - Organic sulfur compound and its use for controlling harmful arthropod: There is provided an organic sulfur compound having an excellent controlling effect on harmful arthropods represented by the formula (I): wherein, R1 represents a C1-C5 haloalkyl group having at least one fluorine atom, R2 represents a C1-C4 alkyl group optionally substituted with at least one halogen atom or the like,... Agent: Birch Stewart Kolasch & Birch

20100160431 - Methods and compositions for the treatment of viral infections: Compositions for treating flu comprise an M2 inhibitor, and optionally a neuraminidase inhibitor, wherein at least one of said M2 inhibitor or said neuraminidase inhibitor is provided in an extended release dosage form.... Agent: Adamas Pharmaceuticals, Inc.

20100160432 - Curative drug for neurodegenerative diseases: wherein, R1 represents an alkyl group with a carbon number of 4 to 8, and R2 represents a hydrogen atom, alkylcarbonyl group with a carbon number of 2 to 6 or alkoxycarbonyl group with a carbon number of 2 to 6. A curative drug for neurodegenerative diseases can be prepared... Agent: Wenderoth, Lind & Ponack, L.L.P.

20100160433 - Treatment of neurodegenerative and cardiovascular disorders: e

20100160434 - Organic sulfur compound and its use for controlling harmful arthropod: There is provided an organic sulfur compound having an excellent controlling effect on harmful arthropods represented by the formula (I): wherein, R1 represents a C3-C10 alkenyl group optionally substituted with at least one halogen atom, a C3-C10 alkynyl group optionally substituted with at least one halogen atom, or the like,... Agent: Birch Stewart Kolasch & Birch

20100160435 - Composition of n-3 fatty acids having high concentration of epa and/or dha and containing n-6 fatty acids: A composition of long-chain polyunsaturated fatty acids containing at least 80% by weight of eicosapentaenoic acid (EPA, C20:5 n-3) and/or docosahexaenoic acid (DHA, C22:6 n-3) and at least 3% by weight of n-6 fatty acids, particularly C20:4 n-6 and C22:5 n-6, is reported. For a better chemical and biological characterization... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20100160436 - Stable gabapentin compositions: Stable compositions containing gabapentin compositions, methods of preparing such compositions, and methods of using such compositions.... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20100160437 - Topical composition comprising a cyclofructan, a carrier and a drug: The present invention relates in particular to a drug delivery system comprising a cyclofructan, a drug and a polymeric carrier.... Agent: Novartis Corporate Intellectual Property

20100160438 - Novel use of a nutraceutical composition in animal feed: This invention relates to a composition comprising benzoic acid or a derivative of benzoic. It has been found surprisingly that benzoic acid and salts thereof have the advantage of being able to improve digestibility of proteins in animal feeds, i.e. to promote amino acid and nitrogen assimilation, and to increase... Agent: Nixon & Vanderhye, PC

20100160439 - Dermatological compositions comprising at least one retinoid compound, an anti-irritant compound and benzoyl peroxide: wherein R is a hydrogen atom, a hydroxyl radical, a branched or unbranched alkyl radical having from 1 to 4 carbon atoms, an alkoxy radical having from 1 to 10 carbon atoms, or a cycloaliphatic radical which is substituted or unsubstituted, and benzoyl peroxide, and also at least one anti-irritant... Agent: Buchanan, Ingersoll & Rooney PC

20100160440 - Intranasal pharmaceutical compositions comprising succinic acid and methods thereof: The present invention relates to intranasal pharmaceutical compositions for preventing and/or treating a disease selected from the group consisting of Alzheimer's disease, Parkinson's disease, cerebral ischemia and neurological damage due to stroke comprising a therapeutically effective amount of succinic acid or a pharmaceutically acceptable salt thereof, and a pharmaceutically and... Agent: Notaro, Michalos & Zaccaria P.C.

20100160441 - Novel compounds: e

20100160442 - Formulations for cancer treatment: The present invention provides compositions of matter, kits, and methods for use in treating cancer and viral conditions. In particular the invention provides for pharmaceutical compositions containing nitrobenzamide compounds that have enhanced solubility in aqueous solutions.... Agent: Bipar Sciences Inc. C/o Morrison Foerster

20100160443 - Compounds useful for treating neurological disorders: The invention relates to the use of compounds for the preparation of a medicament for treating neuropathic pain, migraine, psychiatric disorder and/or neuronal degeneration. The invention additionally relates to a pharmaceutical composition comprising compounds for treating neuropathic pain, migraine, psychiatric disorder and/or neuronal degeneration. A method for treating neuropathic pain,... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20100160444 - Method to inhibit ischemia and reperfusion injury: Methods of treating or inhibiting ischemia and reperfusion injury are provided.... Agent: Knobbe Martens Olson & Bear LLP

20100160445 - Synergistic mixtures of opp and dgh: Ortho phenylphenol or its sodium salt is shown to form synergistic antimicrobial mixtures with nitrogen and aldehyde-containing microbiocides.... Agent: Beck & Thomas, P.C. Suite 100

20100160446 - 3,4-dimethoxyphenethylamine modulators of l-type calcium channel: The present invention relates to new 3,4-dimethoxyphenethylamine modulators of L-type calcium channel activity, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20100160447 - Crystalline forms of (-)-(1r,2r)-3-(3-dimethylamino-1-ethyl-2-methylpropyl)-phenol hydrochloride: A hitherto unknown crystalline form of (−)-(1R,2R)-3-(3-dimethylamino-1-ethyl-2-methylpropyl)-phenol hydrochloride, pharmaceutical compositions containing the new crystalline form, methods of producing the new crystalline form, and a related method of use including treatment of, e.g., pain and/or urinary incontinence.... Agent: Crowell & Moring LLP Intellectual Property Group

20100160448 - Compositions, methods of use and preparation of 2,6-diisopropyl phenol and analogs for ischemic injury: The present invention provides novel 2,6-diisopropyl phenol 2,6-diisopropyl phenol analogs and sterile, stable pharmaceutical compositions of 2,6-diisopropyl phenol 2,6-diisopropyl phenol and analogs thereof useful as an antioxidant in the treatment of ischemic injury including stroke and other cerebral injury. 2,6-diisopropyl phenol or its analogs are administered in a dosage effective... Agent: Leydig Voit & Mayer, Ltd

20100160449 - Peracetic acid oil-field biocide and method: Aqueous well treatment fluid compositions with biocidal activity are disclosed comprising a polymer for modifying fluid viscosity in the aqueous fluid, an organic monocarboxylic peracid being present in an anti-microbial amount of about 1 ppm to about 1000 ppm, and a controlled amount of hydrogen peroxide also being present. Peracetic... Agent: Patent Administrator Fmc Corporation

20100160451 - Methods and compositions for control of cabbage looper, trichoplusia ni: where R1 may be methyl, ethyl, propyl, n-butyl, isopentyl(3-methylbutyl) or allyl; R2 may be at positions 2, 3 or 4 and may be H, methyl, ethyl, propyl, n-butyl, isopentyl(3-methylbutyl) or allyl; and R3 may be optionally present at positions 2, 3 and 4, and is allyl; except that when R2... Agent: Steptoe & Johnson LLP

20100160450 - Methods of reducing 15-f2t-isop levels in mammals: Methods of reducing 15-F2t-IsoP levels in mammalian subjects are disclosed herein. In addition, methods of reducing or preventing oxidative stress and treating or preventing related diseases are disclosed.... Agent: Townsend And Townsend And Crew, LLP

20100160453 - High alcohol content foaming compositions: This invention relates to a “high lower alcohol content” (>40% v/v of a C1-4 alcohol) liquid composition able to be either dispensed as a stable foam with the use of non-propellant foam dispensing devices from non-pressurized containers or as an alcohol gel composition which does not use thickener and gelling... Agent: Dowell & Dowell P.C.

20100160452 - High alcohol-content foams: A foamable aqueous composition having alcohol and at least one water soluble polymer.... Agent: The Dow Chemical Company

20100160454 - Antimicrobial agents, compositions and products containing the same, and methods of using the compositions and products: Antimicrobial agents, products and compositions incorporating the agents, and methods of using the compositions and products are provided. The antimicrobial agents comprise 1,2-cyclohexanedimethanol, 1,4-cyclohexanedimethanol, 2,2,4,4-tetramethyl-1,3-cyclobutanediol, or mixtures thereof. These agents have surprisingly been found to inhibit microbial growth at a much lower concentration than other glycols with known antimicrobial activity.... Agent: Brett L. Nelson Eastman Chemical Company

20100160455 - Vitamin d3 analogues for the prevention and treatment of bone disorders: Novel vitamin D analogues are useful for making pharmaceutical compositions for the prevention or treatment of bone disorders such as osteoporosis... Agent: Clark & Elbing LLP

20100160456 - Propofol solution for anesthetic use: A transparent anesthetic solution for intravenous injection comprising at least 55% to 90% propofol dissolved in 10% to 45% of Macrogol 15 Hydroxystearate (SOLUTOL® HS 15), preferably having 25% by weight of Macrogol 15 Hydroxystearate (SOLUTOL® HS 15) for each 10.815 mg/ml of propofol. The solution may also include 0.0515... Agent: Bond, Schoeneck & King, PLLC

20100160457 - Thickened spreadable warming lubricant: A substantially anhydrous, thickened, spreadable, warming lubricant composition comprising a mixture of glycerin, polyhydric alcohol, a non-ionic surfactant, and a Carbomer thickener, the surfactant improving wetting and spreadability of the composition on skin and latex, and the thickener providing a creamy rich feel to the composition, such that the composition... Agent: Diehl Servilla LLC

06/17/2010 > patent applications in patent subcategories. invention type

20100152096 - Formulations for parenteral administration of amino-substituted (e)-2, 6-dialkoxystyryl 4-substituted benzylsulfones: and at least about 50% by weight of at least one water soluble polymer selected from the group consisting essentially of polyethylene glycol (PEG), poly-oxyethylene, poly-oxyethylene-poly-oxypropylene copolymers, polyglycerol, polyvinylalcohol, polyvinylpyrrolidone (PVP), polyvinylpyridine N-oxide, copolymer of vinylpyridine N-oxide and vinylpyridine.... Agent: Law Offices Of Khalilian Sira, LLC

20100152097 - Polymer-based sustained release device: This invention relates to compositions for the sustained release of biologically active polypeptides, and methods of forming and using said compositions, for the sustained release of biologically active polypeptides. The sustained release compositions of this invention comprise a biocompatible polymer having dispersed therein, a biologically active polypeptide and a sugar.... Agent: Covington & Burling, LLP Attn: Patent Docketing

20100152095 - Wound healing: A composition for use in the treatment of wounds to inhibit scar tissue formation during healing is disclosed, comprising an effective activity-inhibiting amount of a growth factor neutralising agent or agents specific against only fibrotic growth factors together with a pharmaceutically acceptable carrier. The method of preparation of said composition... Agent: Nixon & Vanderhye, PC

20100152098 - Polybasic bacterial efflux pump inhibitors and therapeutic uses thereof: Disclosed are compounds having polybasic functionalities. The compounds inhibit bacterial efflux pump inhibitors and are used in combination with an anti-bacterial agent to treat or prevent bacterial infections. These combinations can be effective against bacterial infections that have developed resistance to anti-bacterial agents through an efflux pump mechanism.... Agent: Knobbe Martens Olson & Bear LLP

20100152099 - Macrocyclic compounds for inhibition of tumor necrosis factor alpha: The invention provides macrocyclic compounds and methods for their synthesis and use. In particular, the invention provides macrocyclic compounds that modulate the activity of tumor necrosis factor alpha and/or are useful in the treatment of medical conditions, such as, rheumatoid arthritis, psoriasis, and asthma.... Agent: Goodwin Procter LLP Patent Administrator

20100152100 - Accelerated therapy: The present invention encompasses the surprising finding that romidepsin can safely be administered to humans on an accelerated dosing schedule.... Agent: Choate, Hall & Stewart LLP

20100152103 - 4-amino-4-oxobutanoyl peptide cyclic analogues, inhibitors of viral replication: The variables are defined herein. Certain compounds of Formula I are useful as antiviral agents. 4-amino-4-oxobutanoyl peptide cyclic analogues as disclosed herein are potent and/or selective inhibitors of viral replication, particularly Hepatitis C virus replication. The invention also provides pharmaceutical compositions containing one or more 4-amino-4-oxobutanoyl peptide cyclic analogues and... Agent: Cantor Colburn, LLP

20100152104 - Methods for inhibiting growth of prolactin-responsive cancer cells with cyclosporine a or other cyclophilin inhibitors: Methods are provided for inhibiting growth of prolactin-responsive cancer cells and treating prolactin-responsive malignancies via administration an agent such as cyclosporine A which directly inhibits an enzymatic activity of a cyclophilin.... Agent: Licata & Tyrrell P.C.

20100152101 - Triazol compounds for treating biofilm formation: t

20100152105 - Use of rapamycin derivatives in chronic rejection: The present invention is directed to the use of a rapamycin derivative of formula I in combination with cyclosporin for preventing or treating manifestations of chronic rejection in a recipient of an organ or tissue transplant.... Agent: Dilworth & Barrese, LLP

20100152102 - Use of somatostatin or one of its analogues for preparing a medicament intended to regulate the ovarian follicular reserve in non-menopausal women: The invention primarily relates to the use of somatostatin or one of the agonistic analogs thereof for producing a medicament serving to regulate the ovarian follicular reserve and, in particular, to reduce the depletion of the ovarian follicular reserve over time in non-menopausal women or to the use of an... Agent: Hunton & Williams LLP Intellectual Property Department

20100152117 - Aequorin-containing compositions and methods of using same: Compositions containing aequorin and methods for their use in preventing and/or alleviating symptoms and disorders related to calcium imbalance are provided by the present invention.... Agent: Quarles & Brady LLP

20100152106 - Agent for therapy and/or improvement of disseminated intravascular coagulation: It is an object of the present invention to provide a therapeutically effective agent for therapy and/or improvement of DIC, or a method for treating and/or improving DIC. The present invention provides an agent for therapy and/or improvement of disseminated intravascular coagulation comprising thrombomodulin as an active ingredient, which is... Agent: Birch Stewart Kolasch & Birch

20100152110 - Alternate reading frame polypeptides derived from hepatitis c and methods of their use: Novel hepatitis C virus (HCV) polypeptides are provided which are not encoded by the standard HCV open reading frame. These alternate reading frame polypeptides are useful, inter alia, in vaccine compositions, in diagnosing HCV infection, and as therapeutic targets.... Agent: Lahive & Cockfield, LLP Floor 30, Suite 3000

20100152114 - Antioxidant activity of gh-rh antagonists: There are provided means for suppressing the Reactive Oxidant Species (ROS) of certain cells by the administration of GHRH antagonists. The therapeutic applications of the anti-oxidative action of GH-RH antagonists relate to the redox status of certain cells, including but not limited to cancer cells, reducing the metabolism of reactive... Agent: Omri M. Behr

20100152115 - Detection of physiologically acceptable polymer molecules using near infrared spectroscopy: The present invention relates, in general, to methods for detecting the amount of a polymer on a protein using near-infrared spectroscopy. Measurement of the number of polymer moieties per protein molecule allows for production of molecules having a uniform number of polymer moieties, which is useful in the production of... Agent: Marshall, Gerstein & Borun (baxter)

20100152109 - Influenza inhibiting compositions and methods: The present invention provides peptides, peptide analogs, peptide derivatives and pharmaceutical compositions useful for treating or preventing influenza infections or preventing the person-to-person transmission of an influenza infection. A peptide of the invention comprises an influenza virus-cell fusion inhibiting portion of the fusion initiation region (FIR) of a wild-type influenza... Agent: Olson & Cepuritis, Ltd.

20100152107 - Long-term feed - cancer patient: Pursuant to the present invention, methods and compositions are provided for providing long-term tube-fed nutrition. More specifically, pursuant to the present invention, methods and compositions are provided for providing long-term tube-fed nutrition to cancer patients.... Agent: Nestle Healthcare Nutrition

20100152113 - Metal-binding therapeutic peptides: The present invention is related methods of delivering MBD peptide-linked agents into live cells. The methods described herein comprise contacting MBD peptide-linked agents to live cells under a condition of cellular stress. The methods of the invention may be used for therapeutic or diagnostic purposes.... Agent: Morrison & Foerster LLP

20100152108 - Methods and combination therapies for treating alzheimer's disease: The invention provides methods and combination therapies for treating and/or preventing and/or slowing the onset and/or development of Alzheimer's disease using a hydrogenated pyrido (4,3-b) indole (e.g., dimebon) in conjunction with another compound, pharmaceutically acceptable salt thereof or therapy for Alzheimer's disease.... Agent: Morrison & Foerster LLP

20100152111 - Polymer-based sustained release device: This invention relates to compositions for the sustained release of biologically active polypeptides, and methods of forming and using said compositions, for the sustained release of biologically active polypeptides. The sustained release compositions of this invention comprise a biocompatible polymer having dispersed therein, a biologically active polypeptide and a sugar.... Agent: Covington & Burling, LLP Attn: Patent Docketing

20100152112 - Quinoline derivatives as p13 kinase inhibitors: Invented is a method of inhibiting the activity/function of PI3 kinases using quinoline derivatives. Also invented is a method of treating one or more disease states selected from: autoimmune disorders, inflammatory diseases, cardiovascular diseases, neurodegenerative diseases, allergy, asthma, pancreatitis, multiorgan failure, kidney diseases, platelet aggregation, cancer, sperm motility, transplantation rejection,... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100152116 - Treatment of amyotrophic lateral sclerosis: The present invention relates to the treatment of motoneuron diseases. More particularly, the invention relates to the treatment of amyotrophic lateral sclerosis (ALS). It is found that the intracerebroventricular delivery of low amounts of vascular endothelial growth factor into a pre-clinical ALS animal model induces a significant motor performance and... Agent: Traskbritt, P.C.

20100152118 - Agonists of guanylate cyclase useful for the treatment of hypercholesterolemia, atherosclerosis, coronary heart disease, gallstone, obesity and other cardiovascular diseases: This invention also provides a method to prevent, control, and treata lipid metabolism disorder, a billary disorder, cardiovascular disease, obesity or an endocrine disorder by administering at least one agonist of guanalyte cyclase receptor either alone or in combination with a compound typically used to treat the disorder and or... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100152120 - Methods and apparatus for the enhanced delivery of physiologic agents to tissue surfaces: Apparatus and methods deliver physiologically active agents in the presence of adjuvant gases. The adjuvant gases can enhance the effectiveness of the drug, lower the dosage of drug or concentration of drug necessary to achieve a therapeutic result, or both. Exemplary adjuvant gases include carbon dioxide, nitric oxide, nitrous oxide,... Agent: Howrey LLP-ca

20100152119 - Pharmaceutical and/or cosmetic composition containing peptides: The present invention concerns the use of peptide fragments of the protein SLC24A5 as active agents designed to induce, increase, or restore the synthesis of melanin in the melanocytes of the epidermis or of the pilar bulb, alone or in association with at least one other active agent, in a... Agent: Young & Thompson

20100152121 - Iodo-hexose compounds useful to treat cancer: Methods of treating glioblastoma and pancreatic cancer are provided by the administration of a therapeutically effective amount of a iodo-hexose compound to a subject in need thereof. The subject disclosure includes methods of treating glioblastoma and pancreatic cancer comprising the administration of a therapeutically effective amount of a 2-deoxy-2-iodo-D-hexose compound... Agent: NielsenIPLaw LLC

20100152122 - Oligo-guluronate and galacturonate compositions: The invention provides a pharmaceutical composition comprising a macromolecular drug and an oligoguluronate or oligogalacturonate, e.g., having a number average degree of polymerization in the range 5 to 18, a guluronate (or galacturonate) fraction (FG) of at least 0.80, a mannuronate fraction (FM) of no more than 0.20, and having... Agent: Knobbe Martens Olson & Bear LLP

20100152123 - Methods and compositions for treating disorders caused by a deficiency in a gene product of a cln gene: The present invention provides methods and compositions for treating a disorder associated with a deficiency in a gene product of a CLN gene in a subject (e.g., neuronal ceroid lipofuscinosis (NCL)), comprising administering to the subject an effective amount of a sphingolipid (e.g., galactosylceramide, ceramide, lysophosphatidic acid, sulfatide and any... Agent: Myers Bigel Sibley & Sajovec

20100152124 - Use of hederagenin 3-0 alpha-l-rhamnopyranosyl(1-2)-(beta-d-glucopyranosyl(1-4)-alpha-l-arabinopyranoside or an extract from pulsatillae radix containing the same as a therapeutic agent for solid tumors: This invention relates to a use of hederagenin 3-O-α-L-rhamnopyranosyl((1→2)-[β-D-glucopyranosyl(1→4)]-α-L-arabinopyranoside or a Pulsatillae radix extract containing the same as a therapeutic agent for solid tumors. Also, this invention relates to a method of preparing a therapeutic agent for solid tumors by using hederagenin 3-O-α-L-rhamnopyranosyl(1→2)-[β-D-glucopyranosyl(1→4)]-α-L-arabinopyranoside, or a method of treating a subject... Agent: Edwards Angell Palmer & Dodge LLP

20100152125 - Compositions and methods for the diagnosis, treatment, and prevention of amyotrophic lateral sclerosis and related neurological diseases: One aspect of the invention relates to a method of treating or preventing a neurodegenerative disease, comprising the step of administering to a patient in need thereof a therapeutically effective amount of an inhibitor of the formation of advanced glycation end products. Another aspect of the invention relates to a... Agent: Foley Hoag, LLP Patent Group, World Trade Center West

20100152278 - Rna interference mediated inhibition of cyclic nucleotide type 4 phosphodiesterase (pde4b) gene expression using short interfering nucleic acid (sina): The present invention relates to compounds, compositions, and methods for the study, diagnosis, and treatment of traits, diseases and conditions that respond to the modulation of cyclic nucleotide type 4 phosphodiesterase (PDE4B) gene expression and/or activity, including PDE4B1, PDE4B2, and PDE4B3 gene expression and/or activity. The present invention is also... Agent: Merck C/o Sirna Therapeutics, Inc.

20100152279 - Rnai inhibition of serum amyloid a for treatment of glaucoma: RNA interference is provided for inhibition of serum amyloid A mRNA expression in glaucomas involving SAA expression.... Agent: Alcon

20100152281 - Methods of treating systemic lupus erythematosus in individuals having significantly impaired renal function: The invention provides methods treating lupus nephritis based in individuals with significantly impaired renal function, and methods of selecting individuals for treatment based on significantly impaired renal function. The treatment entails administration of a conjugate comprising a non-immunogenic valency platform molecule and at least two double stranded DNA epitopes, such... Agent: Morrison & Foerster LLP

20100152280 - Modulation of sid-1 expression: Compounds, compositions and methods are provided for modulating the expression of SID-1. The compositions comprise oligonucleotides, targeted to nucleic acid encoding SID-1. Methods of using these compounds for modulation of SID-1 expression and for diagnosis and treatment of diseases and conditions associated with expression of SID-1 are provided.... Agent: Knobbe, Martens, Olson & Bear, LLP

20100152282 - Use of double stranded rna hairpin duplexes in gene silencing: A DNA polynucleotide is described herein having a modified sequence of a target gene, wherein any one type of nucleotide in the target gene sequence has been chemically modified to another type of nucleotide; and a complementary sequence of the unmodified target gene; wherein either one of the modified sequence... Agent: Ratnerprestia

20100152126 - Beta-l-2'-deoxy-nucleosides for the treatment of hepatitis b: wherein R is selected from the group consisting of H, straight chained, branched or cyclic alkyl, CO-alkyl, CO-aryl, CO-alkoxyalkyl, CO-aryloxyalkyl, CO-substituted aryl, alkylsulfonyl, arylsulfonyl, aralkylsulfonyl, amino acid residue, mono, di, or triphosphate, or a phosphate derivative; and BASE is a purine or pyrimidine base which may be optionally substituted. The... Agent: Jones Day

20100152127 - 2-propynyl adenosine analogs having a2a agonist activity and compositions thereof: e

20100152128 - Antiviral agents: A compound of formula (I) and pharmaceutically acceptable salts thereof; compositions containing it and its use in medicine, particularly for the treatment or inhibition of HCV infections, and processes for making it are disclosed.... Agent: Merck

20100152129 - Novel synergistic combination of gemcitabine with p276-00 or p1446a in treatment of cancer: Synergistic combinations of gemcitabine with P276-00 or P1446A and their use in the treatment of cancer are disclosed. The invention further describes novel and unique gene signatures comprising gene markers used to monitor the drug response in a subject treated with the said combinations.... Agent: Kausalya Santhanam

20100152131 - Method for producing purified hematinic iron-saccharadic complex and product produced: A method for separating and purifying the active hematinic species (AHS) present in iron-saccharidic compositions, including AHS such as sodium ferric gluconate complex, ferric hydroxide-sucrose complex and ferric saccharate complex and others of similar form and function. The method separates the AHS from one or more excipients and, preferably, lyophilizes... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20100152130 - Treatment of cancer with glutamine: Provided are methods of treating cancer, and/or the side effects of cancer therapy, involving the administration of glutamine, optionally in combination with a carbohydrate carrier that enhances the absorption of glutamine.... Agent: Schwegman, Lundberg & Woessner, P.A.

20100152132 - Use of a composition comprising an antacid, a mucolytic and a gelling agent in the treatment of cold: The present invention is concerning a medicine to alleviate and cure colds h} reduced acid content and stimulation of increased mucus production through the fact that active components of the substance consist of acid stanching components like proton p<<mps stanches, histamin-2-receptor-antagonists, mucus stimulating components as acetylsysteine and algine acid. This... Agent: Dennison, Schultz & Macdonald

20100152133 - Use of chitosans to increase nail growth rate: The present invention is directed to the use of chitosan, a chitosan derivative or a physiologically acceptable salt thereof, to increase nail growth rate. The invention is further directed to the use of chitosans to accelerate nail growth rate during treatment of nail illnesses, nail dystrophy or other nail conditions,... Agent: The Firm Of Hueschen And Sage

20100152134 - Emulsified skin external preparation and method for stabilizing the skin external preparation: An emulsified skin external preparation containing a tocopherol glycinate derivative has excellent storage stability without viscosity reduction during storage. The emulsified skin external preparation includes 0.03 to 25% by mass of a tocopherol glycinate derivative, and 0.05 to 25% by mass of at least one fatty acid ester selected from... Agent: Sughrue Mion, PLLC

20100152135 - Cosmetic kit comprising reactive silicone compounds and a glossy oil: The invention relates to a cosmetic kit comprising at least two separately-packaged cosmetic compositions, -the kit comprising at least one silicone compound X, at least one silicone compound Y and, optionally, at least one catalyst, -with the proviso that the compounds X and Y—and the catalyst when present—are not simultaneously... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20100152136 - Tp53 gene expression and uses thereof: The present invention is drawn to diagnosis, prognosis and treatment of multiple myeloma. In this regard, the present invention discloses importance of down-regulation of TP3 gene in multiple myeloma and its use as an independent progostic indicator of multiple myeloma. Additionally, the present invention also discloses novel-TP53 associated genes and... Agent: Benjamin Aaron Adler Adler & Associates

20100152137 - Alkylphospholipids as active agents for prevention of plant pathogens: The invention relates to a process for controlling plant pathogens comprising the application of alkylphospholipids as active substances. Further, the invention relates to the use of alkylphospholipids for controlling plant pathogens, and to an agent for controlling plant pathogens containing an effective amount of at least one alkylphospholipid.... Agent: Ballard Spahr LLP

20100152138 - Cyclic amine bace-1 inhibitors having a benzamide substituent: Also disclosed are pharmaceutical compositions and methods of treating cognitive or neurodegenerative diseases comprising the compounds of formula I in combination with a β-secretase inhibitor other than those of formula I, an HMG-CoA reductase inhibitor, a gamma-secretase inhibitor, a non-steroidal anti-inflammatory agent, an N-methyl-D-aspartate receptor antagonist, a cholinesterase inhibitor or... Agent: Merck Patent Department (k-6-1, 1990)

20100152139 - Emulsified skin external preparation and method for stabilizing the skin external preparation: An emulsified skin external preparation containing a salt of a higher fatty acid ester of ascorbic acid-2-phosphate is provided, and the decomposition and consequent decrease of the salt are prevented and thereby the stability of the preparation is enhanced. A method for stabilizing the skin external preparation containing a salt... Agent: Sughrue Mion, PLLC

20100152140 - Method of cancer treatment with naphthol analogs: In one embodiment, the present invention relates to a method of treating a cancer characterized by overexpression of cyclic adenosine monophosphate response element-binding protein (CREB) or phosphorylated CREB (p-CREB) by administering to a patient suffering from the cancer a pharmaceutically-effective amount of a composition comprising a compound selected from the... Agent: Williams, Morgan & Amerson

20100152141 - Combinations comprising 5ht6 modulators and cholinesterase inhibitors: The invention relates to 5-HT6 receptor modulators. Compositions comprising arylamine compounds and acetylcholinesterase inhibitors and use of these compositions are disclosed. Such uses include e.g., the treatment, modulation and/or prevention of Alzheimer's disease and memory disorders, and psychological disorders such as schizophrenia, are disclosed.... Agent: Goodwin Procter LLP Patent Administrator

20100152142 - Crystalline form ii of tigecycline and processes for preparation thereof: The present invention provides processes for the preparation of crystalline forms of Tigecycline.... Agent: Kenyon & Kenyon LLP

20100152143 - Methods of treating skin disorders with caffeic acid analogs: Embodiments of the invention generally relate to pharmaceutical compositions containing at least one caffeic acid compound and methods for the topical treatment of proliferative and inflammatory skin disorders such as plaque psoriasis, atopic dermatitis, and other disorders. In some embodiments, the topical treatment includes applications of the pharmaceutical composition containing... Agent: Patterson & Sheridan, L.L.P.

20100152144 - Estrogen beta receptor agonists to prevent or reduce the severity of cardiovascular disease: A method for preventing or treating vascular hyperreactivity in which a chemical compound that is an estrogen beta receptor agonist is administered to a subject suffering from or at risk of vascular hyperreactivity. Preferably, the administration is topically to the skin.... Agent: Howard Eisenberg, Esq.

20100152145 - Use of 3-alpha-androstanediol, optionally in combination with a pde5 inhibitor, in the treatment of sexual dysfunction: The invention relates to the field of male and/or female sexual dysfunction. The invention specifically relates to the use of 3-alpha-androstanediol, preferably in combination with a type 5 phosphodiesterase (PDE5) inhibitor.... Agent: Morrison & Foerster LLP

20100152146 - Topical administration of danazol: Pharmaceutical preparations for topical or local administration of drugs directly to the skin for treatment of disorders of the subcutaneous fatty tissue, in particular in cases of cellulite, are disclosed herein. In a preferred embodiment, the drug is danazol or gastrinone. In another embodiment, the drug is danazol in combination... Agent: Pabst Patent Group LLP

20100152147 - Compositions comprising azelastine and methods of use thereof: The present invention provides pharmaceutical compositions comprising azelastine, or a pharmaceutically acceptable salt or ester thereof including azelastine hydrochloride, and optionally one or more additional active agents. Preferred such compositions further comprise one or more pharmaceutically acceptable carriers or excipients that reduce the amount of post-nasal drip, and/or that minimize... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20100152148 - Novel compounds: e

20100152149 - Formulation: The invention relates to a novel sustained release pharmaceutical formulation adapted for administration by injection containing the compound 7α-[9-(4,4,5,5,5-pentafluoropentylsulphinyl)nonyl]oestra-1,3,5(10)-triene-3,17β-diol, more particularly to a formulation adapted for administration by injection containing the compound 7α-[9-(4,4,5,5,5-pentafluoropentylsulphinyl)nonyl]oestra-1,3,5(10)-triene-3,17β-diol in solution in a ricinoleate vehicle which additionally comprises at least one alcohol and a non-aqueous ester... Agent: Morgan Lewis & Bockius LLP

20100152151 - Tgr5 modulators and methods of use therof: e

20100152150 - The application of marine steroid in preparing the medicine of treating neurons damaging: The application of marine steroid, i.e. 24-methylene-cholest-3β,5α,6β,19-tetrol, in preparing the medicine of treating neurons damaging is provided in the present invention. The keto-sterols compounds marine steroid YC-1 extracted from Nephthea albida has the action of neuronal protection, and no toxic reaction under the effective protective dosage.... Agent: Brinks Hofer Gilson & Lione

20100152152 - Therapeutic use of nefopam: Nefopam is used for the manufacture of a medicament for the treatment of an affective disorder such as ADD or ADHD.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20100152153 - Nitric oxide releasing compounds: Compositions comprising nitrosyl-cobinamide are provided. Also provided are methods for treating hypertension, which comprise administering therapeutically effective amounts of nitrosyl-cobinamide. Also provided are methods for producing nitrosyl-cobinamide.... Agent: Fenwick & West LLP

20100152154 - Novel platinum compounds for treating cancer: A series of platinum compounds and methods of treating cancer by said platinum compounds are disclosed.... Agent: Jiajiu Shaw

20100152156 - 2-azetidinone derivatives for the treatment of hyperlipidaemic diseases: The invention relates to novel 2-azetidinone derivatives of formula (I) and to pharmaceutically acceptable salts, solvates and prodrugs thereof. The compounds are cholesterol absorption inhibitors, useful in the treatment of hyperlipidaemic conditions. The invention also relates to processes for their manufacture and to pharmaceutical compositions containing them.... Agent: Pepper Hamilton LLP

20100152157 - 6-cycloamino-3-(pyridazin-4-yl)imidazo[1,2-b]-pyridazine and derivatives thereof preparation and therapeutic application thereof: e

20100152155 - Histone deacetylase inhibitors: Compounds of formula: (I), and salts, N-oxides, hydrates and solvates thereof are histone deacetylase inhibitors and are useful in the treatment of cell proliferative diseases, including cancers: (I) wherein Q, V and W independently represent —N═ or —C═; B is a divalent radical selected from: (IIA), (IIB), (IIC), (IID), and... Agent: Banner & Witcoff, Ltd.

20100152159 - Imidazopyrazine syk inhibitors: Certain imidazopyrazines and pharmaceutical compositions thereof are provided herein. Methods of treating patients suffering from certain diseases and disorders responsive to the inhibition of Syk activity, which comprises administering to such patients an amount of at least one chemical entity effective to reduce signs or symptoms of the disease or... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20100152160 - Novel benzodioxane and benzoxazine derivatives useful as cc chemokine receptor ligands: The present invention relates to benzodioxane and benzoxazine derivatives that act as ligands for CC chemokine receptors, such as CCR1. The invention also relates to methods of preparing the compounds, compositions containing the compounds, and to methods of treatment using the compounds.... Agent: Forest Laboratories, Inc. Attn: Charles S. Ryan

20100152158 - Substituted disulfonamide compounds: In which R1, R2, R3, R4a, R4b, R5a, R5b, R8, R9a, R9b, R10, R11, a, b, s, t and A have defined meanings, pharmaceutical compositions containing one or more such compounds, processes for preparing such compounds, and a method of using such compounds for the treatment or inhibition of pain... Agent: Crowell & Moring LLP Intellectual Property Group

20100152161 - Compositions for weight management: Methods and compositions for preventing or reducing weight gain associated with drug treatment, which utilize an H1 agonist such as betahistine, betahistine metabolite or a betahistine salt are disclosed.... Agent: Martin D. Moynihan D/b/a Prtsi, Inc.

20100152162 - Therapeutic and/or preventive agents for a sleep disorder: It is intended to provide an agent for treating and/or preventing sleep disorder containing as an active ingredient a thiazole derivative represented by the general formula (I) (in the formula, R1 represents a five-membered aromatic heterocyclic group containing at least one oxygen atom or the like, R2 represents halogen or... Agent: Fitzpatrick Cella Harper & Scinto

20100152163 - Azepino[4,5-b]indoles and methods of use: This disclosure relates to new azepino[4,5-b]indole compounds that may be used to modulate a histamine receptor in an individual. Novel compounds are described, including new 1,2,3,4,5,6-tetrahydroazepino[4,5-b]indoles. Pharmaceutical compositions are also provided.... Agent: Morrison & Foerster LLP

20100152164 - Method for stabilizing anti-dementia drug: The present invention provides a method for stabilizing an anti-dementia drug in a pharmaceutical composition containing the anti-dementia drug and a high molecular weight basic substance by adding a high molecular weight acidic substance to said pharmaceutical composition. Further, the present invention provides a pharmaceutical composition containing an anti-dementia drug... Agent: Venable LLP

20100152165 - Carboxylic acid derivatives: [Means for resolution] It was found that novel carboxylic acid derivatives or salts thereof, characterized in that carboxylic acid is linked to a 6-membered monocyclic aromatic ring via two atoms and said aromatic ring is linked to a nitrogen-containing bicyclic ring via a linker, have excellent GPR40 receptor agonist action.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20100152167 - Pyrimidine derivatives: e

20100152166 - Compounds and methods for modulating fxr: Compounds of formula (I): formula (I) wherein variables are as defined herein and their pharmaceutical compositions and methods of use are disclosed as useful for treating dyslipidemia and diseases related to dyslipidemia.... Agent: Eli Lilly & Company

20100152169 - 4-oxoquinazolin-3-yl benzamide derivatives for the treatment of cytokine diseases: The invention concerns a compound of the Formula (I) wherein m is 1-2 and each R1 is a group such as cyano halogeno, trifluoromethyl heterocyclyl and heterocyclyloxy; R2 is trifluoromethyl or (1-6C)alkyl; R3 is hydrogen or halogeno; and R4 is isoxazolyl; or pharmaceutically-acceptable salts thereof; processes for their preparation, pharmaceutical... Agent: Astrazeneca R&d Boston

20100152168 - Substituted benzimidazolone derivatives, medicaments comprising them and their use: The present invention relates to novel benzimidazolone derivatives of the general formula (I) in which the substituents R1, R2, R3, A1, A2, and B are as defined in claim 1, medicaments comprising these, and the use thereof for the prophylaxis and/or treatment of vasopressin-dependent diseases.... Agent: Abbott Laboratories C/o Polsinelli Shughart PC

20100152170 - Benzazole derivatives, compositions, and methods of use as aurora kinase inhibitors: The present invention relates to compounds and methods from the treatment of cancer. The invention provides compounds that inhibit Aurora kinase, pharmaceutical compositions comprising compounds that inhibit Aurora kinase, and methods for the treatment of cancer using the compounds of the presentation invention or pharmaceutical compositions comprising compounds of the... Agent: Kilpatrick Stockton LLP - 41305 Charles Calkins

20100152171 - Cgrp antagonists: e

20100152172 - 2,4-pyrimidinediamine compounds for treating or preventing autoimmune diseases: The present invention provides 3-hydroxyphenyl-2,4-pyrimidinediamine compounds of formula I, as well as related compositions and methods for treating a variety of autoimmune diseases.... Agent: Klarquist Sparkman, LLP

20100152173 - tablet having improved stability with at least two actives: The present invention relates to a tablet comprising at least a first and second active, the first active being in the form of a non-aqueous granulate, the second active ingredient being in the form of melt extrudated granules or a granulate (aqueous or non-aqueous). The first and second active forms... Agent: Troutman Sanders LLP 5200 Bank Of America Plaza

20100152174 - Macrocyclic quinazole derivatives and their use as mtki: The present invention concerns the compounds of formula (I), the N-oxide forms, the pharmaceutically acceptable addition salts and the stereochemically isomeric forms thereof, wherein Z represents NH; Y represents —C3-9alkyl-, —C1-5alkyl-NR13—C1-5alkyl-, —C1-5alkyl-NR14—CO—C1-5alkyl-, —C1-2alkyl-NR21—H2—CO—NH—C1-3alkyl- or —C1-2alkyl-NR23—CO—CR16R17—NH—; X1 represents O or —O—C1-2alkyl-; X2 represents a direct bond, C1-2alkyl, —CO—C1-2alkyl or NR12—C1-2alkyl; R1... Agent: Philip S. Johnson Johnson & Johnson

20100152177 - Compounds having 5-ht6 receptor affinity: e

20100152176 - Modulators of muscarinic receptors: The present invention relates to modulators of muscarinic receptors. The present invention also provides compositions comprising such modulators, and methods therewith for treating muscarinic receptor mediated diseases.... Agent: Jonathan P. O''brien, Ph.d. Honigman Miller Schwartz & Cohn LLP

20100152175 - Pyridine derivatives and their use in the treatment of psychotic disorders: e

20100152178 - Imidazole derivatives:

20100152179 - Treatment of central nervous system disorders: A method for treating a patient suffering from disorders and deficits of the central nervous system associated with diabetes, associated with aging and neurodegeneration, comprising attention deficit disorder in general, attention deficit hyperactivity disorder (ADHD), Alzheimer's disease (AD), mild cognitive impairment, senile dementia, AIDS dementia, neurodegeneration, depression, and schizophrenia, comprising... Agent: Paul D. Yasger Abbott Laboratories

20100152180 - 4-oxo-4,5-dihydropyrrolo[1,2-a)quinoxaline derivatives as inhibitors of poly(adp-ribose) polymerase (parp): The present invention relates to compounds of formula (I): and pharmaceutically acceptable salts or tautomers thereof which are inhibitors of poly(ADP-ribose)polymerase (PARP) and thus useful for the treatment of cancer, inflammatory diseases, reperfusion injuries, ischaemic conditions, stroke, renal failure, cardiovascular diseases, vascular diseases other than cardiovascular diseases, diabetes mellitus, neurodegenerative... Agent: Merck

20100152181 - Amino pyrazole compound: The present invention provides amino pyrazole compounds useful in the treatment of chronic myeloproliferative disorders and various cancers, e.g., glioblastoma, breast cancer, multiple myeloma, prostate cancer, and leukemias.... Agent: Eli Lilly & Company

20100152182 - 2,4- di(hetero)-arylamino-pyrimidine derivatives as zap-70 and/or syk inhibitors: e

20100152183 - Bcl-2-selective apoptosis-inducing agents for the treatment of cancer and immune diseases: Disclosed are compounds which inhibit the activity of anti-apoptotic Bcl-2 or Bcl-xL proteins, compositions containing the compounds and methods of treating diseases during which are expressed anti-apoptotic Bcl-2 protein.... Agent: Paul D. Yasger Abbott Laboratories

20100152185 - Diphenyl substituted cycloalkanes, compositions containing such compounds and methods of use: s

20100152184 - Pharmaceutical compounds:

20100152186 - Triazolyl pyridyl benzenesulfonamides: Compounds are provided that act as potent antagonists of the CCR2 or CCR9 receptor. Animal testing demonstrates that these compounds are useful for treating inflammation, a hallmark disease for CCR2 and CCR9. The compounds are generally aryl sulfonamide derivatives and are useful in pharmaceutical compositions, methods for the treatment of... Agent: Brinks Hofer Gilson & Lione

20100152187 - Aminothiazole derivatives as human stearoyl-coa desaturase inhibitors: Methods of treating an SCD-mediated disease or condition in a mammal, preferably a human, are disclosed, wherein the methods comprise administering to a mammal in need thereof a compound of formula (I), where V, W, R1, R2, R3 and R4 are defined herein. Pharmaceutical compositions comprising the compounds of formula... Agent: Seed Intellectual Property Law Group PLLC

20100152188 - Novel heterocyclic compounds: The present invention relates to novel compounds of the general formula (I), their derivatives, their analogs, their stereoisomers, their pharmaceutically acceptable salts and compositions. The present invention more particularly provides novel heterocyclic compounds of the general formula (I).... Agent: Cooper & Dunham, LLP

20100152189 - Novel polymorphous form and the amorphous form of 5-chloro-n-({ (5s)-2-oxo-3[4-(3-oxo-4-morpholinyl(-phenyl]-1,3-oxazolidine-5-yl}-methyl)-2-thiophene carboxamide: The present invention relates to a novel polymorphic form and the amorphous form of 5-chloro-N-({(5S)-2-oxo-3-[4-(3-oxo-4-morpholinyl)-phenyl]-1,3-oxazolidin-5-yl}-methyl)-2-thiophene-carboxamide, processes for their preparation, medicaments comprising these forms, and their use in the control of diseases.... Agent: Connolly Bove Lodge & Hutz, LLP

20100152190 - Substituted pyrrolidine-2-carboxamides: e

20100152191 - Cyclopropyl pyrrolidine orexin receptor antagonists: The present invention is directed to cyclopropyl proline bis-amide compounds which are antagonists of orexin receptors, and which are useful in the treatment or prevention of neurological and psychiatric disorders and diseases in which orexin receptors are involved. The invention is also directed to pharmaceutical compositions comprising these compounds and... Agent: Merck

20100152192 - Fused imidazole carboxamides as trpv3 modulators: The present invention provides transient receptor potential vanilloid (TRPV) modulators of formula (I). In particular, compounds described herein are useful for treating or preventing diseases, conditions and/or disorders modulated by TRPV3. Also provided herein are processes for preparing compounds described herein, intermediates used in their synthesis, pharmaceutical compositions thereof, and... Agent: Kaplan Gilman & Pergament LLP

20100152193 - Pyridazinones: e

20100152194 - Anthranilamide arthropodicide treatment:

20100152195 - Azabicyclo (3.1.0) hexane derivatives useful as modulators of dopamine d3 receptors:

20100152196 - Novel fused pyrrolocarbazoles: The present invention relates generally to selected fused pyrrolocarbazoles, including pharmaceutical compositions thereof and methods of treating diseases therewith. The present invention is also directed to intermediates and processes for making these fused pyrrolocarbazoles.... Agent: Ross J. Oehler Cephalon, Inc.

20100152197 - (4-tert-butylpiperazin-2-yl)(piperazin-1-yl)methanone-n-carboxamide derivatives: e

20100152198 - Use of c-src inhibitors in combination with a pyrimidylaminobenzamide compound for the treatment of leukemia: The invention relates to a combination which comprises (a) at least one compound decreasing the c-Src activity and (b) a pyrimidylaminobenzamide compound; to pharmaceutical compositions comprising said combinations; and to a method of treating a warm-blooded animal having leukemia, especially chronic myelogenous leukemia, comprising administering to the animal at least... Agent: Dilworth & Barrese, LLP

20100152199 - Heteroarylalkyl-8-azabicyclo[3.2.1]octane compounds as mu opioid receptor antagonists: wherein R1, R2, A, and m are defined in the specification, or a pharmaceutically-acceptable salt thereof, that are antagonists at the mu opioid receptor. The invention also provides pharmaceutical compositions comprising such compounds, methods of using such compounds to treat conditions associated with mu opioid receptor activity, and processes and... Agent: Theravance, Inc.

20100152200 - Alphavirus inhibitors and uses thereof: The present invention relates to chemical compounds, methods for their discovery, and their therapeutic use. In particular, the present invention provides compounds as inhibitors of alphaviruses.... Agent: Casimir Jones, S.c.

20100152201 - Oligomer-antihistamine conjugates: The invention provides antihistamine drugs that are chemically modified by covalent attachment of a water-soluble oligomer. A conjugate of the invention, when administered by any of a number of administration routes, exhibits characteristics that are different from the characteristics of the antihistamine drug not attached to the water-soluble oligomer.... Agent: Nektar Therapeutics

20100152203 - Thiadiazole-substituted arylamides as p2x3 and p2x2/3 antagonists: e

20100152202 - Tissue factor promoter polymorphisms: The invention provides compositions and methods for determining the likelihood of successful treatment with a pyrimidine based antimetabolite chemotherapy drug such as 5-fluorouracil or in combination with a platinum based chemotherapy drug, such as 5-fluorouracil/oxaliplatin. The methods comprise determining the genomic polymorphism present in a predetermined region of a gene... Agent: Foley & Lardner LLP

20100152204 - Treatment for spinal muscular atrophy: A method of treating spinal muscular atrophy. The method includes administering an effective amount of composition including a sodium-proton exchanger inhibitor and a pharmaceutically acceptable carrier or salt, to a subject with spinal muscular atrophy to ameliorate a symptom of spinal muscular atrophy.... Agent: Muncy, Geissler, Olds & Lowe, PLLC

20100152205 - Cxcr2 inhibitors: The present invention relates to compounds of formula (I) and the use of these compounds as pharmaceuticals, e.g. in preventing or treating a CXCR2 receptor mediated condition or disease.... Agent: Novartis Institutes For Biomedical Research, Inc.

20100152206 - Bicyclic dihydropyrimidines and uses thereof: The present invention provides compounds having formula (I): (I) and pharmaceutically acceptable derivatives thereof; as described generally and in subclasses herein, which compounds are useful as kinesin inhibitors (e.g., Eg5 inhibitors), and thus are useful, for example, for the treatment of proliferative disorders e.g., cancer. The invention additionally provides methods... Agent: Choate, Hall & Stewart Patent Group

20100152208 - Bicyclic heteroaromatic compounds as inhibitors of stearoyl-coenzyme a delta-9 desaturase: Bicyclic heteroaromatic compounds of structural formula I are inhibitors of stearoyl-coenzyme A delta-9 desaturase (SCD). The compounds of the present invention are useful for the prevention and treatment of conditions related to abnormal lipid synthesis and metabolism, including cardiovascular disease, such as atherosclerosis; obesity; Type 2 diabetes; insulin resistance; hyperglycemia;... Agent: Merck

20100152207 - Gonadotropin-releasing hormone receptor antagonists and methods relating thereto: GnRH receptor antagonists are disclosed which have utility in the treatment of a variety of sex-hormone related conditions in both men and women. The compounds of this invention have the structure, wherein R1a, R1b, R1c, R1d, R2, R2a, and A are as defined herein, including stereoisomers, esters, solvates and pharmaceutically... Agent: Cooley Godward Kronish LLP Attn: Patent Group

20100152209 - Compounds for modulating trpv3 function: The present application relates to compounds and methods for treating pain and other conditions related to TRPV3.... Agent: Ropes & Gray LLP

20100152210 - Purinyl derivatives and their use as potassium channel modulators: This invention relates to novel purinyl derivatives and their use as potassium channel modulating agents. Moreover the invention is directed to pharmaceutical compositions useful for the treatment or alleviation of diseases or disorders associated with the activity of potassium channels.... Agent: Birch Stewart Kolasch & Birch

20100152211 - Inhibitors of human phosphatidylinositol 3-kinase delta: Methods of inhibiting phosphatidylinositol 3-kinase delta isoform (PI3Kδ) activity, and methods of treating diseases, such as disorders of immunity and inflammation, in which PI3Kδ plays a role in leukocyte function are disclosed. Preferably, the methods employ active agents that selectively inhibit PI3Kδ, while not significantly inhibiting activity of other PI3K... Agent: Morrison & Foerster LLP

20100152212 - Preq1 riboswitches and methods and compositions for use of and with preq1 riboswitches: The preQ1 riboswitch is a target for antibiotics and other small molecule therapies. The preQ1riboswitch and portions thereof can be used to regulate the expression or function of RNA molecules and other elements and molecules. The preQ1 riboswitch and portions thereof can be used in a variety of other methods... Agent: Patent Correspondence Arnall Golden Gregory LLP

20100152213 - Compound that is a dual inhibitor of enzymes pde7 and/or pde4, pharmaceutical compositions and uses thereof: The invention relates to a series of dual inhibitors of enzymes PDE7 and PDE4, having formula (I) and to the use thereof in the production of pharmaceutical compositions for the treatment of inflammatory and/or autoimmune processes.... Agent: Ip Patent Docketing K&l Gates LLP

20100152214 - Novel pyrimidinecarboxamide derivatives: This disclosure relates to novel HIV integrase inhibitors their derivatives, pharmaceutically acceptable salts, solvates, and hydrates thereof. This disclosure also provides compositions comprising a compound of this disclosure and the use of such compositions in methods of treating HIV infections.... Agent: Fish & Richardson P.C.

20100152217 - Method for treating a pulmonary hypertension condition: A method for treating a pulmonary hypertension condition such as pulmonary arterial hypertension (PAH) in a subject comprises administering to the subject a therapeutically effective amount of ambrisentan, wherein, at baseline, time from first diagnosis of the condition in the subject is not greater than about 2 years.... Agent: Harness, Dickey, & Pierce, P.l.c

20100152215 - Methods of identifying activators of lyn kinase: The present invention relates to methods of identifying activators of lyn kinase by preincubating a test compound in the presence of lyn kinase; adding ATP and substrate to the lyn kinase and test compound; incubating the test compound, lyn kinase, ATP, and substrate; and measuring phosphorylation level of the substrate,... Agent: Pepper Hamilton LLP

20100152216 - Monocyclic anilide spirolactam cgrp receptor antagonists: (where variables A1, A2, B, J, K, m, n, R4, R5a, R5b and R5c are as defined herein) useful as antagonists of CGRP receptors and useful in the treatment or prevention of diseases in which the CGRP is involved, such as headache, migraine and cluster headache. The invention is also... Agent: Merck

20100152218 - Compositions and methods for inhibition of the jak pathway: The invention encompasses compounds having formula I and the compositions and methods using these compounds in the treatment of conditions in which modulation of the JAK pathway or inhibition of JAK kinases, particularly JAK3, are therapeutically useful.... Agent: Weaver Austin Villeneuve & Sampson LLP

20100152219 - Pyrazole derivatives as inhibitors of receptor tyrosine kinases: Compounds of formula (I): and their use in the inhibition of Trk activity are described.... Agent: Astrazeneca R&d Boston

20100152220 - Indene derivatives as pharmaceutical agents: m

20100152222 - Medicinal compositions comprising buprenorphine and nalmefene: An analgesic composition, in parenteral unit dosage form or in a unit dosage form suitable for delivery via the dermis or mucosa, comprises buprenorphine and an amount nalmefene such that the ratio by weight of buprenorphine to nalmefene delivered to or reaching the plasma of a patient is in the... Agent: Troutman Sanders LLP 5200 Bank Of America Plaza

20100152221 - Pharmaceutical composition: Provided herein is a pharmaceutical composition comprising an antagonist, an agonist, a seal coat, and a sequestering polymer, wherein the antagonist, agonist, seal coat and at least one sequestering polymer are all components of a single unit, and wherein the seal coat forms a layer physically separating the antagonist from... Agent: Patrick J. Halloran, Ph.d., J.d

20100152223 - Crystal form of cabergoline: The present invention relates to a cabergoline crystal form L, its preparation from halogenated aromatic solvents and aliphatic hydrocarbons and to pharmaceutical compositions containing the new form.... Agent: Arent Fox LLP

20100152224 - Scopine modulators of muscarinic acetylcholine receptor: The present invention relates to new scopine modulators of muscarinic acetylcholine receptors, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20100152225 - Hydrogenated pyrido [4,3-b] indoles such as dimebon for treating canine cognitive dysfunction syndrome: The invention provides method for treating Cognitive Dysfunction Syndrome (CCDS), slowing the onset and/or development and/or progression of CCDS or preventing the development of CCDS in canines, such as dogs, using hydrogenated pyrido[4,3-b]indoles, including dimebon.... Agent: Morrison & Foerster LLP

20100152227 - Methods for enhancing stability of polyorthoesters and their formulations: Disclosed herein are methods of enhancing the stability of a sustained pharmaceutical composition comprising an active agent and a polymer and methods of preparing such pharmaceutical compositions with enhanced stability.... Agent: Hamilton Desanctis & Cha, LLP

20100152228 - Pharmaceutical compositions and methods for relieving pain and treating central nervous system disorders: Patients susceptible to or suffering from disorders, such as central nervous system disorders, which are characterized by an alteration in normal neurotransmitter release, such as dopamine release (e.g., Parkinsonism, Parkinson's Disease, Tourette's Syndrome, attention deficient disorder, or schizophrenia), are treated by administering a compound of Formulas 1 or 2, as... Agent: Womble Carlyle Sandridge & Rice, PLLC

20100152226 - Sustained release implant for granisetron: The main goals of the invention are to develop the long-term release of Granisetron injection implant composition with biodegradable polymer and to develop relative processing. Granisetron is mixed with different biodegradable polymers, and then hot melt extrusion technique with different diameter, temperature, rate of extrusion and holding time is applied... Agent: Wpat, PC Intellectual Property Attorneys

20100152229 - Process for the synthesis of moxifloxacin hydrochloride: A new polymorph of moxifloxacin hydrochloride is described, together with a method for making the polymorph. In addition, new intermediates in the formation of moxifloxacin hydrochloride are described, having formulas (1) and (II):... Agent: Conley Rose, P.C.

20100152230 - Hydroxy substituted 1h-imidazopyridines and methods: Hydroxy substituted 1H-imidazo[4,5-c]pyridin-4-amines, with a hydroxy substituent at the 2-position, pharmaceutical compositions containing these compounds, methods of making the compounds, intermediates, and methods of use of these compounds as immunomodulators, for inducing cytokine biosynthesis in animals and in the treatment of diseases including viral and neoplastic diseases, are disclosed.... Agent: Pfizer Inc Mary J Hosley

20100152232 - 3-substituted-2(arylalkyl)-1-azabicycloalkanes and methods of use thereof: The present invention relates to 3-substituted-2-(arylalkyl)-1-azabicycloalkanes, methods of preparing the compounds and methods of treatment using the compounds. The azabicycloalkanes generally are azabicycloheptanes, azabicyclooctanes, or azabicyclononanes. The aryl group in the arylalkyl moiety is a 5- or 6-membered ring heteroaromatic, preferably 3-pyridinyl and 5-pyrimidinyl moieties, and the alkyl group is... Agent: Womble Carlyle Sandridge & Rice, PLLC

20100152233 - 3-substituted-2(arylalkyl)-1-azabicycloalkanes and methods of use thereof: The present invention relates to 3-substituted-2-(arylalkyl)-1-azabicycloalkanes, methods of preparing the compounds and methods of treatment using the compounds. The azabicycloalkanes generally are azabicycloheptanes, azabicyclooctanes, or azabicyclononanes. The aryl group in the arylalkyl moiety is a 5- or 6-membered ring heteroaromatic, preferably 3-pyridinyl and 5-pyrimidinyl moieties, and the alkyl group is... Agent: Womble Carlyle Sandridge & Rice, PLLC

20100152231 - Compositions useful for treating irritable bowel syndrome: The present invention relates to a method of treating irritable bowel syndrome with constipation (IBS-c) or irritable bowel syndrome with alternating constipation and diarrhea (IBS-a) in a subject in need of treatment. The method comprises administering to said subject a therapeutically effective amount of a thieno[3,2-b]pyridine compound of Structural Formula... Agent: Morgan, Lewis & Bockius LLP

20100152235 - Oxadiazole derivatives active on sphingosine-1-phosphate (s1p): The present invention relates to a novel oxadiazole derivative having pharmacological activity, processes for its preparation, pharmaceutical compositions containing it and its use in the treatment of various disorders.... Agent: Glaxosmithkline Corporate Intellectual Property - Uw2220

20100152234 - Substituted 4-(1,2,3,4-tetrahydroisoquinolin-2-yl)-4-oxobutyric acid amide as kcnq2/3 modulators: The invention relates to substituted tetrahydroisoquinolinyl-4-oxobutyric acid amides, methods for the preparation thereof, medicinal products containing these compounds and the use of these compounds for the preparation of medicinal products.... Agent: Briscoe, Kurt G. Norris Mclaughlin & Marcus, Pa

20100152236 - Cyclic amine compound: R8 is a hydrogen atom, a halogen atom, a group bonded via a carbon atom, a group bonded via a nitrogen atom, a group bonded via an oxygen atom or a group bonded via a sulfur atom, or a salt thereof has a superior action as an androgen receptor modulator,... Agent: Edwards Angell Palmer & Dodge LLP

20100152237 - Bis-pyrindino containing compounds for the use in the treatment of cns pathologies: N-n-Alkylation of nicotine converts nicotine from an agonist into an antagonist specifically for neuronal nicotinic acetylcholine receptor subtypes mediating nicotine-evoked dopamine release. Conformationally restricted analogs exhibit both high affinity and selectivity at this site, and are able to access the brain due to their ability to act as substrates for... Agent: Mcdermott Will & Emery LLP

20100152238 - Novel quinonoid derivatives of cannabinoids and their use in the treatment of malignancies: Novel cannabinoid-derived quinone derivatives (quinonoid derivatives) having a substituted hydroxyl group, pharmaceutical compositions comprising same and uses thereof as anti-proliferative agents, are provided.... Agent: The Nath Law Group

20100152239 - Method to improve survival in sepsis: This invention relates to the use of an α7nAChR-agonist such as GTS to control systemic inflammation during resuscitation following severe trauma such blood loss because of severe hemorrhage.... Agent: Umdnj Office Of Patents And Licensing

20100152240 - Pyrroline-2-one derivatives against cell releasing tumor necrosis factor, preparation methods and uses thereof: wherein A, B and E independently represent CH2 or CO; D represents S, NH, or NC1-6 alkylhydrocarbyl; R represents H or R3; R1 represents H, or 1-2 same or different occurrences of radical(s) selected from the group consisting of F, Cl, Br, C1-4 alkylhydrocarbyl, OH, OC1-4 alkylhydrocarbyl, NO2, NHC(O)C1-4 alkylhydrocarbyl,... Agent: Matthias Scholl

20100152241 - Inhibitors of store operated calcium release: Described herein are compounds and pharmaceutical compositions containing such compounds, which modulate the activity of store-operated calcium (SOC) channels. Also described herein are methods of using such SOC channel modulators, alone and in combination with other compounds, for treating diseases, disorders or conditions that would benefit from inhibition of SOC... Agent: Wilson, Sonsini, Goodrich & Rosati

20100152242 - Transdermal electrotransport delivery device including an antimicrobial compatible reservoir composition: A transdermal electrotransport drug delivery device having an anode, a cathode and a source of electrical power electrically connected to the anode and the cathode. At least one of the anode and the cathode includes an electrode and a reservoir comprised of a housing composed of a polymeric material and... Agent: Diehl Servilla LLC

20100152243 - Treatment of renal cell carcinoma: Methods are provided of treating renal cancer by administration of certain 3,3′,4,4′-tetrahydroxy-2,2′-bipyridine-N,N′-dioxide compounds, especially 3,3′,4,4′-tetrahydroxy-2,2′-bipyridine-N,N′-dioxide (Orellanine), using particular administration protocols and dosing regimens, as well as pharmaceutical compositions suitable for use in the treatment methods that are provided.... Agent: Lynn E Barber

20100152245 - Insecticidal n-substituted (6-halooalkylpyridin-3-yl)-alkyl sulfoximines: N-Substituted (6-haloalkylpyridin-3-yl)alkyl sulfoximines are effective at controlling insects.... Agent: Dow Agrosciences LLC

20100152244 - Self-emulsifying formulation of tipranavir for oral administration: A self-emulsifying formulation of tipranavir for oral administration.... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation

20100152247 - medicament for treating schizophrenia comprising cilostazol: The invention relates to a medicament for preventing and/or treating schizophrenia which comprises as an active ingredient cilostazol or a pharmaceutically acceptable salt thereof.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20100152246 - 5-oxoisoxazoles as inhibitors of lipases and phospholipases: The present invention relates to 5-oxoisoxazole derivatives of the formula I, the pharmaceutically usable salts thereof and the use thereof as medicinal substances.... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20100152248 - Ischemic disorder or disease inhibitors: The invention relates to the use of at least on inhibitor selected from the group consisting of raf-, protein kinase C(PKC)-, MEK1/2-, or ERK1/2-inhibitors, for the manufacturing of a medicament to be administrated from 1 up to 12 hours after initiation of an ischemic disease.... Agent: Merchant & Gould PC

20100152249 - Compositons and method for treatment of mood and cognitive impairments: Compositions, manufacture, and methods for diagnosis and treatment of subjects exhibiting mood disorders and/or being at risk of cognitive impairment.... Agent: Soody Tronson

20100152250 - Capsule formulation of pirfenidone and pharmaceutically acceptable excipients: A capsule formulation of pirfenidone is provided that includes pharmaceutically acceptable excipients. In one embodiment, this capsule formulation is capable of sustaining desirable pharmacokinetic responses in a patient. Further provided are methods of treating fibrotic conditions and other cytokine-mediated disorders by administering pirfenidone capsules of such formulation to a patient... Agent: Marshall, Gerstein & Borun LLP

20100152251 - Pyridine, quinoline, and isoquinoline n-oxides as kinase inhibitors: This invention relates to urea compounds containing a pyridine, quinoline, or isoquinoline functionality which is oxidized at the nitrogen heteroatom and which are useful in the treatment of (i) raf mediated diseases, for example, cancer, (ii) p38 mediated diseases such as inflammation and osteoporosis, and (iii) VEGF mediated diseases such... Agent: Millen, White, Zelano & Branigan, P.C.

20100152252 - Heterocyclyl-substituted-ethylamino-phenyl derivatives, their preparation and use as medicaments: The present invention relates to heterocyclyl-substituted-ethylamino-phenyl compounds of general formula (I), wherein K-L-M-N, Z and R1, R2, R3, R4 are as described in the claims methods for their preparation, medicaments comprising these compounds as well as their use for the preparation of a medicament for the treatment of humans or... Agent: Quarles & Brady LLP

20100152253 - Non-steroidal brassinosteroid mimetic: The present invention relates to non-steroidal mimetics of brassinosteroids. More specifically, it relates to non-steroidal monocyclic compounds, capable of rescuing the brassinosteroid receptor null mutation bri1-116. Preferably, said compounds are low molecular weight, monocyclic halogenated compound.... Agent: Traskbritt, P.C.

20100152254 - Alpha-halo- and alpha-alkyl-cyclopropylcarboxy compounds and uses thereof: Novel Alpha-halo- and Alpha-alkyl-cyclopropylcarboxy compounds, and uses of these and related compounds in the treatment of a variety of neurological diseases and disorders, and particularly epilepsy, are provided.... Agent: Martin D. Moynihan D/b/a Prtsi, Inc.

20100152255 - Organic compounds: provide pharmacological agents which bind to Peroxisome Proliferator-Activated Receptors (PPARs). Accordingly, the compounds of the present invention are useful for the treatment of conditions mediated by the PPAR receptor activity in mammals. Such conditions include dyslipidemia, hyperlipidemia, hypercholesteremia, atherosclerosis, hypertriglyceridemia, heart failure, myocardial infarction, vascular diseases, cardiovascular diseases, hypertension, obesity,... Agent: Novartis Institutes For Biomedical Research, Inc.

20100152256 - (2r)-2-[(4-sulfonyl) aminophenyl] propanamides and pharmaceutical compositions containing them: The present invention relates to novel (2R)-2-phenylpropanamides bearing a 4-sulfonylamino substituent on the 4 position of the phenyl group and to pharmaceutical compositions containing them, which are used as inhibitors of the chemotaxis of polymorphonucleate and mononucleate cells, and which are useful in the treatment of various ELR+CXC chemokine-mediated disorders.... Agent: Abelman, Frayne & Schwab

20100152257 - Antagonists of lysophosphatidic acid receptors: Described herein are compounds that are antagonists of lysophosphatidic receptor(s). Also described are pharmaceutical compositions and medicaments that include the compounds described herein, as well as methods of using such antagonists, alone and in combination with other compounds, for treating LPA-dependent or LPA-mediated conditions or diseases.... Agent: Wilson, Sonsini, Goodrich & Rosati

20100152258 - Angiotensin ii receptor antagonists: A compound having the structure (Formula I), wherein Y is —Y1, —Y2, —Y3, —Y4, —Y5; Y1 is C(O) or C(R1R2); Y2 is O, C(O), P(O)(OH) or CH2, provided that when Y1 is C(O), Y2 is not C(O); R1 is selected from the group consisting of hydrogen and C1-4 alkyl; R2... Agent: Covington & Burling, LLP Attn: Patent Docketing

20100152259 - Angiotensin ii receptor antagonists: A compound having the structure (Formula I), wherein R an angiotensin receptor antagonist active group, Y is Y1—Y2—Y3—Y4—Y5. Y1 is C(R1R2); R1 is selected from the group consisting of hydrogen and C1-4 alkyl; R2 is selected from the group consisting of hydrogen, C1-4 alkyl, and -0C(0)C1-4 alkyl; Y2 is O... Agent: Covington & Burling, LLP Attn: Patent Docketing

20100152260 - Cannabinoid receptor antagonists/inverse agonists useful for treating metabolic disorders, including obesity and diabetes: The present invention provides novel pyrazoles that are useful as cannabinoid receptor antagonists and pharmaceutical compositions thereof and methods of using the same for treating obesity, diabetes, and/or cardiometabolic disorders.... Agent: Vance Intellectual Property, PC

20100152261 - Novel nitrogen-containing heterocyclic compound: A nitrogen-containing heterocyclic derivative represented by the following general formula (I), or a hydrate or solvate thereof, which has a selective antagonistic action on the muscarinic M3 receptor and causes reduced cardiac side effect and thus is safe, and has superior pharmacological efficacy and prolonged action even by inhalation administration,... Agent: Leydig Voit & Mayer, Ltd

20100152262 - Buccal, polar and non-polar spray containing ondansetron: Buccal aerosol sprays or capsules using polar and non-polar solvents have now been developed which provide ondansetron for rapid absorption through the oral mucosa, resulting in fast onset of effect. The buccal polar compositions of the invention comprise formulation I: aqueous polar solvent, ondansetron, and optional flavoring agent; formulation II:... Agent: Dickstein Shapiro LLP

20100152263 - Therapy for the treatment of disease: Disclosed herein are pharmaceutical compositions comprising oxybutynin or tolterodine, or a free base thereof or a pharmaceutically acceptable salt thereof, and pilocarpine, or a free base thereof or a pharmaceutically acceptable salt thereof. Also disclosed are methods of treating a patient suffering from overactive bladder comprising administering to the patient... Agent: Techlaw LLP

20100152264 - 3- to 7-membered 1,3-diaza-4-oxo-heterocyclic derivatives capable of releasing active aldehydes or ketones: The present invention provides 3- to 7-membered 1,3-diaza-4-oxo-heterocyclic derivatives, such as imidazolidinone O derivatives, capable of releasing in a controlled manner a biologically active aldehyde or ketone in the surrounding. The invention also relates to the use of these compounds as perfuming or flavoring ingredients, as well as to the... Agent: Winston & Strawn LLP Patent Department

20100152265 - Indazole derivatives: Compounds represented by the Formula (A-1) and the Formula (1) or salt thereof are provided. The compounds represented by the Formula (A-1) and the Formula (1) or salt thereof have a β3 adrenergic receptor agonist activity, and therefore are useful as an agent for the prevention and treatment of diabetes,... Agent: Greenblum & Bernstein, P.L.C

20100152266 - Iodopyrazolyl carboxanilides: m

20100152267 - Novel rifamycin 3,4-(3-substituted aminomethyl) fused pyrrolo derivatives: The present invention is directed to novel 3,4-(3′-substituted aminomethyl) fused pyrrolo rifamyacin derivatives, pharmaceutical compositions containing them and the use of said derivatives and pharmaceutical compositions as antimicrobial agents against pathogenic microorganisms, particularly against resistant microbes.... Agent: Philip S. Johnson Johnson & Johnson

20100152268 - Stable atorvastatin formulations: The present invention provides novel alternative pharmaceutical compositions comprising amorphous atorvastatin or a pharmaceutically acceptable salt thereof and a controlled amount of one or more additional compounds selected from the group consisting of compounds of formula I (formed by ring opening of the epoxide of Formula II to form a... Agent: Cantor Colburn, LLP

20100152269 - Modified-release formulations of azabicyclo derivatives: The present invention discloses modified-release oral dosage forms of an azabicyclo derivative or its pharmaceutically acceptable salts, solvates, esters, enantiomers, diastereomers, N-oxides and polymorphs; and processes for the preparation thereof. The modified release formulation comprises an azabicyclo derivative, at least one rate-controlling polymer and at least one pharmaceutically acceptable excipient... Agent: Ranbaxy Inc.

20100152270 - Pesticide composition comprising a strigolactone derivative and a fungicide compound: e

20100152271 - Estrogen receptor modulators and uses thereof: A method for preventing, diagnosing, or treating a condition mediated by an estrogen receptor by administering to a patient in need thereof an effective amount of a compound of formula I, II, or a combination thereof: wherein R1, R3, R4, and R5 are independently selected from H, OH, and ORa;... Agent: Fox Rothschild LLP Princeton Pike Corporate Center

20100152272 - Functionalized drugs and polymers therefrom: where DRUG-OH, DRUG-COOH and DRUG-NH2 are biologically active compounds; each X is independently selected from —CH2COO— (glycolic acid moiety), —CH(CH3)COO— (lactic acid moiety), —CH2CH2OCH2COO— (dioxanone moiety), —CH2CH2CH2CH2CH2COO— (caprolactone moiety), —(CH2)yCOO—, where y is 2-4 or 6-24 and —(CH2CH2O)zCH2COO—, where z is 2-24; each Y is independently selected from —COCH2O— (glycolic... Agent: Fox Rothschild LLP Princeton Pike Corporate Center

20100152273 - Low-viscous anthracycline formulation: The present invention relates to formulations comprising an anthracycline compound and an aromatic or heterocyclic compound.... Agent: Ropes & Gray LLP

20100152274 - Crystalline forms of atorvastatin 4-(nitrooxy) butyl ester: The present invention relates to two crystalline forms designated as form A and form B, of (βR,δR)-2(4-fluorophenyl)-β,δ-dihydroxy-5-(1-methylethyl)-3-phenyl-4-[(phenylamino)carbon-yl]-1H-pyrrole-1-heptanoic acid 4-(nitrooxy)butyl ester (atorvastatin 4-(nitrooxy)butyl ester), represented by the formula (I), The invention also relates to processes for the preparation of the forms A and B, to pharmaceutical compositions comprising the two forms,... Agent: Arent Fox LLP

20100152275 - Drug or supplement combination with conjugated linoleic acid for fat loss in mammals: Food, feed or drug combinations with conjugated linoleic acid are described that cause enhanced fat loss in mammals more efficiently than any of the individual components of the combination. Food, feed, or drugs that activate AMP activated protein kinase, agonists of nuclear receptors that bind RXR in adipocytes, or statin... Agent: Michael Fromm

20100152276 - Deuterated aminocyclohexyl ether compounds and processes for preparing same: This invention is directed to deuterated aminocyclohexyl ether compounds and processes for preparing same and methods of using same.... Agent: Seed Intellectual Property Law Group PLLC

20100152277 - Diacylglycerol acyltransferase assay: The present invention generally provides a method of measuring the biological activity of diacylglycerol acyltransferase (DGAT). Specifically, the present invention provides a method for rapid, mass screening of compounds which are able to modulate the biological activity of DGAT. More specifically, the present invention provides an assay system for measuring... Agent: Philip S. Johnson Johnson & Johnson

20100152283 - Tetrahydrocannabinol modulators of cannabinoid receptors: The present invention relates to new tetrahydrocannabinol modulators of cannabinoid receptors, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20100152285 - Flavononol renin inhibitor compounds and methods of use thereof: e

20100152284 - Prevention and reversal of chemotherapy-induced peripheral neuropathy: Provided herein are methods for treating or preventing neuropathy, neuropathy-related conditions, wherein the neuropathy or neuropathy-related conditions are induced by, or otherwise associated with, treatment of the subject with at least one chemotherapeutic agent, the methods comprising administering an effective amount of an isoflavonoid compound of formula (I). Also provided... Agent: Mchale & Slavin, P.A.

20100152286 - Method for producing fucoxanthin: The present invention provides a method for producing fucoxanthin extract, said method comprising: performing absorption of the fucoxanthin extract by using absorbent and then performing elution to remove heavy metals and arsenic salt contained in the fucoxanthin extract, wherein the absorbent is selected from a group having macroporous resin, polyamide,... Agent: Lariviere, Grubman & Payne, LLP

20100152287 - Dispersions containing iodopropargyl compounds: Aqueous dispersion containing at least one iodopropargyl compound and at least one block and/or black copolymers on an ethylene and/or propylene oxide basis, having a numerically determined mean molecular weight greater than 1000 g/mol.... Agent: Lanxess Corporation

20100152288 - Novel a-lipoic acid derivatives and applications thereof: u

20100152289 - Organic sulfur compound and its use for controlling harmful arthropod: wherein R1 represents a C3-C6 haloalkyl group having at least one fluorine atom and at least one atom selected from group consisting of a chlorine atom, a bromine atom and an iodine atom, R2 represents a cyano group and the like, R3 represents a hydrogen atom, a halogen atom or... Agent: Birch Stewart Kolasch & Birch

20100152290 - Benzo lipoxin analogues: Benzolipoxin analogs, methods of their preparation and pharmaceutical compositions containing the compounds are provided. The compounds and compositions are useful in methods for treatment of various diseases, including, inflammation, autoimmune disease and abnormal cell proliferation.... Agent: Fish & Richardson, PC

20100152291 - Production method of capsinoid by dehydrating condensation, stabilizing method of capsinoid, and capsinoid composition: n

20100152292 - Production of peracids using an enzyme having perhydrolysis activity: A method is provided for producing peroxycarboxylic acids from carboxylic acid esters. More specifically, carboxylic acid esters are reacted with an inorganic peroxide, such as hydrogen peroxide, in the presence of an enzyme catalyst having perhydrolysis activity derived from Bacillus sp. to produce peroxycarboxylic acids.... Agent: Potter Anderson & Corroon LLP Attn: Janet E. Reed, Ph.d.

20100152293 - Use of polyunsaturated ketones for the treatment of psoriasis: Psoriasis is a common, chronic, inflammatory skin disorder. This invention provides the use of a compound of formula (I) R—CO—X) (Wherein R is a C16-24 unsaturated hydrocarbon group optionally interrupted by α, β, γ, or δ to the carbonyl group by a heteroatom or group of heteroatoms selected from S,... Agent: Edwards Angell Palmer & Dodge LLP

20100152294 - Assays for detecting inhibitors of binding between cox-2 and pdz proteins: The invention provides an assay for determining whether a test agent is a COX modulator. In general terms, the assay includes: determining whether a test agent modulates binding of a PDZ-containing polypeptide to a COX PL-containing polypeptide. The PDZ-containing polypeptide may contain the PDZ domain of PDZ domain of MAGI1,... Agent: Townsend And Townsend And Crew, LLP

20100152295 - Methods of reducing small, dense ldl particles: The present invention provides methods for increasing LDL particle size.... Agent: Townsend And Townsend And Crew, LLP

20100152296 - Photopolymerization material for gums isolation: The main goal of the present invention is the development of a polymerizable material for isolation and protection of the gums and generally the soft tissues of the oral cavity. For better protection during various procedures of the dental surfaces. The composition of the material can contain many other substances... Agent: Keown & Zucchero, LLP

20100152297 - Composition for regulating cellular senescence comprising n-[2-(cyclohexy-loxyl)-4-nitrophenyl]-methanesulfonamide: The present invention relates to a composition for inhibiting cellular senescence, comprising N-[2-(cyclohexyloxyl)-4-nitrophenyl]-methanesulfonamide. During the progression of cellular senescence, the expression of COX-2 was decreased, whereas the enzymatic activity of COX-2 was increased, and the cellular senescence regulatory effects of the three selective COX-2 inhibitors had no connection with the... Agent: Jhk Law

20100152298 - present invention relates to a treatment for the management of cancer more specially the use of flutamide anti-androgen drugsa: This invention helps in the treatment and the management of cancer. It is the use of flutamide drug to treat and manage cancer where the Flutamide anti-androgen drug acts in another mechanism other than the well know androgen respects (AR) mechanism.... Agent: Furr Law Firm

20100152299 - Process for making compositions with poorly compressible therapeutic compounds: A process for preparing solid dosage forms that contain poorly compressible therapeutic compound. The process, for example, provides for the inventive use of an extruder, especially a twin screw extruder, to melt granulate a therapeutic compound(s) with a granulation excipient.... Agent: Novartis Corporate Intellectual Property

20100152300 - Stabilized compositions of alkylating agents and methods of using same: Provided are stable compositions comprising alkylating agents, including nitrogen mustards, that are suitable for topical use, and methods for treating skin disorders comprising topically administering the compositions.... Agent: Wilson, Sonsini, Goodrich & Rosati

20100152301 - Treatment of viral infections: Treatment of cells or subjects (e.g., humans, animals) carrying or infected with a virus capable of causing an immunodeficiency disease by administration of one or more compounds that inhibit integrase.... Agent: Edwards Angell Palmer & Dodge LLP

20100152302 - Novel crystalline forms of atovaquone: The present invention relates to two novel and stable crystalline forms of atovaquone, to processes for their preparation and to pharmaceutical compositions comprising them. The present invention also provides crystalline particles of atovaquone having a specific surface area of from about 0.7 m2/g to about 4 m2/g, methods for the... Agent: Caesar, Rivise, Bernstein, Cohen & Pokotilow, Ltd.

20100152303 - Agents and method for increasing brain chaperonin levels: The invention includes; a method of modulating a level of chaperone protein, a method of modulating a level of ERP57, a method of alleviating a symptom of a disease associated with decreased levels of chaperone proteins, and a method of alleviating a symptom of Alzheimer's disease. The methods include administering... Agent: Merchant & Gould PC

20100152304 - Pharmaceutical composition comprising periplaneta americana or its ethanol extract and a method of using the same for treating inflammations: The present invention relates to Periplaneta Americana or its ethanol extract for the treatment of inflammation. Specifically, said inflammation includes cervical erosion, ulcerative colitis, skin ulcer, mucosal ulcer and postoperative condyloma acuminatum. Treating said disorders by Periplaneta Americana or its ethanol extract has the advantages of effectively reducing bleeding, shortering... Agent: Ladas & Parry LLP

20100152305 - Methods of treatment of hyperuricemia and associated disease states: The present disclosure relates to compositions and methods for reducing uric acid levels in a individual in need thereof. The present disclosure further relates to the treatment of hyperuricemia and diseases associated with high uric acid levels in mammals using scyllo-inositol.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20100152306 - Sensitive skin perfumes: The invention relates to a fragrance composition for use in cosmetic, toiletry, personal care and cleansing, household cleaning and laundry products which comprises two to ten well characterized fragrance materials having a cosmetic function, of which at least two are selected from: allyl caproate, benzyl acetate, benzaldehyde, dihydroisojasmonate, ethyl phenethylacetal,... Agent: Sughrue-265550

06/10/2010 > patent applications in patent subcategories. invention type

20100144590 - Biocompatible phase invertable proteinaceous compositions and methods for making and using the same: Biocompatible phase invertible proteinaceous compositions and methods for making and using the same are provided. The subject phase invertible compositions are prepared by combining a proteinaceous substrate and a crosslinking agent, such as a stabilized aldehyde crosslinking agent. Also provided are kits for use in preparing the subject compositions. The... Agent: Bozicevic, Field & Francis LLP

20100144587 - Frequency modulated drug delivery (fmdd): Embodiments of the present disclosure include a coordination complex, comprising a first biologically active moiety, a second biologically active moiety, and a metal, wherein the first biologically active moiety and second biologically active moiety are bound to the metal by covalent coordination bonds, and wherein the first biologically active moiety... Agent: Reed Smith LLP

20100144589 - Methods of predicting cancer lethality using replikin counts: The present invention provides methods of predicting the relative growth rate, replication rate, or lethality of a first malignancy as compared to another malignancy or as compared to a plurality of malignancies, including methods of predicting the relative growth rate, replication rate, or relative lethality of a primary malignancy as... Agent: Kenyon & Kenyon LLP

20100144588 - Proton acceptor iminium/carbocation-type coupling agents: Novel iminium-type coupling agents containing proton acceptors in their iminium moiety, which can be used beneficially as coupling agents in various chemical polypeptide and/or polynucleotide syntheses, and are particularly useful as yield enhancing and racemization suppressing coupling agents for use in peptide syntheses, are disclosed. Further disclosed are a process... Agent: Martin D. Moynihan D/b/a Prtsi, Inc.

20100144591 - Benzimidazole derivatives and methods of use thereof: The present invention relates to compounds of formula (I); compositions comprising the compounds, and methods of using the compounds to treat or prevent pain, diabetes, a diabetic complication, impaired glucose tolerance (IGT) or impaired fasting glucose (IGT) in a patient.... Agent: Merck Patent Department (k-6-1, 1990)

20100144593 - Pharmaceutical compositions and methods for insulin treatment: Compositions and methods for treating a patient with insulin that combines insulin, a permeation enhancer, and a carrier that maintains an acidic pH, are disclosed.... Agent: Axinn, Veltrop & Harkrider LLP Attn. Michael A. Davitz

20100144592 - Stable non-aqueous pharmaceutical compositions: The present invention relates to shelf stable non-aqueous pharmaceutical compositions, and to the use thereof in methods of treating diabetes and hyperglycaemia, comprising dehydrated active polypeptide comprising 10-100 amino acids and at least one semi-polar protic organic solvent.... Agent: Novo Nordisk, Inc. Intellectual Property Department

20100144594 - 2-heteroaryl-pyrrolo[3,4-c]pyrrole derivatives and their use as scd inhibitors: e

20100144596 - An apo-ferredoxin preparation, a process for producing same and uses thereof: A process for obtaining a pure preparation of an apo- form of an [Fe2S2] ferredoxin is provided. The process comprising, applying a solution comprising a holo- form of the [Fe2S2] ferredoxin on an anion exchange column; and eluting the [Fe2S2] ferredoxin from the anion exchange column with a solution comprising... Agent: Martin D. Moynihan D/b/a Prtsi, Inc.

20100144595 - Lyophilization of hemoglobin solutions: A lyophilized hemoglobin composition and a method for lyophilizing hemoglobin are described. The method of the invention produces a reconstituted hemoglobin solution which is not altered in functional properties from the hemoglobin solution prior to lyophilization.... Agent: Elizabeth Hart-wells University Of Maryland, Baltimore

20100144597 - Novel combinatorial approaches to enhancing oxygen transport to tissues: The subject application provides for a method for enhancing oxygen delivery to a tissue in a subject comprising administering to the subject a composition comprising two or more compounds selected from the group consisting of a hemoglobin based oxygen carrier, a nonhemoglobin based oxygen carrier, a rheologic modulator, a diffusion... Agent: Cooper & Dunham, LLP

20100144601 - Anti-tnf alpha fibronectin type iii domain based scaffold compositions, methods and uses: A protein scaffold based on a consensus sequence of the tenth fibronectin type III (FN3) repeat from human fibronectin, preferably human Tenascin, that binds to human TNFα including isolated nucleic acids that encode a protein scaffold, vectors, host cells, and methods of making and using thereof have applications in diagnostic... Agent: Philip S. Johnson Johnson & Johnson

20100144603 - Methods and uses thereof of prosaposin: The invention relates to methods for treating of tumor metastasis, methods for preventing, inhibiting, and predicting tumor recurrence and tumor metastasis, and methods of preventing cancer development for one at risk of developing cancer, for one diagnosed with a benign cancer, and/or for one diagnosed with malignant cancer. The invention... Agent: David S. Resnick

20100144602 - Methods of inhibiting metastatic cancer by administration of streptolysin o: The invention provides a method for administering streptolysin O for treatment of various conditions including connective tissue disorders, reproductive fibroses and conditions mediated by the CD44 receptor. The invention also provides methods for protecting nerve cells from the effects of neurotoxic agents by the administration of streptolysin O.... Agent: Marshall, Gerstein & Borun LLP

20100144598 - Natural polypeptides for oral health care: The present invention relates generally to dental diseases, caries and periodontal disease. More specifically, the invention relates to Lactoferrin and Statherin fusion proteins (STAT-LF) along with therapeutic, diagnostic and research uses for these polypeptides. The present invention also provides methods of treating dental diseases, caries and periodontal disease.... Agent: Patent Docket Administrator Lowenstein Sandler PC

20100144604 - Novel cellular factor-containing solution compositions: The invention is directed to novel cellular factor-containing solution compositions (referred to herein as “CFS” compositions), including novel sustained-release cellular factor-containing solution compositions (referred to herein as “SR-CFS” compositions), methods of making such novel compositions and uses thereof.... Agent: Linda O. Palladino

20100144600 - Osteoprotegerin variant proteins: The present invention relates to novel osteoprotegerin variant proteins (OVPs) that demonstrate reduce binding affinity for their ligand TRAIL when compared to wild-type osteoprotegerin. Nucleic acids which encode these OVPs are also provided. Recombinant vectors and host cells expressing these OVPs are also encompassed as are methods of producing recombinant... Agent: Quine Intellectual Property Law Group, P.C.

20100144605 - Rescue of gonadotropin releasing hormone receptor mutants: Herein disclosed is a method of rescuing gonadotropin-releasing hormone receptor (GnRHR) mutants with IN3 or a mimetic thereof. IN3 significantly rescues 11 missense mutations as assessed by radioligand binding and by IP production. Such rescue occurred despite widely disparate loci along the receptor. In addition, many altered GnRH receptors (terminally... Agent: Klarquist Sparkman, LLP

20100144599 - Vegf pathway blockade: The present invention relates to innovative proteins that block the VEGF-VEGFR pathway mediated biology and pathology, as well as pharmaceutical formulations of these proteins. The invention also relates to dosage therapies for the administration of these proteins. The invention further relates to the use of VEGF-A as a biomarker for... Agent: Ropes & Gray LLP

20100144606 - Combination 408: The invention provides a pharmaceutical product, kit or composition comprising a first active ingredient which is N-Cyclohexyl-N3-[2-(3-fluorophenyl)ethyl]-N-(2-{[2-(4-hydroxy-2-oxo-2,3-dihydro-1,3-benzothiazol-7-yl)ethyl]amino}ethyl)-β-alaninamide or a salt thereof, and a second active ingredient selected from: a non-steroidal Glucocorticoid Receptor (GR Receptor) Agonist; an antioxidant; a CCR1 antagonist; a chemokine antagonist (not CCR1); a corticosteroid; a CRTh2 antagonist;... Agent: Astra Zeneca Pharmaceuticals Lp Global Intellectual Property

20100144607 - Anti-inflammatory and antiallergic cyclic peptides: The present invention refers to synthetic, cyclic peptides containing a sequence of 13 L-amino acids in their primary structure which present anti-inflammatory and antiallergic activities, useful for the treatment of acute or chronic inflammation and/or allergies, being particularly useful for the treatment of acute or chronic allergic asthma. The invention... Agent: Birch Stewart Kolasch & Birch

20100144608 - Macrocyclic hepatitis c serine protease inhibitors: The present invention relates to novel macrocyclic compounds and methods of treating a hepatitis C infection in a subject in need of such therapy with said macrocyclic compounds. The present invention further relates to pharmaceutical compositions comprising the compounds of the present invention, or pharmaceutically acceptable salts, esters, or prodrugs... Agent: Edwards Angell Palmer & Dodge LLP

20100144609 - Methods using cyclosporin in treating patients with intraocular lenses: Methods of treating a patient are disclosed in which a cyclosporine component is administered to the patient and an intraocular lens is inserted into an eye of the patient. One or more benefits to the patient may be obtained by practicing the present methods.... Agent: Allergan, Inc.

20100144610 - Pharmaceutical formulations: An aspect of the present invention provides for a medicament including a solution containing pleconaril or a pharmaceutically acceptable salt thereof, wherein at least one solvent including the solution is a pleconaril-dissolving hydrofluorocarbon.... Agent: Merck Patent Department (k-6-1, 1990)

20100144612 - Phosphorylated pyrone analogs and methods: The invention relates to phosphorylated polyphenols, phosphorylated flavonoids, and phosphorylated pyrone analogs. Methods and compositions for the modulation of side effects of substances using such phosphorylated compounds are described. Methods and compositions are described for the modulation of blood-tissue barrier (BTB) transporter activity to increase the efflux of drugs and... Agent: Wilson, Sonsini, Goodrich & Rosati

20100144611 - Treatment of t-cell mediated diseases: The invention provides a method of treating T-cell mediated diseases and a method of inhibiting the activation of T-cells using certain diketopiperazines. The invention also provides methods of synthesizing diketopiperazines and pharmaceutical compositions comprising certain diketopiperazines. The invention further provides methods of making improved pharmaceutical compositions of proteins and peptides... Agent: Sheridan Ross PC

20100144614 - Altering memory by affecting staufen function: The present invention provides methods for screening a pharmaceutical agent for its ability to modulate long term memory formation, performance of a hippocampal-dependent cognitive task or STAUFEN function. The present invention also provides methods for modulating long term memory formation or performance of a hippocampal-dependent cognitive task by modulating staufen-dependent... Agent: Don J. Pelto Sheppard, Mullin, Richter & Hampton LLP

20100144619 - Antimicrobial protein specific to staphylococcus aureus: The present invention relates to a novel bacteriophage-originated protein having antimicrobial activity, more precisely an antimicrobial protein originated from lytic bacteriophage having killing activity specific to Staphylococcus aureus which is the causing agent of infectious diseases in human and animals, a pharmaceutical composition for the prevention and treatment of the... Agent: Ballard Spahr LLP

20100144623 - C-terminal domain truncation of mglur1a by calpain and uses thereof: A composition comprising a peptide or a peptidomimetic thereof that inhibits the C-terminal domain truncation of mGluR1α by calpain, wherein the peptide is 10-30 amino acids in length and contains a sequence that is at least 70% homologous to VIKPLTKSYQGSGK. Also disclosed are methods of detecting the C-terminal domain truncation... Agent: Hogan & Hartson L.L.P.

20100144633 - Chloroplast expression of membrane proteins: Disclosed herein are chloroplast transformation vectors constructed to enable expression and hyperaccumulation of membrane proteins in chloroplasts. Another embodiment relates to plants transformed with such vectors. Another embodiment relates to seeds and other plant tissues transformed with such vectors. Another embodiment relates to a method of increasing expression of membrane... Agent: Timothy H. Van Dyke

20100144613 - Combined use of dpp-iv inhibitors and gastrin compounds: The invention relates to compositions, conjugates, and methods for the prevention and/or treatment of a condition and/or disease comprising a therapeutically effective amount of a DPP-IV inhibitor and a gastrin compound. The combination of a DPP-IV inhibitor and a gastrin compound provides beneficial effects, in particular sustained beneficial effects, in... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100144620 - Complementation of factor xi deficeincy by factor v mutants: Described are methods for preventing and/or treating bleeding in a subject with Factor XI deficiency, such as hemophilia C, which methods comprise administering to the subject APC-resistant Factor V.... Agent: Traskbritt, P.C.

20100144634 - Compositions and methods for modulation of adamts13 activity: Compositions and methods are provided for the diagnosis and treatment of thrombotic thrombocytopenic purpura (TTP), stroke and myocardial infarction.... Agent: Dann, Dorfman, Herrell & Skillman

20100144618 - Compositions containing an intestinal trefoil peptide and a mucoadhesive: The invention features compositions containing an intestinal trefoil peptide and a mucoadhesive excipient. Such compounds are useful, e.g., for the treatment or prevention of lesions. Compositions containing an intestinal trefoil peptide and a mucoadhesive excipient may be formulated in combination with one or more additional therapeutic agents.... Agent: Clark & Elbing LLP

20100144630 - Compositions, methods and uses for inhibition and/or treatment of influenza infection: Embodiments of the present invention illustrate methods and compositions for treating medical disorders. In certain embodiments, compositions and methods relate to reducing or inhibiting onset, transmission or development of a viral disorder.... Agent: Faegre & Benson LLP Patent Docketing - Intellectual Property

20100144631 - Concentrated protein preparations of bone morphogenetic proteins and methods of use thereof: Disclosed herein are heretofore undescribed preparations of highly concentrated, solubilized proteins, such as but not limited to, Bone Morphogenetic Proteins. Such protein preparations can be formulated in an aqueous carrier at protein concentrations in excess of 10 mg/ml when using the methods of manufacture taught herein. Such methods yield stable... Agent: K&l Gates LLP

20100144638 - Glucagon-like peptide-1 secretagogue, glucagon-like peptide-1 secretagogue food or drink, inhibitor of postprandial rise in blood glucose, and inhibitory food or drink of postprandial rise in blood glucose: The invention relates to a GLP-1 secretagogue and an inhibitor of postprandial rise in blood glucose, containing κ-casein as an active ingredient, and a food or drink for promoting GLP-1 secretion and an inhibitory food or drink of postprandial rise in blood glucose, containing a milk-derived casein protein wherein κ-casein... Agent: Wood, Herron & Evans, LLP

20100144628 - Hepatopoietin and use thereof: Provided are a hepatopoietin PCn (HPPCn) and its homologous proteins, which can promote hepatocyte proliferation in vitro, promote liver regeneration in vivo, inhibit the growth of tumor cells and promote the apoptosis of tumor cells. The hepatopoietin PCn (HPPCn) and its homologous proteins are useful for the treatment of acute... Agent: Fish & Richardson PC

20100144629 - Method to treat inflammation: The present invention relates generally to the fields of pharmacology, and particularly to a method for treating inflammation, particularly inflammation of the respiratory system. The invention provides a method to reduce or ameliorate inflammation, by administering an effective amount of a protein factor originally isolated from thymic tissue, and referred... Agent: Morrison & Foerster LLP

20100144635 - Methods and compositions to treat myocardial conditions: Methods, devices, kits and compositions to treat a myocardial infarction. In one embodiment, the method includes the prevention of remodeling of the infarct zone of the ventricle. In other embodiments, the method includes the introduction of structurally reinforcing agents. In other embodiments, agents are introduced into a ventricle to increase... Agent: Abbott Cardiovascular Systems Inc./bstz Blakely Sokoloff Taylor & Zafman LLP

20100144627 - Methods for modulating set and uses thereof: The present invention provides methods for modulating SET activity by contacting SET with a binding agent such as an ApoE peptide derivative. In one embodiment of the invention, a pharmaceutical composition capable of modulating SET activity is administered to a patient for the treatment of an inflammatory or neurological condition.... Agent: Cooley Godward Kronish LLP Attn: Patent Group

20100144622 - Methods for production of recombinant plasminogen and plasmin polypeptides: Methods of producing properly refolded recombinant plasminogen and plasmin polypeptide are provided. Denatured recombinant plasminogen polypeptide is refolded by first solubilizing the polypeptide with a chaotroph and reducing and oxidizing agents at high pH, followed by refolding in the presence of reduced concentration of chaotroph and reducing and oxidizing agents... Agent: Morrison & Foerster LLP

20100144640 - Molecules designated b7l-1: The invention is directed to B7L-1 as a purified and isolated protein, the DNA encoding the B7L-1, host cells transfected with cDNAs encoding B7L-1 and processes for preparing B7L-1 polypeptides.... Agent: Immunex Corporation Law Department

20100144616 - Neuroprotective methods and reagents: One aspect of the present application relates to a method for limiting damage to neuronal cells by ischemic or epoxic conditions, e.g., such as may be manifest by a reduction in brain infarct volume, by administering to an individual a hedgehog therapeutic or ptc therapeutic in an amount effective for... Agent: Ropes & Gray LLP

20100144637 - Nucleic acid and corresponding protein entitled 161p5c5 useful in treatment and detection of cancer: A novel gene (designated 161P5C5) and its encoded protein, and variants thereof, are described wherein 161P5C5 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 161P5C5 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 161P5C5 gene... Agent: Agensys C/o Morrison & Foerster LLP

20100144615 - Nucleotide sequence encoding a modulator of nf-kb: The present invention relates to nucleotide sequences encoding a modulator of NF-κB, and to the polypeptides encoded by the nucleotide sequences. In particular, the invention relates to nucleotide sequences and the polypeptides encoded thereby, wherein the polypeptides are involved in the response to NF-κB-activating stimuli, including HTLV-1 Tax, LPS, PMA... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20100144625 - Organic compounds: A powder formulation for inhalation comprising a macromolecule and a crystalline carrier material.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100144617 - Oxyntomodulin derivatives: Modified oxyntomodulin derivatives. Such derivatives can be used for the treatment of metabolic diseases such as diabetes and obesity.... Agent: Merck

20100144636 - Peptides derived from ras-p21 and uses therefor: A method of treating ras-transformed and ras-related cancer, including: administering to a plurality cells, including ras-transformed cancer cells and normal cells, a peptide material having a membrane resident peptide and a ras-p21 component, the membrane resident peptide attached to the carboxyl or amino terminal end of the ras-p21 component.... Agent: Hoffmann & Baron, LLP

20100144624 - Process for the preparation of compositions of at1 receptor antagonist and angiotensin-(1-7): We describe preparation of compounds of an AT1 receptor antagonist(s) and Angiotensin (1-7), for example, Angiotensin-(1-7) losartanate and analogues thereof, and/or mixtures of these systems, pharmaceutical compositions thereof and use of their derivative products. Cyclodextrins and derivatives thereof may be used for the micro-encapsulation of compounds, for example, Angiotensin (1-7)... Agent: Nixon & Vanderhye, PC

20100144626 - Treatment of multi-drug resistant bacterial infections: There is described an imidazole for the treatment of an infection caused or contributed to by microorganisms resistant to antibiotics. There is also described a method of treating a patient suffering from an infection caused or contributed to by microorganisms resistant to antibiotics, said method comprising the step of administering... Agent: Ip Patent Docketing K&l Gates LLP

20100144632 - Truncated 24kda basic fibroblast growth factor: The invention relates to fragments of an amino acid sequence of mature, full length 24 kDa fibroblast growth factor-2 or an analog thereof. The fragments have an activity that inhibits the migration of cultured cells as well as inhibiting angiogenesis, tumor growth, or any other processes that involve the migration... Agent: T. D. Foster

20100144621 - Use of exendins and exendin agonists and glp-1 receptor agonists for altering the concentration of fibrinogen: The present invention relates to altering the concentration of fibrinogen, specifically, for example, by decreasing fibrinogen concentration. The present invention also relates to methods for improving the cardiovascular risk profile of a subject by decreasing fibrinogen concentration.... Agent: Intellectual Property Department Amylin Pharmaceuticals, Inc.

20100144639 - Use of inhibitors of the egfr-mediated signal transduction for the treatment of benign prostatic hyperplasia (bph) / prostatic hypertrophy: The present invention relates to the use of specific EGF-receptor antagonists for preparing a pharmaceutical composition for the prevention and/or treatment of benign prostatic hyperplasia and/or prostatic hypertrophy, a method for the treatment or prevention of benign prostatic hyperplasia/prostatic hypertrophy comprising administering an EGF-receptor antagonist of groups (A), (B) or... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation

20100144641 - Compositions having antiangiogenic activity and uses thereof: The invention generally features compositions and methods that are useful for modulating blood vessel formation, as well as methods that provide for the systematic and efficient identification of angiogenesis modulators. As described in more detail below, a systematic computational methodology based on bioinformatics was used to identify novel peptide modulators... Agent: Edwards Angell Palmer & Dodge LLP

20100144642 - Peptides and apl-type derivatives of hsp60 and pharmaceutical compositions: Peptides of human heat shock protein of 60 kDa, that constitute epitopes for T cells, as well as their derived peptides, which are modified at the contact sites with the MHC molecule, are useful to induce mechanisms of peripheral tolerance, in particular mechanisms of anergy or mediated by clones of... Agent: Hoffmann & Baron, LLP

20100144644 - Metal-binding compounds and uses therefor: The invention provides a method of reducing the damage done by reactive oxygen species (ROS) in an animal. The invention also provides a method of reducing the concentration of a metal in an animal. These methods comprise administering to the animal an effective amount of a metal-binding compound as further... Agent: Sheridan Ross PC

20100144643 - Polymeric biosufactants: The present invention is directed to biosurfactants that can self-assemble or auto-aggregate into polymeric micellar structures and their use in topically-applied dermatologic products. The invention relates in particular to polymeric acylated biosurfactants (PABs) conforming to the formula Acyl-AA-Term where Acyl is an 8- to 22-membered carbon chain, branched or unbranched,... Agent: Louis C. Paul

20100144645 - Compositions and methods for enhancing analgesic potency of covalently bound-compounds, attenuating its adverse side effects, and preventing their abuse: The invention generally relates to compositions and methods with covalently bound compounds, such as controlled substances covalently attached to a chemical moiety, and opioid antagonists or covalently bound opioid antagonists to enhance analgesic potency and/or attenuate one or more adverse effects of covalently bound compounds, including adverse side effect(s) in... Agent: Darby & Darby P.C.

20100144646 - Method of diagnosing and treating asthma: The present invention provides materials and methods to diagnose asthma. In some embodiments, the present invention provides a method of diagnosing asthma by measuring the zonulin level of a subject. The present invention also provides methods and compositions for treating asthma that comprise one or more zonulin antagonist.... Agent: Cooley Godward Kronish LLP Attn: Patent Group

20100144648 - Compounds for enzyme inhibition: One aspect of the invention relates to inhibitors that preferentially inhibit immunoproteasome activity over constitutive proteasome activity. In certain embodiments, the invention relates to the treatment of immune related diseases, comprising administering a compound of the invention. In certain embodiments, the invention relates to the treatment of cancer, comprising administering... Agent: Ropes & Gray LLP

20100144649 - Compounds for enzyme inhibition: One aspect of the invention relates to inhibitors that preferentially inhibit immunoproteasome activity over constitutive proteasome activity. In certain embodiments, the invention relates to the treatment of immune related diseases, comprising administering a compound of the invention. In certain embodiments, the invention relates to the treatment of cancer, comprising administering... Agent: Ropes & Gray LLP

20100144647 - Dual acting prodrugs: The present invention relates to a prodrug which comprises at least two different pharmaceutically and/or diagnostically active compounds independently bound by cleavable linkers and a protein-binding moiety which is capable of binding to carrier a molecule.... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20100144650 - Dimeric iap inhibitors: Compounds, compositions, and methods of using such compounds to modulate apoptosis including IAP antagonists are provided herein. Compositions including mimetics of the invention and, optionally, secondary agents, may be used to treat proliferative disorders such as, cancer and autoimmune diseases.... Agent: Banner & Witcoff, Ltd.

20100144652 - Composition comprising a glycolytic inhibitor and a ring system comprising a sulphamate group for the treatment of cancer: The present invention provides a composition comprising (a) a glycolytic inhibitor (b) a compound comprising a ring system substituted with at least one of a suiphamate group and an alkoxy group; wherein (a) and (b) are different.... Agent: Hunton & Williams LLP Intellectual Property Department

20100144651 - Novel glucopyranose esters and glucofuranose esters of alkyl- fumarates and their pharmaceutical use: The present invention relates to novel glucofuranose esters and glucopyranose esters of alkyl-fumarates. The esters are suitable for use as active substances in the treatment of e.g. psoriasis or other hyperproliferative, inflammatory or autoimmune disorders.... Agent: Darby & Darby P.C.

20100144654 - Crystalline forms of 1,6-bis [3-(3-carboxymethylphenyl)-4-(2-alpha-d-mannopyranosyl-oxy)-phenyl] hexane: The novel crystalline and polymorphic forms of 1,6-Bis [3-(3-carboxymethylphenyl)-4-(2-α-D-mannopyranosyloxy)-phenyl] hexane have advantageous properties and can be used in pharmaceutical and dermatological compositions.... Agent: O'brien Jones, PLLC

20100144653 - Fatty acid carbohydrate hybrid molecules as therapeutic agents and methods thereof: Described herein are fatty acid carbohydrate hybrid compounds and derivatives thereof, and methods of treating or preventing disease and disease symptoms using the compounds and compositions thereof.... Agent: Edwards Angell Palmer & Dodge LLP

20100144656 - Feed or pharmaceutical composition comprising apramycin or an adequate salt thereof: An apramycin containing supplement feeding stuff for poultry and is used for the prophylaxis and/or the treatment of histomoniasis.... Agent: Merchant & Gould PC

20100144655 - Organic compounds: This invention relates to novel compounds that have various medicinal applications, e.g. for the treatment and/or prevention of viral infections.... Agent: Banner & Witcoff, Ltd.

20100144657 - Phenylpiperidine modulators of mu-opioid receptors: The present invention relates to new phenylpiperidine modulators of opioid μ-receptors, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20100144658 - Novel antibiotics, bispolides a1, a2, and a3 as well as bispolides b1, b2a, b2b and b3 and processes for producing said antibiotics: e

20100144659 - Targeting agent for cancer cell or cancer-associated fibroblast: Disclosed are a novel therapeutic agent and a novel treatment method for cancer. Specifically disclosed are: a targeting agent for a cell selected from the group consisting of a cancer cell and a cancer-associated fibroblast, which comprises a retinoid; a substance delivery carrier for the cell, which comprises the targeting... Agent: Knobbe Martens Olson & Bear LLP

20100144660 - Use of n,n-diethyl-2-[-4-(phenylmethyl)-phenoxy]ethanamine monohydrochloride (dppe) in cancer thereapy: The present invention provides for the use of N,N-diethyl-2-[-4-(phenylmethyl)-phenoxy]ethanamine monohydrochloride (DPPE) in cancer therapy. DPPE is used in the treatment of patients having, or suspected of having, an aggressive cancer. The present invention further provides for the use of DPPE in the treatment of a patient suspected of having an... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20100144661 - Sodium channel blockers: The present invention relates to sodium channel blockers. The present invention also relates to a variety of methods of treatment using the sodium channel blockers.... Agent: Gilead Sciences Inc

20100144662 - Aminoglycoside antibiotics targeting bacterial 16s ribosomal rna: The present invention relates to paromamine-based compounds according to formula I having selective antimicrobial activity directed at ribosomal 16S RNA. Furthermore, the invention is directed to the use of said compounds for preparing a medicament, pharmaceutical preparations and methods for preparing said compounds... Agent: The Nath Law Group

20100144839 - Anti-cancer oligodeoxynucleotides: It is disclosed herein that suppressive ODNs are of use for preventing or delaying the formation of a tumor, reducing the risk of developing a tumor, treating a tumor, preventing conversion of a benign to a malignant lesion, or preventing metastasis. In some embodiments, methods are disclosed herein for treating,... Agent: Klarquist Sparkman, LLP

20100144831 - Blocking of gene expression in eukaryotic cells: The present invention provides methods for designing a sequence for efficient short interference RNA molecules. In particular, the present invention defines a universal target for siRNA derived from a poly A sequence, optionally in conjunction with unique sequences for gene silencing and inhibition of viral replication in a eukaryotic host... Agent: Morrison & Foerster LLP

20100144830 - Cancer cell identification marker and cancer cell proliferation inhibitor: Disclosed is an identification marker which can be utilized for detection of various human cancer cells and whose expression closely relates to malignant alteration of cells, and compositions for human cancer treatment which are based on suppression of cancer cell proliferation through inhibition of expression of the identification marker. The... Agent: Millen, White, Zelano & Branigan, P.C.

20100144841 - Control of nk cell function and survival by modulation of ship activity: Inhibition of dendritic cell function in solid organ grafts or allogeneic bone marrow transplants prior to or during engraftment by blocking SH2-containing inositol phosphatase (SHIP) expression or function is taught as a method of abrogating immune rejection and thereby increasing the efficacy of engraftment of an allogeneic bone marrow transplant... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20100144837 - Diagnosis and treatment of malignant neoplasms: The invention features a method for diagnosing a malignant neoplasm in a mammal by contacting a bodily fluid from the mammal with an antibody which binds to an human aspartyl (asparaginyl) beta-hydroxylase (HAAH) polypeptide and methods of treating malignant neoplasms by inhibiting HAAH.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100144835 - Inhibition of gpr4: e

20100144836 - Methods for detecting epigenetic modifications: A method of detecting a predisposition to, or the incidence of, cancer in a sample comprises detecting an epigenetic change in at least one gene selected from an NDRG4/NDRG2 subfamily gene, GATA4, OSMR, GATA5, SFRP1, ADAM23, JPH3, SFRP2, APC, MGMT, 11112, BNIP3, FOXE1, SYNE1, S0X17, PHACTR3 and JAM3, wherein detection... Agent: Andrus, Sceales, Starke & Sawall, LLP

20100144838 - Methods for identifying modulators of pyrimidine tract binding protein: Provided herein are methods and materials for identifying compounds that modulate polypyrimidine tract binding protein (PTB), a protein that functions as a negative regulator of pre-mRNA splicing by blocking the inclusion of numerous alternative exons into mRNA.... Agent: Polsinelli Shughart PC

20100144840 - Methods for modulating the efficacy of nucleic acid based therapies: Covalently reactive antigen analogs are disclosed herein. The antigens of the invention may be used to stimulate production of catalytic antibodies specific for predetermined antigens associated with particular medical disorders. The antigen analogs may also be used to permanently inactivate endogenously produced catalytic antibodies produced in certain autoimmune diseases as... Agent: Dann, Dorfman, Herrell & Skillman

20100144834 - Methods for treating hypercholesterolemia: Disclosed herein are antisense compounds and methods for decreasing LDL-C in an individual having elevated LDL-C. Additionally disclosed are antisense compounds and methods for treating hypercholesterolemia, or alternatively for treating or preventing atherosclerosis. Further disclosed are antisense compounds and methods for decreasing coronary heart disease risk. Such methods include administering... Agent: Drinker Biddle & Reath (dc)

20100144832 - Prostate cancer-specific alternations in erg gene expression and detection and treatment methods based on those alterations: The disclosure describes alterations in ERG gene expression. ERG isoforms and promoter sequence of the ERG gene that are involved in, or associated with, prostate cancer are provided. The disclosure further provides therapeutic compositions and methods of detecting, diagnosing, prognosing, and treating prostate cancer, including biomarkers for detecting the expression... Agent: Latimer & MayberryIPLaw, LLP

20100144842 - Rna interference mediated inhibition of nogo and nogo receptor gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating NOGO and/or NOGO receptor gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways of NOGO and/or NOGO... Agent: Merck C/o Sirna Therapeutics, Inc.

20100144833 - Rnai modulation of rsv, piv and other respiratory viruses and uses thereof: The present invention is based on the in vivo demonstration that RSV and PIV can be inhibited through intranasal administration of RNAi agents as well as by parenteral administration of such agents. Further, it is shown that effective viral reduction can be achieved with more than one virus being treated... Agent: Alnylam/fenwick

20100144843 - Rnai therapeutic for respiratory virus infection: Double stranded siRNA molecules for combatting a respiratory virus, wherein the strands of an siRNA molecule may be from about 15 to about 60 nucleotides, and uses thereof. One strand of an siRNA molecule can be a nucleic acid sequence identical to a conserved site, or a variant thereof, within... Agent: Eckman Basu LLP

20100144844 - Rnai-mediated inhibition of h1f1a for treatment of ocular angiogenesis: RNA interference is provided for inhibition of HIF1A mRNA expression for treating patients with ocular angiogenesis, particularly for treating retinal edema, diabetic retinopathy, sequela associated with retinal ischemia, posterior segment neovascularization (PSNV), and neovascular glaucoma, and for treating patients at risk of developing such conditions.... Agent: Alcon

20100144848 - Dna controlled assembly of lipid membranes: The present invention relates to detection of target nucleic acids by target nucleic acid induced liposome assembly. The invention provides oligonucleotides for use in detection and a method of detecting target nucleic acids. Other aspects of the invention are use of the oligonucleotide of the invention for detection, a kit... Agent: Knobbe Martens Olson & Bear LLP

20100144847 - Fusion polypeptide suitable as a cytotoxin: The present invention relates to fusion polypeptides including (a) a binding site for a cytoskeleton component and (b1) an effector protein or the catalytic domain thereof or (b2) a binding site for the effector protein, and nucleic acid sequences encoding the fusion polypeptides. Moreover, various therapeutic uses of the fusion... Agent: Intellectual Property / Technology Law

20100144849 - Method for inhibiting signaling mediated by erbb2, signaling inhibitor to be used therefor and use thereof: An object of the present invention is to provide a method for inhibiting activation of signaling pathway mediated by ErbB2 in a human cell and a signaling inhibitor to be used therefor. The above-described activation of signaling pathway can be inhibited by a polypeptide comprising at least one of PTB... Agent: Cantor Colburn, LLP

20100144850 - Methods for differentiating pancreatic cancer from normal pancreatic function and/or chronic pancreatitis: There is provided herein methods and compositions for the diagnosis, prognosis and treatment of pancreatic cancer, along with methods of identifying anti-pancreatic cancer agents.... Agent: Macmillan Sobanski & Todd, LLC

20100144845 - Oligonucleotide systems for targeted intracellular delivery: The present invention provides methods for deriving oligonucleotides for specific internal delivery to one or more target cell types (e.g., cancer cells). The method generally includes selecting at least once with a target cell type to provide a plurality of internalizing oligonucleotides for the target cell type, and in some... Agent: Pabst Patent Group LLP

20100144846 - Oligoribonucleotides and uses thereof: The invention relates to immunostimulatory RNA oligonucleotides (ORN). In particular the ORN have an immunostimulatory ORN motif directly or indirectly flanked by a 3′ poly G motif and optionally a 5′ poly-G motif. The invention also relates to methods including therapeutic methods and screening methods and related kits for use... Agent: Pharmacia & Upjohn

20100144851 - Rna interference mediated inhibition of platelet-derived endothelial cell growth factor (ecgf1) gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating platelet-derived endothelial cell growth factor and/or receptor (ECGF1 and/or ECGF1r) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved... Agent: Merck C/o Sirna Therapeutics, Inc.

20100144663 - 2, 6-dinitrogen-containing substituted purine derivatives, the preparation and uses thereof: The present invention provides 2,6-dinitrogen-containing substituted purine compounds of formula (A) or salts or solvates thereof or the solvates of salts thereof, as well as pharmaceutical compositions containing such compounds. The compounds of the present invention have the characteristics of lower toxicity, broad anticancer spectrum, higher anticancer activity, good stability... Agent: William D. Hare

20100144664 - Carbocyclic compounds and methods for treating emerging disease, including influenza and venezuela equine encephalitis virus: The present invention relates to the use of carbodine and 5-F carbodine and analogs thereof for use in the treatment or prophylaxis of influenza, in particular the H5N1 strain of Avian Influenza A virus or “bird flu” strain of influenza as well as the treatment or prophylaxis of Venezuela equine... Agent: Coleman Sudol Sapone, P.C.

20100144665 - Treatment of statin side effects: In a preferred aspect the invention relates to a method of treatment of one or more side effects of statin therapy comprising administering to a subject in need of such treatment an effective amount of uridine, one of its biological precursors or a salt, ester, tautomer or analogue thereof either... Agent: Scully Scott Murphy & Presser, PC

20100144666 - Biomaterials in the form of fibres for use as medical devices in the treatment of wounds, and their production process: The present invention relates to new biomaterials in the form of fibres, essentially consisting of a mixture of gellan and hyaluronic acid derivatives, for use in surgery, especially in the treatment of wounds and mild burns. The present invention also relates to the process for the preparation of said biomaterials.... Agent: Ladas & Parry LLP

20100144667 - Methods for fucoidan purification from sea weed extracts: Methods for purifying fucoidan in extracts from brown seaweed are disclosed. In particular, methods of purifying fucoidan in the extract to remove heavy metal ions, bacterial and endotoxin contaminants, and other impurities are disclosed. The methods include the use of a chelating agent, selective precipitation, and filtration.... Agent: Robins & Pasternak

20100144668 - Semi-fluid food product including beta glucane fibres and guar gum, and use thereof as a functional food product: The invention relates to a semi-fluid food product containing from 2.5 to 16 g of guar gum and from 2.8 to 11.3 g of beta-glucane fibres per portion of said food product, said portions ranging from 125 to 250 g, characterised in that the guar gum: beta-glucane fibres mass ratio... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20100144669 - Dissolution and processing of cellulose: The invention relates to a method for dissolving the components of gel forming materials suitable for use in wound care comprising the steps of admixing said components with an ionic liquid. The ionic liquid may be selected from the group of tertiary amine N-oxides, N,N-dimethyl formamide/nitrogen tetroxide mixtures, dimethyl sulphoxide/paraformaldehyde... Agent: Convatec Inc.

20100144670 - Particle formation: A process for producing particles of a substance is described wherein a solution of the substance in a solvent is delivered in at least one shot into a supercritical fluid. The supercritical fluid is a non-solvent for the substance and is miscible with the solvent. Particles of the substance distributed... Agent: Fenwick & West LLP

20100144671 - Compositions and methods for cancer treatment: Bromoacetoxycalcidiol (B3CD), which is structurally related to calcidiol, exhibits cytotoxic and apoptotic activity toward cancer cells, including highly aggressive neuroblastoma cells. A series of small molecules designed around the structure of B3CD is expected to have growth inhibitory and apoptogenic activities toward a wide range of malignancies. B3CD shows no... Agent: Edwards Angell Palmer & Dodge LLP

20100144672 - Pyrimidinyl pyrazoles as insecticides and parasiticide active agents: The present invention relates to pyrimidinylpyrazoles and their use as insecticides, and also to processes for their preparation and to compositions comprising such arylpyrazoles.... Agent: Baker Donelson Bearman, Caldwell & Berkowitz, PC

20100144673 - Diagnosis, prognosis and identification of potential therapeutic targets of multiple myeloma based on gene expression profiling: Gene expression profiling is a powerful tool that has varied utility. It enables classification of multiple myeloma into subtypes and identifying genes directly involved in disease pathogensis and clinical manifestation. The present invention used gene expression profiling in large uniformly treated population of patients with myeloma to identify genes associated... Agent: Benjamin Aaron Adler Adler & Associates

20100144674 - Pyridazine derivatives: The present invention relates to novel pyridazine derivatives of formula (I) as active ingredients which have microbiocidal activity, in particular fungicidal activity: wherein R1 is hydrogen, C1-C6alkyl, C1-C8haloalkyl or C3-C6cycloalkyl; R2 is cycloalkyl, cycloalkylalkyl, halocycloalkyl, cycloalkoxy, halocycloalkoxy, cycloalkylalkoxy, halocycloalkylalkoxy, alkoxyalkyl, cycloalkoxyalkoxyalkyl, haloalkoxyalkyl, trialkylsilyl, alkylthioalkyl, haloalkylthioalkyl, cycloalkylthio, halocycloalkylthio, cycloalkylalkylthio, halocycloalkylalkylthio, alkylsulfinylalkyl,... Agent: Syngenta Crop Protection , Inc. Patent And Trademark Department

20100144676 - Oleyl phosphocholine: The invention relates to the use of oleyl phosphocholine and oleyl-phospho-(N.N.-dimethyl-N-ethyl)-ethyl-ammonium for the long-term and continuous treatment of serious illnesses, such as cancer, leishmaniasis, ehrlichiosis, multiple sclerosis and psoriasis, in addition to other indications mentioned in the application.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20100144675 - Regulation of sgc function by corrin derivatives: We disclose a method of activating soluble guanylyl cyclase (sGC) in a patient, comprising administering to the patient a composition comprising a corrin and a pharmaceutically-acceptable carrier. We also disclose a composition, comprising a corrin, an NO-independent sGC activator selected from the group consisting of BAY 41-2272, BAY 58-2667, HMR1766,... Agent: Williams, Morgan & Amerson

20100144677 - Method for screening agents for the treatment of diabetes:

20100144678 - Compositions and methods for treating bone cancer: Small molecule bradykinin inhibitor bisphosphonate amide derivatives useful for inhibiting cancer growth and treating cancer residing in and around bone are disclosed. These compounds and pharmaceutical compositions containing these compounds are particularly useful for the treatment of prostate cancer bone metastases.... Agent: Sheridan Ross PC

20100144679 - Medication kits and formulations for preventing, treating or reducing secondary fractures after previous fracture: The present invention provides a multi-component kit comprising a therapeutically effective amount of a bisphosphonate or analogue thereof in combination with an effective amount of Vitamin D, a metabolite thereof, a precursor thereof or an analogue thereof, wherein the kit provides instructions for daily dosing and correct chronological order of... Agent: Moore & Van Allen PLLC

20100144680 - Pharmaceutical compositions useful for preventing and treating oncological diseases: The invention relates to pharmacology, medicine and oncology, in particular, to a class of chemical compounds, the structure of which corresponds to formula (I) and which can be used in pharmaceutical compositions for preventing and treating an extended range of oncological diseases, including, in the form of an anti-tumoral preparation... Agent: Wilmerhale/boston

20100144681 - Compounds for the treatment of alzheimer's disease: e

20100144682 - Composition based on salicylic acid derivatives: The present invention relates to an aqueous composition for topical application comprising at least one (C8-C14)alkyl betaine and at least one salicylic acid acylated derivative, the molar ratio of the (C8-C14)alkyl betaine(s) to the salicylic acid derivative(s) being equal to or greater than 1. The composition can be used for... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20100144684 - Method of safely and effectively treating and preventing secondary hyperparathyroidism in chronic kidney disease: A method of treating and preventing secondary hyperparathyroidism in CKD by increasing or maintaining blood concentrations of both 25-hydroxyvitamin D and 1,25-dihydroxyvitamin Din a patient by administering 25-hydroxyvitamin D3 with or without 25-hydroxyvitamin D2 and, as necessary, 1,25-dihydroxyvitamin D2 as a Vitamin D hormone replacement therapy.... Agent: Marshall, Gerstein & Borun LLP

20100144683 - Methods for generating mammalian models of atopic diseases, and screening for their treatment: The present invention concerns a method for generating a human atopic disease-like phenotype, preferably an atopic dermatitis (AD)-like phenotype in a mammal comprising administering to said mammal at least one compound selected in the group comprising the physiologically active vitamin D3 (1α,25(OH)2D3) and agonistic analogs thereof. The present invention also... Agent: Harness, Dickey & Pierce, P.L.C

20100144685 - Inhibiting cyclin d polypeptides: This document involves methods and materials related to inhibiting cyclin D polypeptide activity. For example, this document provides methods and materials that can be used to (1) identify mammals or cells in need of cyclin D polypeptide inhibition and (2) administer an agent capable of inhibiting cyclin D polypeptide activity.... Agent: Fish & Richardson P.C.

20100144687 - Pharmaceutical compositions containing testosterone and an aromatase inhibitor: A pharmaceutical dosage comprising testosterone or an ester thereof and an aromatase inhibitor; the aromatase inhibitor may be selected from the group consisting of anastrozole, letrozole, and exemestane. In one embodiment the dosage is an implant. Also disclosed are therapies for patients with symptoms of relative androgen deficiency, breast cancer... Agent: Thompson Hine L.L.P. Intellectual Property Group

20100144686 - Topically applicable anti-inflammatory o/w emulsions comprising pro-penetrating glycols: p

20100144688 - 23-substituted derivatives of lupane-type pentacyclic triterpenoids: The present invention comprises small molecule inhibitors of cell proliferative conditions, in particular cancer and conditions associated with cancer. For example, associated malignancies include ovarian cancer, cervical cancer, breast cancer, colorectal cancer, and glioblastomas, among others. Accordingly, the compounds of the present invention are useful for treating, preventing, and/or inhibiting... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20100144689 - Compounds useful for treating neurodegenerative disorders: As described herein, the present invention provides compounds useful for treating or lessening the severity of a neurodegenerative disorder. The present invention also provides methods of treating or lessening the severity of such disorders wherein said method comprises administering to a patient a compound of the present invention, or composition... Agent: Choate, Hall & Stewart LLP

20100144690 - Medicaments and methods for promoting wound contraction: Provided are antagonists of FXR activity for use as medicament for the prevention, reduction or inhibition of scarring. This use may preferably be to prevent, reduce or inhibit scarring formed on healing of wounds. The invention also provides corresponding methods of treatment. Preferred antagonists of FXR activity include guggulsterone (Z);... Agent: Foley And Lardner LLP Suite 500

20100144691 - Treatment of female fertility conditions through modulation of the autonomic nervous system: Methods are provided for treating a subject for a fertility condition. In accordance with the subject methods, at least a portion of a subject's autonomic nervous system is modulated to increase the sympathetic activity/parasympathetic activity ratio in a manner that is effective to treat the subject for the condition. Embodiments... Agent: Bozicevic, Field & Francis LLP

20100144692 - Ulipristal acetate tablets: The invention relates to a pharmaceutical tablet for oral administration comprising ulipristal acetate together with the following excipients: a diluent in an amount of 60 to 95 wt %, a binding agent in an amount of 1 to 10 wt %, croscarmellose sodium in an amount of 1 to 10... Agent: Axinn, Veltrop & Harkrider LLP Attn. Michael A. Davitz

20100144693 - Method of treatment of age-related macular degeneration (amd): The present invention relates generally to the field of treatment and prophylaxis of retinal degenerative diseases. More particularly, the present invention contemplates a method for preventing, reducing the risk of development of, or otherwise treating or ameliorating the symptoms of, age-related macular degeneration (AMD) or related retinal conditions in mammals... Agent: Scully Scott Murphy & Presser, PC

20100144694 - 1,2-diazetidin-3-one derivatives and drugs containing same: e

20100144696 - Stabilized pharmaceutical compositions containing a calcium channel blocker: [wherein R1 represents an optionally substituted C1-C4 alkyl group, an amino group or a cyano group; R2 represents an optionally substituted C1-C4 alkyl group, a substituted C3-C4 alkenyl group, or a substituted 4- to 6-membered cyclic amino group; R3 represents a substituted phenyl group; R4 represents an optionally substituted C1-C4... Agent: Frishauf, Holtz, Goodman & Chick, PC

20100144698 - Substituted azetidinones: Wherein A, B, C, D, m, Y, Ra, Rc, Rd, and Rd′ are as described herein, and which are useful as inhibitors of tryptase, thrombin, trypsin, Factor Xa, Factor VIIa, Factor XIa, and urokinase-type plasminogen activator and may be employed in preventing and/or treating asthma, chronic asthma, allergic rhinitis, and... Agent: Morgan, Lewis & Bockius LLP (sf)

20100144699 - Combination medicaments for treating bacterial infections: e

20100144700 - Heterocyclic-carbonyl-diazabicycloalkanes as modulators of the neuronal nicotinic acetylcholine alpha 4 beta 2, subtype receptor for the treatment of cns related disorders: A compound of Formula 1: A-C(O)-Cy, wherein A is a diazabicyclic core, containing 7, 8, or 9 ring atoms, and selected from the following: 2,6-diazabicyclo[3.2.0]heptane; 3,6-diazabicyclo[3.ZO]heptane; 2,7-diazabicyclo[4.2.0]octane; 3,7-diazabicyclo[4.2.0]octane; 3,8-diazabicyclo[4.2.0]octane; 2,7-diazabicyclo[3.3.0]octane; 2,7-diazbicyclo[4.3.0]nonane; 2,8-diazbicyclo[4.3.0]nonane; 3,7-diazabicyclo[4.3.0]nonane; 3,8-diazabicyclo[4.3.0]nonane; 3,9-diazabicyclo[4.3.0]nonane; 2,6-diazabicyclo[3.2.1]octane; 3,6-diazabicyclo[3.2.1]octane; wherein the diazabicycle is attached as a radical to the depicted carbonyl via... Agent: Womble Carlyle Sandridge & Rice, PLLC

20100144701 - Modulators of cb1 receptors: Compounds of formula (I) suppress the normal signalling activity CB1 receptors, and are thus useful in the treatment of diseases or conditions which are mediated by CB1 receptor signalling activity, such as treatment of obesity and overweight, prevention of weigh gain, treatment of diseases and conditions directly or indirectly associated... Agent: Banner & Witcoff, Ltd.

20100144695 - 4-azetidinyl-1-heteroaryl-cyclohexanol antagonists of ccr2: wherein: R1, R2, R3, and R4 are as defined in the specification. The invention also comprises pharmaceutical compositions comprising the compounds of formula (I) and methods of preventing, treating or ameliorating a CCR2 mediated syndrome, disorder or disease, for example, type II diabetes, obesity or asthma, by administering the compounds... Agent: Philip S. Johnson Johnson & Johnson

20100144697 - Stabilized pharmaceutical compositions containing a calcium channel blocker: [wherein R1 represents an optionally substituted C1-C4 alkyl group, an amino group or a cyano group; R2 represents an optionally substituted C1-C4 alkyl group, a substituted C3-C4 alkenyl group, or a substituted 4- to 6-membered cyclic amino group; R3 represents a substituted phenyl group; R4 represents an optionally substituted C1-C4... Agent: Frishauf, Holtz, Goodman & Chick, PC

20100144702 - Indole compound: The purpose of the present invention is to provide a glucokinase activator useful as a pharmaceutical agent such as an agent for the prophylaxis or treatment of diabetes, obesity and the like. The present invention provides a glucokinase activator containing a compound represented by the formula (I): wherein R1 is... Agent: Wenderoth, Lind & Ponack, L.L.P.

20100144703 - Xanthine derivatives, the preparation thereof and their use as pharmaceutical compositions: e

20100144704 - Method of reducing amyloid-beta peptide levels using a bisdioxopiperazine: Disclosed are methods of reducing amyloid-β peptide levels in a subject. The method involves administering to the subject a therapeutically effective amount of a bisdioxopiperazine or a pharmaceutically acceptable salt thereof to reduce β-amyloid peptide levels.... Agent: Woodcock Washburn LLP

20100144706 - Compounds: The present invention encompasses compounds of general formula (1) wherein R1 to R4, X and n are defined as in claim 1, which are suitable for the treatment of ailments characterised by excessive or abnormal cell proliferation, and the use thereof for preparing a medicament having the above-mentioned properties.... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation

20100144705 - Egfr kinase knockdown via electrophilically enhanced inhibitors: Provided herein are electrophilically enhanced kinase inhibitors. Also provided herein are methods of making and utilizing the same.... Agent: Wilson, Sonsini, Goodrich & Rosati

20100144713 - 6-and 7-amino isoquinoline compounds and methods for making and using the same: 6- and 7-amino isoquinoline compounds are provided that influence, inhibit or reduce the action of a kinase. Pharmaceutical compositions including therapeutically effective amounts of the 6- and 7-aminoisoquinoline compounds and pharmaceutically acceptable carriers are also provided. Various methods using the compounds and/or compositions to affect disease states or conditions such... Agent: Michael Best & Friedrich LLP

20100144708 - Heterocyclic compounds containing nitrogen atoms or pharmaceutically acceptable salts thereof, process for the preparation thereof and pharmaceutical composition comprising the same for treatment of cancer: The present invention relates to new heterocyclic compounds containing nitrogen atoms or pharmaceutically acceptable salts thereof, a process for the preparation thereof, and a pharmaceutical composition comprising the same for treatment of cancer. The compounds according to the present invention induce DNA damage due to reactive oxygen species to activate... Agent: Knobbe Martens Olson & Bear LLP

20100144711 - Pharmaceutical composition for oral administration: A pharmaceutical composition for oral administration, comprising 3-hydroxy-N1-(4-methoxybenzoyl)-N2-[4-(4-methyl-1,4-diazepan-1-yl)benzoyl]-1,2-phenylenediamine or a pharmaceutically acceptable salt thereof, and hydroxypropyl cellulose having a viscosity of approximately 6 mPa·S (inclusive) to approximately 150 mPa·S (exclusive) in a 2% aqueous solution at 20° C., or a viscosity of 75 mPa·S (inclusive) to 400 mPa·S (inclusive) in... Agent: Townsend And Townsend And Crew, LLP

20100144707 - Pharmacokinetically improved compounds: The present invention relates to inhibitors of ROCK1 and ROCK2 and methods of modulating the pharmacokinetic and/or pharmacodynamic properties of such compounds. Also provided are methods of inhibiting ROCK1 and or ROCK2 that are useful for the treatment of disease.... Agent: Kenyon & Kenyon LLP

20100144710 - Piperazine and piperidine mglur5 potentiators: Compounds of Formula I or pharmaceutically acceptable salts or solvates thereof, wherein A, B, D, Ar1, Ar2, R2, R3, R4, a, m and n are defined in the specification, methods for the use thereof, processes for making and pharmaceutical compositions containing the same.... Agent: Astra Zeneca Pharmaceuticals Lp Global Intellectual Property

20100144709 - Thiadiazole derivatives for the treatment of neuro-degenerative diseases: The invention provides novel 1,2,4-thiadiazole derivatives useful for preventing or treating an α-synucleopathy such as Parkinson's disease, as well as pharmaceutical compositions including them as biologically active ingredients, and methods for manufacturing them.... Agent: Castellano PLLC

20100144712 - Triazole derivatives having antifungal activity, method for the preparation thereof, and pharmaceutical composition comprising the same: A triazole derivative of formula 1 or a pharmaceutically acceptable salt, hydrate, solvate or isomer thereof is superior to the conventional antifungal drugs in antifungal activity against a wide spectrum of pathogenic fungi, and has advantageously low toxicity.... Agent: Sughrue Mion, PLLC

20100144714 - Derivatives of imidazo pyrimido and diazepine pyrimidine-dione, and use thereof as a drug: The present invention relates to new derivatives of imidazo, pyrimido and diazepine-pyrimidine-dione of the general formula (I) in which R1, R2, L1, L2, Y, Z and A are various and varying groups. These products exhibit a good affinity for certain sub-types of cannabinoid receptors, in particular the CB2 receptors. They... Agent: Hunton & Williams LLP Intellectual Property Department

20100144716 - New cgrp-antagonists, process for preparing them and their use as pharmaceutical compositions: wherein R1, R2, R3, R4 and X are defined as in claim 1, the tautomers, the isomers, the diastereomers, the enantiomers, the hydrates, mixtures and salts thereof and the hydrates of the salts, particularly the physiologically acceptable salts thereof with inorganic or organic acids or bases, as well as those... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation

20100144715 - Substituted benzodiazepinones, benzoxazepinones and benzothiazepinones as sodium channel blockers: The present invention is directed to substituted benzodiazepinones, benzoxazepinones and benzothiazepinones compounds that are sodium channel blockers useful for the treatment of chronic and neuropathic pain. The compounds of the present invention are also useful for the treatment of other conditions, including disorders of the CNS such as anxiety, depression,... Agent: Merck

20100144717 - 2-quinolinone and 2-quinoxalinone-derivatives and their use as antibacterial agents: The present invention relates to compounds of Formula (I): and pharmaceutically acceptable salts thereof, to their use in the treatment of bacterial infections, and to their methods of preparation.... Agent: Astrazeneca R&d Boston

20100144718 - Treatment of diseases modulated by a h4 receptor agonist: The invention provides a method for the treatment of H4R modulated diseases and/or conditions comprising administering to the subject an effective amount of a H4R agonist. The invention also provides a method for treating COPD comprising administering to the subject an effective amount of a H4R agonist, a H1R antagonist... Agent: Mandel & Adriano

20100144719 - Pharmaceutical suspension: The present invention is directed to the provision of a pharmaceutical suspension. The suspension includes high molecular weight polyethylene glycol as a suspending agent. The suspension also typically includes an antimicrobial agent (e.g., polymeric quaternary ammonium compound), an antimicrobial system (e.g., borate/polyol complex system) or both. The suspension has been... Agent: Alcon

20100144720 - Inhibitors of human tumor-expressed ccxckr2: Pharmaceutical compositions containing organic compounds or salts thereof that serve as modulators for the SDF-1 or I-TAC chemokines are disclosed. The compounds and compositions are useful in the treatment of cancer, especially in the inhibition of cancer proliferation, growth, and metastasis. Methods of interfering with SDF-1 and/or I-TAC binding to... Agent: Brinks Hofer Gilson & Lione

20100144724 - 1-(4-(pyridin-2-yl)benzyl)imidazolidine-2,4-dione derivatives: R8 is (C5-7)cycloalkyl optionally comprising a heteroatom selected from O, S, SO and SO2; R9 is H or (C1-4)alkyl; R10 represents 1-3 substituents independently selected from H, (C1-3)alkyl, halogen, oxo, CN and CF3; Y is CF2, O, S, SO or SO2; or a pharmaceutically acceptable salt thereof, to pharmaceutical compositions... Agent: Organon Usa, Inc. C/o Merck

20100144723 - 1-(biphenyl-4-ylmethyl)imidazolidine-2,4-dione: or NR8R9; X represents CHR6, CF2, O, S, SO or SO2; R4 and R5 are (C1-6)alkyl; R6 is H, OR7 or CN; R7 is (C1-3)alkyl; R8 is (C5-7)cycloalkyl comprising a heteroatom selected from O, S, SO and SO2; R9 is H or (C1-4)alkyl; o and m represent the ortho or... Agent: Organon Usa, Inc. C/o Merck

20100144721 - Inhibitors of c-met and uses thereof: The present invention relates to compounds useful as inhibitors of PI3K, particularly of PI3Kγ. The invention also provides pharmaceutically acceptable compositions comprising said compounds and methods of using the compositions in the treatment of various disease, conditions, or disorders.... Agent: Vertex Pharmaceuticals Inc.

20100144722 - Novel heterocyclic compounds as gata modulators: Novel heterocyclic compounds, sstereoisomers thereof and/or pharmaceutically acceptable salts of formula (I) and its stereoisomers are provided. Additionally, methods of forming novel heterocyclic compounds, stereoisomers thereof and/or pharmaceutically acceptable salts of formula (I) and its stereoisomers are provided.... Agent: Nelson Mullins Riley & Scarborough LLPIPDepartment

20100144725 - Pesticidal combinations: A method of controlling or preventing pathogenic damage and/or pest damage in a plant propagation material, a plant, part of a plant and/or plant organ that grow at a later point in time, which comprises applying on the plant, part of the plant, plant organ, plant propagation material or a... Agent: Syngenta Crop Protection , Inc. Patent And Trademark Department

20100144726 - Novel indolic derivatives, their preparation processes and their uses in particular as antibacterials: in which R and R3 are particularly a hydrogen atom, R1 is particularly a hydrogen atom or a methyl, ethyl or isobutyl mi group, R4, R5, R6 and R7 are independently a hydrogen atony, an alkoxyl group with 1 to 7 carbon atoms or a halogen atom, R2 is a... Agent: Young & Thompson

20100144727 - Oxazolidine and morpholine carboxamide derivatives as p2x7 modulators: The compounds modulate P2X7 receptor function and are capable of antagonizing the effects of ATP at the P2X7 receptor. The invention also provides the use of such compounds, or pharmaceutical compositions thereof, in the treatment or prevention of disorders mediated by the P2X7 receptor, for example pain, inflammation or a... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100144728 - Oxazolidinone for the treatment and prophylaxis of pulmonary hypertension: The present invention relates to the use of factor Xa inhibitors, especially of oxazolidinones of the formula (I), for the treatment and/or prophylaxis of pulmonary hypertension, and to the use thereof for the manufacture of medicaments for the treatment and/or prophylaxis of pulmonary hypertension.... Agent: Connolly Bove Lodge & Hutz, LLP

20100144729 - Coumarin derivatives: A compound of formula (I) wherein R1, R2, R3 and R4 are as defined in the specification, processes for their production, their uses, in particular in transplantation, and pharmaceutical compositions containing them.... Agent: Fanelli Strain & Haag PLLC

20100144731 - Novel biccyclic compounds as gata modulators: Novel bicyclic compounds, stereoisomers, and/or pharmaceutically acceptable salts of the novel bicyclic compounds, and/or pharmaceutically acceptable salts of the stereoisomers of the novel bicyclic compounds are provided. Additionally, methods of forming novel bicyclic compounds, stereoisomers, and/or pharmaceutically acceptable salts of the novel bicyclic compounds, and/or pharmaceutically acceptable salts of the... Agent: Nelson Mullins Riley & Scarborough LLPIPDepartment

20100144730 - Pyridinonyl pdk1 inhibitors: The present invention provides pyridinonyl PDK1 inhibitors and methods of treating cancer using the same.... Agent: Townsend And Townsend And Crew, LLP

20100144732 - Pyrimidine kinase inhibitors: The invention provides novel kinase inhibitors that are useful as therapeutic agents for example in the treatment malignancies where the compounds have the general formula I wherein Q, X, Y, Z, R1, R2, R4, m and n are as defined herein.... Agent: Genentech, Inc.

20100144734 - 1, 2, 3-triazole derivatives as new cannabinoid-1 receptor antagonists: The present invention relates to 1,2,3-triazole derivatives which can be used as cannabinoid CB1 receptor antagonists. In addition, the compound of the 1,2,3-triazole derivatives in the present invention can be formulated into a pharmaceutical composition for treating indications relative to signal transduction of CB1 receptors.... Agent: Bacon & Thomas, PLLC

20100144733 - Compounds, compositions and methods comprising heteroaromatic derivatives: The present invention relates to compositions and methods for treating a disease in an animal, which disease is responsive to inhibiting of functional cystic fibrosis transmembrane conductance regulator (CFTR) polypeptide by administering to a mammal in need thereof an effective amount of a compound defined herein (including those compounds set... Agent: Foley & Lardner LLP

20100144735 - Substituted piperidino phenyloxazolidinones having antimicrobial activity with improved in vivo efficacy: The present invention provides agents having antimicrobial activity for preventing and treating infectious diseases. Thus, the present invention provides novel substituted piperidino phenyloxazolidinone derivatives, processes for making compounds as well as antimicrobial compositions containing said derivatives as active ingredients and methods of treating bacterial infections with the said derivatives.... Agent: Ladas & Parry LLP

20100144736 - Novel biphenyl thio-urea derivatives useful as potassium channel modulators: The invention relates to novel biphenyl thio-urea derivatives of Formula (I), wherein A represents hydroxy or tetrazolyl; R1 represents halo, hydroxy or phenyl, which phenyl may optionally be substituted with halo; and R2 and R3, independent of each other, represent halo, trifluoromethyl, nitro and/or phenyl, that are found to be... Agent: Birch Stewart Kolasch & Birch

20100144741 - Ethanolamine derivatives useful as bace inhibitors: The invention relates to novel cyclic compounds of the formula (I), in free base form or in acid addition salt form, to their preparation, to their use as medicaments and to medicaments comprising them.... Agent: Novartis Institutes For Biomedical Research, Inc.

20100144739 - Heterocyclic inhibitors of c-met and uses thereof: The present invention provides compounds useful as inhibitors of c-Met tyrosine kinase. The invention also provides pharmaceutically acceptable compositions comprising the compounds of the invention and methods of using the compositions in the treatment of various proliferative disorders.... Agent: Vertex Pharmaceuticals Inc.

20100144738 - Inhibitors of c-met and uses thereof: The present invention relates to compounds and methods use as inhibitors of c-Met. Certain compounds of the subject invention have the following structural formula (I). Other compounds of the subject invention have structural formulas as defined herein. Also disclosed herein are pharmaceutical compositions comprising the compounds of the subject invention.... Agent: NielsenIPLaw LLC

20100144737 - Methods for inhibiting t helper cell differentiation: The present invention relates to methods and compounds useful for inhibiting T helper cell differentiation. Methods and compounds for decreasing IL-12 signaling in T helper cells are also provided.... Agent: Fibrogen, Inc.

20100144742 - Multiply-substituted tetrahydronaphthalene derivatives, process for their production and their use as anti-inflammatory agents: e

20100144740 - Synergistic combinations of vr-1 antagonists and cox-2 inhibitors: A synergistic combination of a vanilloid receptor VR-1 antagonist and an NSAID or a pharmaceutically acceptable salt or solvate of either or both compounds thereof.... Agent: Novartis Institutes For Biomedical Research, Inc.

20100144743 - Compositions and methods for inhibition of tyrosine kinases: Compositions for inhibiting the catalytic activity of tyrosine kinases comprising compounds represented by Formulas (I), (II), and (III). Methods for treating proliferative diseases comprising administering a therapeutically effective amount of the above compositions.... Agent: NielsenIPLaw LLC

20100144744 - Fused heterocyclic 11-beta-hydroxysteroid dehydrogenase type 1 inhibitors: Novel compounds are provided which are 1 1-beta-hydroxysteroid dehydrogenase type I inhibitors. 1 1-beta-hydroxysteroid dehydrogenase type I inhibitors are useful in treating, preventing, or slowing the progression of diseases requiring 1 1-beta-hydroxysteroid dehydrogenase type I inhibitor therapy. These novel compounds have the structure: W-L-Z or stereoisomers or prodrugs or pharmaceutically... Agent: Louis J. Wille Bristol-myers Squibb Company

20100144745 - Pyrrolopyrazinyl urea kinase inhibitors: v

20100144746 - Method for restructuring a biological tissue comprising collagen fibrils and relative uses: A method for restructuring a biological tissue comprising collagen fibrils selected from a venous tissue, a cardiac valvular tissue, a cutaneous or subcutaneous tissue, a tissue of a muscular tendon, a tissue of a muscular fascia or a tissue of a muscular aponeurosis, comprising the following operational steps: a) bringing... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20100144747 - 1h-quinaz0line-2,4-diones: m

20100144748 - Methods involving aldose reductase inhibitors: Embodiments of the invention include methods and compositions involving aldose reductase inhibitors for the treatment of inflammation, including uveitis and asthma.... Agent: Fulbright & Jaworski L.L.P.

20100144749 - Treatment of cancers with acquired resistance to kit inhibitors: The present invention provides compositions and methods for treating cancers which have acquired resistance to a KIT inhibitor by administering effective amounts of sorafenib.... Agent: Millen, White, Zelano & Branigan, P.C.

20100144750 - Use of n-phenyl-2-pyrimidineamine derivatives against mast cell-based diseases like allergic disorders: in which the symbols and substituents have the meaning as given herein in free form or in pharmaceutically acceptable salt form in the manufacture of a pharmaceutical composition for the treatment of allergic rhinitis, allergic dermatitis, drug allergy or food allergy, angioedema, urticaria, sudden infant death syndrome, bronchopulmonary aspergillosis, multiple... Agent: Novartis Corporate Intellectual Property

20100144751 - Imidazo[1,2-a]pyridine compounds as receptor tyrosine kinase inhibitors: Compounds of Formula (I): are receptor tyrosine inhibitors useful in the treatment of diseases mediated by class (3) and class (5) receptor tyrosine kinases. Particular compounds of this invention have also been found to be inhibitors of Pim-1.... Agent: Viksnins Harris & Padys Pllp

20100144752 - Heterocyclylamide-substituted thiazoles, pyrroles and thiophenes: The invention relates to heterocyclylamide-substituted thiazoles, pyrroles and thiophenes and to processes for preparing them, to their use for the treatment and/or prophylaxis of diseases, and to their use for the production of medicaments for the treatment and/or prophylaxis of diseases, particularly for use as antiviral agents, especially against cytomegaloviruses.... Agent: Barbara A. Shimei Director, Patents & Licensing

20100144753 - Crystal modifications of transmission dyes: Disclosed is the use of an aqueous dispersion comprising (a) a micronized sparingly soluble organic benzophenone derivative of formula (1), selected from the crystal modifications (B) and (C), wherein the crystal modification (B) is characterized by a peak in the X-ray diffraction pattern at a d-spacing of about 7.70; and... Agent: Basf Performance Products LLC Patent Department

20100144754 - Methods and compositions for treating or preventing narcotic withdrawal symptoms: This invention provides methods and pharmaceutical compositions for preventing or treating physical dependence and/or withdrawal associated with narcotic use, in particular by modulating a 5-HT3 receptor. Using a computational genetic approach in mice, a gene conserved between mice and humans was identified as candidate as a modulator of physical dependence... Agent: Peters Verny , L.L.P.

20100144758 - Azaindole p2x3 and p2x2/3 modulators: i

20100144757 - Derivatives of 7-alkynyl-1,8-naphthyridones, preparation method thereof and use of same in therapeutics:

20100144755 - Novel compounds: Novel substituted 2,4,8-trisubstituted 8H-pyrido[2,3-d]pyrimidin-7-one containing compounds and compositions, and their use use in therapy as CSBP/RK/p38 kinase inhibitors.... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100144756 - Novel heteroaromatic derivatives and their use as positive allosteric modulators of metabotropic glutamate receptors: v

20100144759 - Novel n-(fluoro-pyrazinyl)-phenylsulfonamides as modulators of chemokine receptor ccr4:

20100144761 - Antimicrobial molecules for treating multi-drug resistant and extensively drug resistant strains of mycobacterium: The present invention provides methods of inhibiting the growth of Mycobacterium species or treating an animal having a Mycobacterium infection (including multi-drug resistance strains and extensively drug resistant strains) by administering a compound of the invention, a salt thereof, or a composition comprising the same.... Agent: Pepper Hamilton LLP

20100144760 - Novel compounds: Disclosed are N-{[(1R,4S,6R)-3-(2-pyridinylcarbonyl)-3-azabicyclo[4.1.0]hept-4-yl]methyl}-2-heteroarylamine derivatives and their use as pharmaceuticals.... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100144762 - Novel sulfonamides as l-cpt1 inhibitors: s

20100144763 - Pharmaceutical composition for inhibiting topoisomerase i and method for exploiting drug: The invention relates to the compounds isolated from Evodia rutaecarpa (Juss.), in that has been demonstrated to inhibit topoisomerase I. Evodiamine, an alkaloidal compound is reported the topoisomerase I inhibitory activity. The effect of evodiamine acts by stabilizing the covalent complex between topoisomerase I and DNA, which results in a... Agent: Hudak, Shunk & Farine, Co., L.p.a.

20100144764 - Pyrimidinedione derivatives and methods of use thereof: The present invention relates to Pyrimidinedione Derivatives, compositions comprising a Pyrimidinedione Derivative and methods for using the Pyrimidinedione Derivatives for treating or preventing a metabolic disorder, dyslipidemia, a cardiovascular disease, a neurological disorder, a hematological disease, cancer, inflammation, a respiratory disease, a gastroenterological disease, diabetes, a diabetic complication, obesity, an... Agent: Merck Patent Department (k-6-1, 1990)

20100144765 - 5,6-trimethylenepyrimidin-4-one compounds: e

20100144766 - Composition and method for treating or preventing skeletal muscle fibrosis: A compound in combination with a pharmaceutically acceptable carrier, the compound having a formula: wherein: R1 is a member of the group consisting of hydrogen, halogen, nitro, benzo, lower alkyl, phenyl, and lower alkoxy; R2 is a member of the group consisting of hydroxy, acetoxy, and lower alkoxy; and R3... Agent: Daniel J Swirsky

20100144767 - Use of sodium channel blockers for the treatment of visceral pain or pain caused by cancer treatment: The invention provides methods for treating visceral pain and pain associated with therapy. The compounds useful in the methods of the invention are blockers of sodium ion channels, and in particular compounds that bind to the SS1 or SS2 extracellular mouth of the α-subunit thereof. Particularly useful compounds are saxitoxin... Agent: Fish & Richardson PC

20100144768 - Kinase inhibitor compounds: Pyrimidinone derivatives have enhanced and unexpected drug properties as inhibitors of protein kinases and are useful in treating disorders related to abnormal protein kinase activities such as inflammatory diseases and certain types of cancer.... Agent: Edwards Angell Palmer & Dodge LLP

20100144769 - Composition and method for improved bioavailability and enhanced brain delivery of 5 5-diphenyl barbituric acid: The present invention relates to a composition and a method of delivering a barbituric acid derivative to the central nervous system of a mammal in need of treatment for neurological conditions. In particular, the present invention relates to a method of administering an oral dosage form of a sodium salt... Agent: Taro Pharmaceuticals U.s.a., Inc. C/o Venable LLP

20100144771 - Novel hydantoin derivatives for the treatment of obstructive airway diseases: e

20100144770 - Pyrimidinones as casein kinase ii (ck2) modulators: A compound having Formula I: or a pharmaceutically acceptable salt thereof, wherein X, R, R and R are as defined in the specification; pharmaceutical compositions thereof; and methods of use thereof. The compounds of Formula I are inhibitors of Casein kinase II (CK2) pathways.... Agent: Mcdonnell Boehnen Hulbert @ Berghoff LLP

20100144772 - 2,2,2-tri-substituted acetamide derivatives as glucokinase activators, their process and pharmaceutical application: Compounds of the present disclosure are 2,2,2-tri-substituted acetamide derivatives of formula (I), its polymorphs, stereoisomers, prodrugs, solvates, pharmaceutically acceptable salts and formulations thereof, useful as Glucokinase activator. Processes of their preparation are also described in the disclosure. The disclosure also describes method to characterize partial glucokinase activators.... Agent: K&l Gates LLP

20100144773 - Pharmaceutical compositions for intranasal administration comprising choline salts of succinic acid: The present invention relates to pharmaceutical compositions for the intranasal administration comprising a therapeutically effective amount of a compound of formula (I) or pharmaceutically acceptable salts thereof. Preferably, the pharmaceutically acceptable salt is selected from the group consisting of choline salt, sodium salt, potassium salt, and thiamine salt. Further, the... Agent: Notaro, Michalos & Zaccaria P.C.

20100144775 - Heterocyclic cyclopamine analogs and methods of use thereof: The present invention relates to steroidal alkaloids that can be used in the treatment of hedgehog pathway related disorders, particularly cancer.... Agent: Fish & Richardson P.C.

20100144774 - Heterocyclic spiro-compounds: The patent application relates to new heterocyclic compounds of the general formula (I), in which R, R1, R2, Q, T, n and p have the definitions elucidated in more detail in the description, to a process for preparing them and to the use of these compounds as medicaments, particularly as... Agent: Wenderoth, Lind & Ponack, L.L.P.

20100144776 - Use of snps for the diagnosis of a pain protective haplotype in the gtp cyclohydrolase 1 gene (gch1): The present invention relates to an in vitro method for diagnosing a genetic predisposition or susceptibility for pain in a mammal which comprises detecting of at least one particular single nucleotide polymorphism (SNP) in a sample obtained from said mammal in the genomic locus-derived nucleic acid or fragment thereof of... Agent: David S. Resnick

20100144777 - Method of network-based identification of multicomponent synergy and compositions for use as effective component of anti-angiogenesis medicines: A method was provided for determining synergistic effect of a medicine combination including two medicines relating to a disease on the basis of a gene network and medicine-effective genes of each and/or any of said two medicines, comprising: determining a synergy factor (ST1,2) of said two medicines on the basis... Agent: Meredith & Keyhani, PLLC

20100144779 - Marine alkalod makaluvamines and derivatives thereof: The present disclosure provides compounds based on the marine alkaloid makaluvamine. Described are compounds of the general formula (I) and (II). Also described are pharmaceutical compositions comprising one or more of the compounds of the general formula (I) and (II). The compounds and pharmaceutical compositions described inhibit the growth of... Agent: Bradley Arant Boult Cummings LLP Intellectual Property Department

20100144778 - Niacin receptor agonists, compositions containing such compounds and methods of treatment: The present invention encompasses compounds of Formula (I): as well as pharmaceutically acceptable salts and hydrates thereof, that are useful for treating atherosclerosis, dyslipidemias and the like. Pharmaceutical compositions and methods of use are also included.... Agent: Merck

20100144780 - Salts and mixture of 9-oxoacridine-10-acetic acid with 1-alkylamino-1-desoxy-polyols, pharmaceutical compositions containing said agents and treatment methods: e

20100144782 - Derivatives of 7-alkynyl-1,8-naphthyridones, preparation method thereof and use of same in therapeutics:

20100144781 - Methods of treating psychosis and schizophrenia based on polymorphisms in the erbb4 gene: The present application is directed to the use of genetic polymorphism in the ErbB4 gene to predict whether a patient is likely to respond to psychotic medication Paliperidone. The polymorphism in the ErbB4 gene is also used to predict whether a patient is likely to display placebo effect among patients... Agent: Philip S. Johnson Johnson & Johnson

20100144783 - Kinase inhibitors with improved cyp safety profile: Compounds that inhibit protein kinases such as Aurora-kinases and the VEGFR and PDGFR families of kinases, with an improved safety profile due to low CYP3A4 inhibition, compositions containing the compounds and methods of treating diseases using the compounds are disclosed.... Agent: Paul D. Yasger Abbott Laboratories

20100144784 - Aerosol formulation: The present invention relates to propellant-free aerosol formulations for inhalation containing ipratropium bromide and salbutamol.... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation

20100144785 - Fungicide n-6-membered fused (hetero) aryl-methylene-n-cycloalkyl carboxamide derivatives: The present invention relates N-(aromatic, 6-membered, fused, (hetero)aryl-methylene)-N-cycloalkyl carboxamide derivatives, their thiocarboxamide or N-substituted carboximidamide analogues, all of formula (I) wherein A represents a carbo-linked 5-membered heterocyclyl group; T represents O, S, N—Rc, N—ORd, N—NRcRd or N—CN; Z1 to Z3 and B represents an aromatic, 6-membered, fused, (hetero)aryl; their process... Agent: Ostrolenk Faber Gerb & Soffen

20100144786 - Quinoline derivatives as crth2 receptor ligands: Specific quinoline derivatives are CRTH2 antagonists, useful in the treatment of conditions having an inflammatory component.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20100144787 - Quinolines and their therapeutic use: Compounds of formula (I) are CRTH2 ligands, useful in the treatment of, for example, asthma and COPD wherein: R1 is halogen or cyano; R2 is hydrogen or methyl; R3 and R4 are independently —OR6, C1-C6alkyl or C3-C6cycloalkyl, the latter two groups being optionally substituted by one or more halogen atoms;... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20100144788 - 4- [2- (4-methylphenylsulfanyd-phenyl] piperidine with combined serotonin and norepinephrine reuptake inhibition for the treatment of adhd, melancholia, treatment resistent depression or residual symptoms in depression: The use of 4-[2-(4-methylphenylsulfanyl)phenyl]piperidine and acid additions salts thereof for the treatment of ADHD, melancholia, treatment resistant depression or residual symptoms in depression is provided.... Agent: Darby & Darby P.C.

20100144789 - 1-isopropyl-2-oxo-1,2-dihydropyridine-3-carboxamide derivatives having 5-ht4 receptor agonistic activity: This invention provides a compound of formula (I): wherein R1 represents an alkyl group having from 1 to 4 carbon atoms or a halogen atom, R2 represents an alkyl group having from 1 to 4 carbon atoms, R3 represents a hydrogen atom or a hydroxy group, and A represents an... Agent: Pfizer Inc. Patent Department

20100144790 - Use of thalidomide for alzheimers disease treatment and prevention: β-secretase (BACE) is a biomarker for MCI and Alzheimer's disease. BACE1 protein level and the enzymatic activity level increase in the brain, and in the CSF in AD and MCI patients. Increased BACE1 levels in CSF are related to neuronal death and synaptic damages, which contribute to AD-related cognitive deficits.... Agent: Jennings, Strouss & Salmon, P.L.C

20100144791 - Cannabinoid receptor antagonists/inverse agonists useful for treating obesity: The present invention provides novel pyrazoles that are useful as cannabinoid receptor antagonists and pharmaceutical compositions thereof and methods of using the same for treating obesity, diabetes, and/or cardiometabolic disorders.... Agent: Vance Intellectual Property, PC

20100144792 - Neurite formation promoter: The invention provides an agent for promoting ocular tissue neuritogenesis, containing N-(1-acetylpiperidin-4-yl)-4-fluorobenzamide or a pharmaceutically acceptable salt thereof, and an agent for promoting corneal neuritogenesis and retinal neuritogenesis, containing N-(1-acetylpiperidin-4-yl)-4-fluorobenzamide or a pharmaceutically acceptable salt thereof. The corneal neuritogenesis promoter can be used for the improvement of corneal sensitivity, treatment... Agent: Leydig Voit & Mayer, Ltd

20100144793 - Novel compounds for the treatment of diseases associated with amyloid or amyloid-like proteins: The present invention relates to compounds of the general formula (I) wherein (formula 2) independently represents a single bond or a double bond, represents a linking group A and A′ are each independently a 5- to 7-membered heterocyclic ring, wherein the heterocyclic rings A und A′ are optionally substituted by... Agent: King & Spalding

20100144794 - Insecticidal n-substituted (6-halooalkylpyridin-3-yl)-alkyl sulfoximines: N-Substituted (6-haloalkylpyridin-3-yl)alkyl sulfoximines are effective at controlling insects.... Agent: Dow Agrosciences LLC

20100144796 - New polymorphs of ethyl 3-[(2-{[4-(hexyloxycarbonylamino-imino- methyl)-phenylamino]-methyl-1-methyl-1h-benzimidazole-5-carbonyl) -pyridin-2-yl-amino]-propionate: The invention relates to new polymorphs of the active substance ethyl 3-[(2-{[4-(hexyloxycarbonylamino-imino-methyl)-phenylamino]-methyl}-1-methyl-1H-benzimidazole-5-carbonyl)-pyridin-2-yl-amino]-propionate, the preparation thereof and the use thereof as pharmaceutical compositions.... Agent: Michael P. Morris Boehringer Ingelheim Usa Corporation

20100144795 - Treatment of attention-deficit/hyperactivity disorder: 3-(5,6-Dichloro-pyridin-3-yl)-1S,5S-3,6-diazabicyclo[3.2.0]heptane and salts thereof are effective nicotinic receptor agonist compounds that demonstrated pharmacological effect for symptoms associated with attention-deficit/hyperactivity disorder.... Agent: Paul D. Yasger Abbott Laboratories

20100144797 - Isoxazoline-substituted benzamide compound and pest control agent: (where, for example, R1 in Q-1 is a C1 to C4 haloalkyl, etc., and R2 is H, etc., R1 in Q-2 is —OR1a, etc., R1a is a C1 to C4 alkyl, etc., and R2 is H, etc.), W is O or S, X is a halogen atom, a C1 to... Agent: Oliff & Berridge, PLC

20100144798 - Modulators of atp-binding cassette transporters: The present invention relates to modulators of ATP-Binding Cassette (“ABC”) transporters or fragments thereof, including Cystic Fibrosis Transmembrane Regulator (“CFTR”), compositions thereof, and methods therewith. The present invention also relates to methods of treating ABC transporter mediated diseases using such modulators.... Agent: Vertex Pharmaceuticals Inc.

20100144799 - Optical enantiomers of phenyramidol and process for chiral synthesis: The present invention discloses optically pure (R) and (S) Phenyramidol enantiomers and their pharmaceutically acceptable salts, a process for synthesizing such enantiomers by means of a styrene oxide based synthesis, and also a clinical evaluation of (R) and (S) enantiomers of Phenyramidol, their salts and compositions thereof for enhanced/newer therapeutic... Agent: Law Offices Of Albert Wai-kit Chan, PLLC

20100144800 - extended release tablet formulation of niacin: The present invention relates to an extended release tablet formulation comprising niacin and a release retarding agent selected from hydroxypropyl cellulose, polyethylene oxide or mixtures thereof.... Agent: Ranbaxy Inc.

20100144803 - Insecticidal n-substituted (6-halooalkylpyridin-3-yl)-alkyl sulfoximines: N-Substituted (6-haloalkylpyridin-3-yl)alkyl sulfoximines are effective at controlling insects.... Agent: Dow Agrosciences LLC

20100144801 - Muscarinic receptor antagonists: The present invention generally relates to muscarinic receptor antagonists of formula I, which are useful, among other uses, for the treatment of various diseases of the respiratory, urinary and gastrointestinal systems mediated through muscarinic receptors. The invention also relates to the process for the preparation of disclosed compounds, pharmaceutical compositions... Agent: Ranbaxy Inc.

20100144802 - Small molecule inhibitors for immune modulation: Methods of treating immunosuppression by administering a therapeutic amount of a tryphostin compound of the formula:... Agent: NielsenIPLaw LLC

20100144804 - Polymorph of a pharmaceutical: A new crystalline polymorph of ritonavir and methods for its use and preparation are disclosed.... Agent: Paul D. Yasger Abbott Laboratories

20100144806 - Cyclopropanecarboxylic acid compound: wherein each symbol is as defined in the description, a salt s thereof, and a prodrug thereof of the present invention unexpectedly have a superior GPR40 receptor agonist activity and superior properties as pharmaceutical products such as stability and the like, and can be safe and useful pharmaceutical agents for... Agent: Edwards Angell Palmer & Dodge LLP

20100144807 - Pharmaceutical composition for modified release: A pharmaceutical composition for modified release, comprising (1) (R)-2-(2-aminothiazol-4-yl)-4′-[2-[(2-hydroxy-2-phenylethyl)amino]ethyl]acetic acid anilide, or a pharmaceutically acceptable salt thereof, (2) at least one additive which ensures penetration of water into the pharmaceutical composition and which has a solubility such that the volume of water required for dissolving 1 g of the additive... Agent: Townsend And Townsend And Crew, LLP

20100144805 - Regulation of protein synthesis: A composition and method for inhibiting proliferation of a tumor cell compared to a non-tumor cell. Also described are methods of screening for a composition that inhibits cap-dependent translation compared to cap-independent translation of proteins.... Agent: Banner & Witcoff, Ltd.

20100144808 - Substituted isoxazoline or enone oxime compound, and pest control agent: Disclosed is a novel pest control agent, in particular a pesticide or a miticide. Specifically disclosed are a substituted isoxazoline compound or a substituted enone oxime compound represented by the general formula (1) below or the general formula (2) below, and a pest control agent containing any of them. (In... Agent: Oliff & Berridge, PLC

20100144810 - Angiotensin ii receptor antagonists: s

20100144811 - Combination:

20100144809 - Novel benzamidine derivatives useful as potassium channel modulators: This invention relates to novel benzamidine derivatives of formula (I) that are found to be potent modulators of potassium channels and, as such, are valuable candidates for the treatment of diseases or disorders as diverse as those which are responsive to the modulation of potassium channels. A stereoisomer or a... Agent: Birch Stewart Kolasch & Birch

20100144812 - Heterocyclic sulfonamide inhibitors of beta amyloid production containing an azole: wherein, R1 is lower alkyl, substituted lower alkyl, phenyl, substituted phenyl, benzyl, substituted benzyl, benzyloxy, substituted benzyloxy, or SO2R5; R5 is phenyl, substituted phenyl, heterocycle, substituted heterocycle, alkyl, or substituted alkyl; R2 is lower alkyl, substituted lower alkyl, CF3, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, phenyl, substituted phenyl, or cycloalkyl;... Agent: Howson & Howson LLP / Wyeth LLC

20100144813 - Novel 4-heteroarylimidazole-2-thione tyrosinase inhibitors and pharmaceutical/cosmetic applications thereof: e

20100144814 - Novel 4-phenylimidazole-2-thione tyrosinase inhibitors and pharmaceutical/cosmetic applications thereof:

20100144815 - Amino acid composition: The amino acid composition comprises 3.0 to 10.0 mass parts of aspartic acid, 2.5 to 9.0 mass parts of threonine, 2.0 to 9.5 mass parts of serine, 12.0 to 40.0 mass parts of glutamic acid, 7.0 to 20.0 mass parts of proline, 0.5 to 4.5 mass parts of glycine, 1.0... Agent: Posz Law Group, PLC

20100144816 - Functionally selective alpha2c adrenoreceptor agonists: In its many embodiments, the present invention provides a novel class of naphthene- and indane-type as inhibitors of α2C adrenergic receptor agonists, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment,... Agent: Merck Patent Department (k-6-1, 1990)

20100144818 - 1-benzylpyrazole derivatives, preparation thereof and therapeutic use thereof:

20100144817 - Fungicidel n-cycloalkyl-benzyl-thiocarboxamides or n-cycloalkyl-benzyl-n'-substituted-amidine derivatives: The present invention relates to N-cycloalkyl-benzyl-thiocarboxamide or N-cycloalkyl-benzyl-N-substituted-carboximidamide amide derivatives of formula (I) wherein A represents a carbo-linked, unsaturated or partially saturated, 5-membered heterocyclyl; T represents S, N—Ra, N—ORa, N—NRaRb or N—CN; Z1 represents a C3-C7-cycloalkyl and Z2; Z3, X and n represent various substituents; their process of preparation; their... Agent: Ostrolenk Faber Gerb & Soffen

20100144819 - Synergistic methods for control of pests: The present invention provides a method for the synergistic control of insect pests, such as cockroaches and spiders, which comprises applying to a locus where insect pest control is needed or expected to be needed a synergistically effective amount of a combination of bifenthrin and fipronil.... Agent: Patent Administrator Fmc Corporation

20100144820 - Therapeutic hpph dosage for pdt: A method for treating cancer and other hyperproliferative tissues in humans that can be exposed to light comprising injection of HPPH at the equivalent to a dose of 0.05 to 0.11 mg/kg of body weight 24 hours post injection and exposing the tumor or other hyperproliferative tissue to 665±10 nm... Agent: Michael L. Dunn

20100144821 - Compounds and methods for treating protein folding disorders: The invention is directed to compounds and methods for treating protein folder disorders. In certain embodiments the invention provides compounds and methods for treating neurodegenerative diseases such as Alzheimer's disease, tauopathy, cerebral amyloid angiopathy, Lewy body disease, dementia, Huntington's disease and prion-based spongiform encelopathy. The invention further provides compounds, methods... Agent: Dowell & Dowell P.C.

20100144823 - Novel indole derivatives as selective androgen receptor modulators (sarms): The present invention is directed to novel indole derivatives, pharmaceutical compositions containing them and their use in the treatment of disorders and conditions modulated by the androgen receptor.... Agent: Philip S. Johnson Johnson & Johnson

20100144822 - Use of inhibitors of the degradation of p27, in particular argyrin and derivatives thereof, for the treatment of proliferative diseases: The present invention relates to the use of particular macrocycles that are inhibitors of the proteasomic degradation of p27, in particular Argyrin and derivatives thereof, preferably Argyrin A, for the treatment of proliferative diseases, such as cancer, as well as the derivatization of said macrocycles.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20100144824 - Glucagon receptor antagonist compounds, compositions containing such compounds and methods of use: Glucagon receptor antagonist compounds are disclosed. The compounds are useful for treating type 2 diabetes and related conditions. Pharmaceutical compositions and methods of treatment are also included.... Agent: Merck

20100144825 - Renin inhibitors: The present invention is directed to aspartic protease inhibitors. The present invention is also directed to pharmaceutical compositions comprising the disclosed aspartic protease inhibitors. The present invention is further directed to methods of antagonizing one or more aspartic proteases in a subject in need thereof, and methods for treating an... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20100144826 - Salinosporamides and methods for use thereof: The present invention is based on the discovery that certain fermentation products of the marine actinomycete strains CNB392 and CNB476 are effective inhibitors of hyperproliferative mammalian cells. The CNB392 and CNB476 strains lie within the family Micromonosporaceae, and the generic epithet Salinospora has been proposed for this obligate marine group.... Agent: Dla Piper LLP (us)

20100144828 - Caffeoylquinic acid derivatives containing nitrogen, and preparation method, pharmaceutical composition and usage thereof: The present invention provides caffeoylquinic acid derivatives and a method of preparing for the same, and also provides pharmaceutical compositions containing caffeoylquinic acid derivatives, and uses of caffeoylquinic acid derivatives in preparation of a medicament for the treatment or prophylaxis of virus diseases, in particular, uses of respiratory syncytial virus... Agent: Emerson, Thomson & Bennett, LLC

20100144827 - Novel conjugates of polyunsaturated fatty acids with amines and therapeutic uses thereof: The present application discloses conjugates comprising an aminic moiety covalently linked to a hydrophobic moiety, through an amidic bond, which are selective inhibitors of COX-2 enzyme and can be beneficially used in the treatment of various inflammatory disease or disorder and cancer.... Agent: Martin D. Moynihan D/b/a Prtsi, Inc.

20100144829 - Novel receptor antagonists and their methods of use: e

20100144852 - Bicyclo[2.2.1]hept-7-ylamine derivatives and their uses: Compounds of formula (I) have muscarinic M3 receptor modulating activity; Formula (I) wherein A is an oxygen atom or group —N(R12)—; (i) R1 is C1-C6-alkyl or a hydrogen atom; and R2 is a hydrogen atom or a group —R5, —Z—Y—R5—Z—NR9R10; —Z—CO—NR9R10; —Z—NR9—CO—R5; or —Z—CO2H; and R3 is a lone pair,... Agent: Astra Zeneca Pharmaceuticals Lp Global Intellectual Property

20100144853 - Novel combined administration: The present invention is directed to the combined administration of a thioester therapeutic agent (preferably of formula I) and at least one esterase inhibitor. Also provided are a pharmaceutical composition, package, and a kit comprising the aforementioned active ingredients, as well as a method for increasing the bioavailability of said... Agent: Hoffmann-la Roche Inc. Patent Law Department

20100144854 - Use of rhodamine 6g as a medicinal agent for treating malignant neoplasms and amiloidoses: Rhodamine 6G is used as a medical agent for treating malignant neoplasms and amyloidoses at a dosage ranging from 1 mg to 10 g in the form of an aqueous, physiological, or alcoholic solution. For different purposes, the rhodamine G6 solution is orally administered before or after meals, or rhodamine... Agent: Kevin D. Mccarthy Roach Brown Mccarthy & Gruber, P.C.

20100144855 - Application of sedoisoprosan for preparation of medicine for treatment of human hbeag positive chronic hepatitis b: The present invention disclosed the application of sedoisoprosan for preparation of medicine for therapy on human HBeAg positive chronic hepatitis B. Results of the clinical trials indicated that sedoisoprosan could effectively inhibit hepatitis B virus, the anti-virus effect is enhanced as the dose is increased and the incidence of adverse... Agent: Schmeiser, Olsen & Watts

20100144859 - Dimeric avermectin and milbemycin derivatives: This invention provides for novel antiparasitic and pesticidal derivatives of avermectin and milbemycin compounds in which two avermectin or milbemycin members are linked together by a chemical linker. The resulting compounds may be used in veterinary compositions which are used in treating, controlling and preventing of endo- and ectoparasite infections... Agent: Judy Jarecki-black Ph.d., J.d.

20100144856 - Prenylfavanone compounds and uses thereof: The present invention relates to new prenylflavanone compounds and a pharmaceutical composition comprising at least one of the compounds.... Agent: Occhiuti Rohlicek & Tsao, LLP

20100144857 - Prenylflavanone compounds and uses thereof: The present invention relates to new prenylflavanone compounds and a pharmaceutical composition comprising at least one of the compounds.... Agent: Occhiuti Rohlicek & Tsao, LLP

20100144860 - Transglutaminase inhibitor comprising egcg and a method for producing thereof: The present invention relates to a transglutaminase inhibitor comprising epigallocatechin gallate (hereinafter, referred to as EGCG). More particularly, the present invention relates to a transglutaminase inhibitor comprising EGCG which effectively inhibits the activity of transglutaminase, the overexpression of which is responsible for the etiology of various diseases, and to novel... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20100144858 - Treatment of movement disorders with a metabotropic glutamate 4 receptor positive allosteric modulator: An mGluR4 receptor positive allosteric modulator is useful, alone or in combination with a neuroleptic agent, for treating or preventing movement disorders such as Parkinson's disease, dyskinesia, tardive dyskinesia, drug-induced parkinsonism, postencephalitic parkinsonism, progressive supranuclear palsy, multiple system atrophy, corticobasal degeneration, parkinsonian-ALS dementia complex, basal ganglia calcification, akinesia, akinetic-rigid syndrome,... Agent: Gerard Bilotto

20100144861 - Perfluorocarbon gel formulations: A perfluorocarbon gel composition is disclosed with numerous uses including topical medical and cosmetic uses.... Agent: Cooper & Dunham, LLP

20100144862 - Use of substituted pyranone acid derivatives for the treatment of metabolic syndrome: The invention relates to the use of substituted pyranone acid derivatives and of their physiologically acceptable salts for producing medicaments for treating the metabolic syndrome.... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20100144863 - Compounds and methods for treating autism spectrum disorders: e

20100144865 - Compound feed for aquaculture: The present invention relates to a fish feed comprising dioxabicyclo[3.3.0]octane derivates, in particular selected sesame lignans, and a vegetable oil or oil mixture comprising at least one 18-carbon chain omega-3 fatty acid. The dioxabicyclo[3.3.0]octane derivate will induce a desaturation and elongation of the 18-carbon chain fatty acid in the fish... Agent: Birch Stewart Kolasch & Birch

20100144864 - Soluble guanylate cyclase (sgc) modulators for treatment of lipid related disorders: Disclosed herein are novel compositions and methods for treating or preventing a variety of disorders and conditions associated with lipid metabolism. The methods generally include administering to a patient in need thereof a therapeutically effective amount of a pharmaceutical composition comprising one or more sGC modulators alone or in combination... Agent: Heslin Rothenberg Farley & Mesiti PC

20100144866 - Anti-fatigue agents and oral compositions containing andrographolide as active ingredient: Disclosed is a composition which is safe for a human body and an animal, can be ingested continuously on a daily basis, has an anti-fatigue activity, and is effective for the prevention or treatment of a disease or condition associated with fatigue. Specifically disclosed is an anti-fatigue agent comprising andrographolide... Agent: Drinker Biddle & Reath (dc)

20100144867 - Use of lecithin:retinol acyl transferase gene promoter methylation in evaluating the cancer state of subject: The present invention relates to a method of evaluating the cancer state of a subject using lecithin:retinol acyl transferase (LRAT) gene promoter methylation status. Methods of analyzing and quantifying LRAT gene promoter methylation level are also disclosed. The present invention also relates to methods of determining the prognosis for s... Agent: Nixon Peabody LLP - Patent Group

20100144868 - Novel neuroprotective compounds and uses thereof: Disclosed are novel hybrid compounds having a fullerene core residue, one or more bioavailability enhancing moieties and one or more glutamate receptor ligand residues, whereby the bioavailability enhancing moiety allow the compound to reach an effective concentration in physiological media and pass the blood-brain barrier, as defined in the specification.... Agent: Martin D. Moynihan D/b/a Prtsi, Inc.

20100144869 - Conjugates comprising a gaba-or glycine compound, pharmaceutical compositions and combinations thereof as well as their use in treating cns disorders: A novel use of conjugates of psychotropic drugs (e.g., antidepressants or anti-epileptic drugs) and organic acids such as GABA in the treatment of pain is disclosed. A novel GABA conjugate and uses thereof is also disclosed.... Agent: Martin D. Moynihan D/b/a Prtsi, Inc.

20100144870 - Chemical compositions and methods of making them: Bimetal chelates are prepared from a solution formed by adding to a solvent one or more polyfunctional acids with basic salts of two or more coordination elements listed in Groups IIIA to VIIIA, Groups IB to IIIB, of periods 4 and 5 and aluminum in Group IIIB, period 3 of... Agent: Carter, Deluca, Farrell & Schmidt, LLP

20100144871 - Treating muscle wasting with selective androgen receptor modulators: This invention provides: 1) a method of treating a subject suffering from a muscle wasting disorder; 2) a method of preventing a muscle wasting disorder in a subject; 3) a method of treating, preventing, suppressing, inhibiting or reducing muscle loss in a subject suffering from a muscle wasting disorder; 4)... Agent: Pearl Cohen Zedek Latzer, LLP

20100144872 - New methylenebisphenyl compounds useful in the treatment of inflammation: There is provided compounds of formula (I), wherein Rx, Ry, X1, X2, L1, L2, Y1 and Y2 have meanings given in the description, and pharmaceutically-acceptable salts thereof, which compounds are useful in the treatment of diseases in which inhibition of the activity of leukotriene C4 synthase is desired and/or required,... Agent: K&l Gates LLP

20100144873 - Treatment of myocarditis using fts: Disclosed are methods of treating myocarditis by—administering to a human in need thereof effective amounts of FTS, or various analogs thereof, or a pharmaceutically acceptable salt thereof.... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20100144874 - Use of a pparalpha agonist and metformin for decreasing the serum triglycerides: The present invention relates to the combined use of a PPARα agonist and metformin for decreasing serum triglycerides.... Agent: Crowell & Moring LLP Intellectual Property Group

20100144875 - Compositions and methods for preserving brain function: Compositions and methods for preventing, reducing, or delaying decline in one or more of cognitive function, motor function, cerebrovascular function, or behavior in animals, particularly geriatric animals, are disclosed. The compositions and methods utilize medium chain triglycerides.... Agent: Wendell Ray Guffey Nestle Purina Petcare Global Resources, Inc.

20100144876 - Modulator: The present invention relates to a compound of formula (I), or a pharmaceutically acceptable salt thereof, wherein Z is OR1 or NR1R2 wherein each of R1 and R2 is independently H, or a hydrocarbyl group; X is an alkylene, alkenylene, or alkynylene group, each of which may be optionally substituted... Agent: Nixon & Vanderhye, PC

20100144877 - Synergistic enhancement of calcium propionate: A novel composition comprised of a monocarboxylic fatty acid synergistically enhanced with a dual quaternary ammonium compound to provide immediate fungal and sporicidal destruction with long term residual resistance.... Agent: Vinson & Elkins L.L.P.

20100144878 - Nutritional supplement or functional food comprising oil combination: The present invention relates to a nutritional supplement or functional food comprising or consisting of (a) a nut oil in an amount of 0.5 to 20 percent by volume; (b) one or more ω-3-fatty acid sources in an amount of 10 to 50 or 10 to 90 percent by volume,... Agent: Reed Smith LLP

20100144880 - Amino acid inhibitors of plasmin: The present invention relates to new amino acid inhibitors of plasmin, pharmaceutical compositions thereof, and methods of use thereof... Agent: Global Patent Group - Apx

20100144879 - Antibiotic compound: Fermentation of a nutrient medium with a eubacterium Streptomyces sp. yields a novel antibacterial compound of structural formula (I).... Agent: Merck

20100144881 - Crystalline forms of a 3-carboxypropyl-aminotetralin compound: The invention provides crystalline solid forms of (S)-4-((2S,3S)-7-carbamoyl-1,1-diethyl-3-methoxy-1,2,3,4-tetrahydronaphthalen-2-ylamino)-2-cyclohexylmethyl-butyric acid. The invention also provides pharmaceutical compositions comprising such crystalline solid forms, methods of using such crystalline solid forms to treat diseases associated with mu opioid receptor activity, and processes useful for preparing such crystalline solid forms.... Agent: Theravance, Inc.

20100144882 - Method of treating post-surgical acute pain: A method is provided for treating pain in patients recovering from post-surgical trauma by administering between about 13 to about 30 mg of diclofenac potassium in a liquid dispersible formulation over a period of at least 24 hours, wherein the daily total amount of diclofenac potassium administered is less than... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20100144883 - Topically applicable compositions for the treatment of keratinization disorders: Topical compositions containing from 0.01% to 0.09% by weight of adapalene or salts thereof are useful for the treatment or prevention of keratinization disorders, particularly acne, and additionally contain at least one gelling agent selected from among carbomers, polysaccharides, cellulose and its derivatives, copolymers of acrylate and of alkyl acrylate,... Agent: Buchanan, Ingersoll & Rooney PC

20100144884 - Novel 3-phenyl acrylic acid compound activators of type ppar receptors and pharmaceutical/cosmetic compositions comprised thereof: p

20100144885 - Histone acetyl transferase activators and histone deacetylase inhibitors in the treatment of alcoholism: The present invention relates to the reduction of a symptom of an alcohol withdrawal state comprising administering a modulator of histone acetylation.... Agent: Marshall, Gerstein & Borun LLP

20100144886 - Method for treating pulmonary arterial hypertension: The present invention is directed to methods comprising administering a composition comprising a therapeutically effective amount of (R)-verapamil, a derivative thereof, or a pharmaceutically acceptable salt thereof, wherein the composition treats, prevents and/or manages at least one condition having MT1 receptor, 5-HT2B receptor and L-type calcium channel activity and releases... Agent: Greenblum & Bernstein, P.L.C

20100144887 - Crystalline solid rasagiline base: The subject invention provides crystalline R(+)-N-propargyl-1-aminoindan, pharmaceutical compositions and methods of manufacture thereof.... Agent: Cooper & Dunham, LLP

20100144888 - Pesticidal methods and compositions for modulating gaba receptors: Methods for using pesticidal compositions containing a pesticidally acceptable carrier, at least one GABA receptor modulator compound as a pesticidally active ingredient and optionally an additional compounds, such as a synergist, and methods for using same.... Agent: Nixon & Vanderhye, PC

20100144889 - Cholesterol control agent: The invention relates to medicine and can be used for producing a medicinal agent for normalising the cholesterol level. The aim of the invention is to develop a physiologically acceptable cholesterol-control agent which is nontoxic and does not cause addiction of organism. In preferred embodiments, the method for producing said... Agent: Aleksandr Smushkovich

20100144890 - Use of a surfactant for the preparation of a formulation for the treatment of adipose diseases: Use of a mixture comprising at least one non-aromatic surfactant having a plurality of ether and/or ester groups and at least one carrier agent for the preparation of a formulation for the treatment of adipose tissue disease and/or condition with improved bioavailability and lipolysis behaviour.... Agent: The Firm Of Hueschen And Sage

20100144891 - Use of cyclohexanehexol derivatives in the treatment of amyotrophic lateral sclerosis: The present invention relates to methods for modulating, disrupting or enhancing the clearance of copper/zinc superoxide dismutase 1 (SOD1) aggregates in astrocytes or motor neurons in a subject, by administering a medicament comprising a therapeutically effective amount of a cyclohexanehexyl derivative. In another aspect, the invention provides a medicament comprising... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20100144892 - Method of producing organic certified glycerin: A process for the production of naturally and organically fermented glycerin includes cleaning and sanitizing of the fermentation equipment prior to fermentation without using any traditional synthetic organic hydrocarbon-based chemicals. The fermentation process uses a non-chemical nutrient and nitrogen source from natural proteins during the fermentation to reduce trace amounts... Agent: Procopio, Cory, Hargreaves & Savitch LLP

20100144893 - Isoprenoid synthases: The invention relates to the field of genetic engineering of flavor, fragrance and biocontrol agent development. More specifically it relates to a process for production of natural flavors, fragrances or bio-control agents by the control of one or more genes implicated in that process. The invention provides an isolated or... Agent: Lester & Horwitz C/o Ladas & Parry

20100144895 - Embolic compositions with non-cyanoacrylate rheology modifying agents: Compositions for embolization are disclosed herein. The compositions disclosed can have a matrix-forming component, a solid-aggregate material, and a rheology modifying agent, wherein the matrix-forming component includes at least alkyl cyanoacrylate monomers, a stabilizer, and a plasticizer, and the solid-aggregate material includes at least a radiopacifier. The composition and a... Agent: Mayer & Williams PC

20100144894 - Use of dicalcium phosphate anhydride powder: Dicalcium phosphate anhydride powder of which at least 50% by weight is of a grain size of between 45 and 150 μm, a maximum of 50% by weight is of a grain size of <45 μm and a maximum of 5% by weight is of a grain size >150 μm... Agent: Dinsmore & Shohl LLP

20100144896 - Thixotropic pharmaceutical compositions: The present invention relates to a thixotropic pharmaceutical composition in which the viscosity is changed due to external mechanical stress applied so that isothermal and continuous gel/sol/gel transition occurs. The thixotropic pharmaceutical composition includes a pharmacologically active substance, a biocompatible thickener having a predetermined thixotropic property, and optionally a hydrophilic... Agent: Dickstein Shapiro LLP

20100144897 - Methicone replacements for cyclomethicone: The invention is directed to a dry feeling silicone that not only provides a dry feel when applied to skin, but also has a low surface tension, provides spreadability and contains essentially no cyclic silicones and additionally and importantly cannot is not form to make cyclomethicone. The ability to make... Agent: A.j. O'lenick, Jr.

20100144899 - Method for preparing nano-emulsions: e

20100144898 - Mixture comprising an alkylpolyglucoside, a cosurfactant and a polymer additive: a polymeric additive as component II, wherein the polymeric additive, as component III, contains at least one water-soluble moiety and at least one hydrophobic moiety, the ratio of the number average molecular weights of all water-soluble moieties to the number average molecular weights of all hydrophobic moieties being from 2:1... Agent: Jacobson Holman PLLC

20100144900 - Stereo photo hydrofel, a process of making said stereo photo hydrogel, polymers for use in making such hydrogel and a pharmaceutical comprising said polymers: The Invention relates to a stereo photo hydrogel formed by stereo complexed and photo cross-linked polymers, which polymers comprise at least two types of polymers having at least one hydrophilic component, at least one hydrophobic mutually stereo complexing component, and at least one of the types comprises at least one... Agent: Bozicevic, Field & Francis LLP

20100144901 - Gel composition for medical material or hygiene material, molded article thereof and adhesive material or adhesive preparation using same: The present invention can provide a composition for a medical material or a hygiene material, which can retain a considerable amount of a chemical substance such as a drug and the like or an organic liquid component, is associated with less limitation on molding, does not easily drop off when... Agent: Wenderoth, Lind & Ponack, L.L.P.

20100144902 - Biocompatible rapid-gelating hydrogel and associated preparation method of spray: This invention discloses a preparation method for biocompatible rapid-gelating hydrogel. Wherein, hydrogel is formed by rapid chemical-crosslinking using the mixing and chemical-crosslinking reaction under specified conditions between several active compound components. The preparation method comprises the following steps: (1) The solution containing biocompatible thiolated macromolecular derivatives (component A) and biocompatible... Agent: Oliff & Berridge, PLC

20100144903 - Methods of diagnosis and treatment of crohn's disease: In one embodiment, this invention provides methods of diagnosing and/or predicting susceptibility to Crohn's Disease by determining the presence or absence of risk haplotypes in IL23R, IL17A, IL17RA and/or IL12RB1 locus. In another embodiment, the invention provides methods of diagnosing and/or predicting susceptibility to Crohn's Disease in an individual by... Agent: Davis Wright Tremaine LLP/los Angeles

06/03/2010 > patent applications in patent subcategories. invention type

20100137187 - Glutamate-enhanced cell-penetrating peptides and methods of using same: Disclosed herein are novel glutamate-enhanced cell-penetrating peptides (CPPs) for use as delivery vehicles to mediate intracellular uptake of therapeutic payloads and methods of using the same.... Agent: Patent Docket Administrator Lowenstein Sandler PC

20100137186 - Use of an active principle originating from amaranth (amaranthus) for preparing a composition intended to activate cellular energy and to protect the skin from oxidative damage: Methods of administering in a cosmetic composition or a pharmaceutical composition, an effective amount of a peptide active principle originating from amaranth of the species Amaranthus hypochondriacus. The active principle is intended to activate cellular energy and to protect the skin from oxidativ damage, and the active principle may be... Agent: Young & Thompson

20100137188 - Formulations comprising cyclic compounds: wherein A, B independently in each occurrence is alkane-i,j-diyl having k carbon atoms, i and independently j being less than or equal k and k being selected from 1 to 10, wherein said alkane-i,j-diyl (i) may comprise one or more double bonds; (ii) is optionally substituted; and/or (iii) comprises a... Agent: Pillsbury Winthrop Shaw Pittman LLP

20100137189 - Modified globin proteins with altered electron transport pathway: The present invention relates to a modified porphyrin-based oxygen-carrying protein, such as haemoglobin, which has been found, in its unmodified state to have a low affinity site of electron transfer and a high affinity electron transfer between a reductant and ferryl haem iron via one or more protein amino acids.... Agent: Nixon & Vanderhye, PC

20100137193 - Chitosan derivatives to treat animals or optimize animal health: Described herein are methods of inhibiting the growth of or killing a bacterium in an animal subject, preventing or delaying onset of an infection with a bacterium in an animal subject, preventing or delaying onset of a pathogen mediated disease or disorder in an animal subject, or reducing bacterial load... Agent: Lando & Anastasi, LLP

20100137192 - Compositions and methods for treating or ameliorating mycobacterial infections: A novel method of treating and preventing bacterial diseases is provided. In particular, the present invention relates to compositions and methods for inhibition of Gram negative, Gram poitive and acid fast bacilli in general and tuberculosis (TB), mycobacterium avium complex (MAC), and anthrax in particular. Thus, the invention relates to... Agent: Faegre & Benson LLP Patent Docketing - Intellectual Property

20100137190 - Liquid composition for external application and preparation for external application for treatment of skin ulcer: An object of the present invention is to provide a liquid composition for external application and a preparation for external application which are excellent in healing effect on skin ulcers including intractable skin ulcers such as bedsore (decubitus), diabetic skin ulcer and ischemic skin ulcer. The liquid composition for external... Agent: Kratz, Quintos & Hanson, LLP

20100137194 - Plasminogen activator inhibitor-1 inhibitors and methods of use thereof to modulate lipid metabolism: The invention relates to plasminogen activator-1 (PAI-1) inhibitor compounds and uses thereof in the treatment of any disease or condition associated with elevated PAI-1. The invention includes, but is not limited to, the use of such compounds to modulate lipid metabolism and treat conditions associated with elevated PAI-1, cholesterol, or... Agent: Marshall, Gerstein & Borun LLP

20100137195 - Production of recombinant il-18 binding protein: The invention relates to a process for the production of IL-18 binding protein (IL-18BP), and to a composition comprising IL-18BP characterized by a specific glycosylation pattern.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20100137191 - Protective agents for transplanted organs: Compositions for protecting transplanted organs, promoting survival of transplanted organs or preserving organs for transplant containing erythropoietin (EPO) as an active ingredient are provided.... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20100137196 - Histone deacetylases, and uses related thereto: The present invention concerns the discovery that proteins encoded by a family of genes, termed here HDx-related genes, which are involved in the control of chromatin structure and, thus in transcription and translation. The present invention makes available compositions and methods that can be utilized, for example to control cell... Agent: Patent Correspondence Arnall Golden Gregory LLP

20100137197 - Lyophilized anti-fungal composition: A lyophilized anti-fungal composition comprises (A) caspofungin, or a pharmaceutically acceptable salt thereof, in an effective amount; (B) one or more non-reducing sugars having a glass transition temperature Tg(s) of at least about 90° C.; and (C) an acetate buffer in an amount effective to provide a pH in a... Agent: Merck

20100137198 - Pharmaceutical composition for topical application: A pharmaceutical or cosmetic carrier or composition for topical application characterized by rheological properties which render the carrier or composition semi-solid at rest and a liquid upon application of shear forces thereto. The composition or carrier are prepared by mixing 1-25 percent of a solidifying agent and 75-99 percent of... Agent: Wilmerhale/boston

20100137199 - Dab9 derivatives of lipopeptide antibiotics and methods of making and using the same: The present invention provides Dab9 derivatives of amphomycin-type lipopeptide antibiotics that display antimicrobial activity against Gram-positive bacteria, methods and intermediates for synthesizing the compounds and methods of using the compounds in a variety of contexts, including in the treatment and prevention of infections.... Agent: Darby & Darby P.C.

20100137216 - Axmi-027, axmi-036 and axmi-038, a family of delta-endotoxin genes and methods for their use: Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a delta-endotoxin polypeptide are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also... Agent: Alston & Bird LLP

20100137214 - Chimeric hirudin proteins: The present invention relates to a chimeric hirudin protein comprising a carrier attached to the N-terminus of hirudin, with an intervening plasmin cleavage site. The chimeric hirudin protein contains a relatively inactive form of hirudin. However, when such chimeric hirudin protein being cleaved by plasmin in the vicinity of a... Agent: Wolf Greenfield & Sacks, P.C.

20100137202 - Compositions for reprogramming a cell and uses therefor: The present invention generally provides therapeutic compositions and methods for treating a disease, disorder, or injury characterized by a deficiency in the number or biological activity of a cell of interest. The method provides compositions for generating reprogrammed cells or for increasing regeneration in a cell, tissue, or organ of... Agent: Edwards Angell Palmer & Dodge LLP

20100137218 - Expression system of nell peptide: Recombinant NELL peptides and methods of preparing the same are disclosed.... Agent: Squire, Sanders & Dempsey L.L.P.

20100137217 - Fibrosis inhibitor for implanted organ: A pharmaceutical preparation comprising a hepatocyte growth factor or a DNA molecule encoding the same and the like according to the present invention can suppress the fibrosis of a transplanted organ after organ transplantation. The present invention is useful in the fields of organ transplantation and regeneration therapy.... Agent: Wenderoth, Lind & Ponack, L.L.P.

20100137213 - Formulations of single domain antigen binding molecules: The invention relates to formulations of single domain antigen binding molecules, e.g., nanobody molecules, in particular formulations of TNF-binding nanobody molecules. The single domain antigen binding molecules can include one or more single binding domains that interact with, e.g., bind to, one or more target proteins. The formulations are useful,... Agent: Lando & Anastasi, LLP W2023

20100137207 - G protein coupled receptor agonists and antagonists and methods of activating and inhibiting g protein coupled receptors using the same: The invention relates generally to G protein coupled receptors and in particular to agonists and antagonists of G protein receptors and methods of using the same.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100137210 - Gastrointestinal proliferative foctor and uses thereof: The invention relates to pharmaceutical compositions comprising gastrointestinal proliferative factor (GIPF) polynucleotides and polypeptides. The invention further relates to the therapeutic use of GIPF to prevent or treat conditions or disorders associated with the degeneration of the epithelial mucosa.... Agent: Robins & Pasternak

20100137204 - Glp-1 pharmaceutical compositions: The present invention is directed to peptide analogues of glucagon-like peptide-1, the pharmaceutically-acceptable salts thereof, to methods of using such analogues to treat mammals and to pharmaceutical compositions useful therefore comprising said analogues.... Agent: Leon R. Yankwich

20100137208 - Intratumorally administered lactoferrin in the treatment of malignantneoplasms and other hyperproliferative diseases: The present invention relates to methods of treating a hyperproliferative disease by administering a composition of lactoferrin alone or in combination with standard anti-cancer therapies.... Agent: Fulbright & Jaworski, LLP

20100137201 - Medicaments: There is provided the use of WNT5A, or a therapeutically effective fragment or derivative thereof, in the preparation of a medicament for use in the prevention, reduction or inhibition of scarring. There is also provided the use of WNT5A, or a therapeutically effective fragment or derivative thereof, in the preparation... Agent: Foley And Lardner LLP Suite 500

20100137203 - Method for preparing a cell-derived extracellular matrix membrane: The present invention relates to a method for preparing a cell-derived extracellular matrix membrane, more particularly, to a method for preparing a chondrocyte-derived ECM membrane, the method comprising the steps of forming a suitable thickness of ECM membrane by culturing chondrocytes derived from animal cartilage at a high concentration in... Agent: Moore & Van Allen PLLC

20100137211 - Methods and compositions for intra-articular coagulation proteins: The present invention provides methods and compositions for treating blood clotting factor disorders and/or reducing bleeding-associated joint damage by treatments delivered to the joint in a subject.... Agent: Myers Bigel Sibley & Sajovec

20100137200 - Methods for treatment of growth disorders: The present invention provides methods and compositions for increasing the growth rates, alleviating the symptoms, or improving the metabolism of human patients having an endocrine disorder characterized by partial endogenous growth hormone activity or signaling. The invention provides a method comprising administering to a patient suffering from an endocrine disorder... Agent: Bozicevic, Field & Francis LLP

20100137209 - Modified plasminogen activator inhibitor type-1 and methods based thereon: The present invention is based upon the discovery that modified plasminogen activator inhibitor type-I (PAI-1) in which two or more amino acid residues that do not contain a sulfhydryl group have been replaced with amino acid residues that contain a sulfhydryl group and, therefore, forms intramolecular disulfide bonds, have increased... Agent: Frommer Lawrence & Haug

20100137206 - Novel ligand guided block copolymers for targeted drug delivery: This application relates to micelle-forming poly(ethylene oxide)-block-poly(ester) block copolymers having reactive groups on both the poly(ethylene oxide) block and the poly(ester) block therein. The biodegradability of these copolymers and their biocompatibilities with a large number of bioactive agents make them suitable as carriers for various bioactive agents. The bioactive agent,... Agent: Bennett Jones LLP C/o Ms Roseann Caldwell

20100137215 - Novel tetrahydro-1h-pyrido[4,3-b]indoles: This invention relates to novel tetrahydro-1H-pyrido[4,3-b]indoles, their derivatives and pharmaceutically acceptable salts thereof. This invention also provides compositions comprising a compound of this invention and the use of such compositions in methods of treating diseases and conditions that are beneficially treated by NMDA antagonists, acetylcholinesterase inhibitors, 5-HT6 antagonists, other neuroprotectors,... Agent: Foley & Lardner LLP

20100137205 - Use of fgf-18 protein, target proteins and their respective encoding nucleotide sequences to induce cartilage formation: The use of fibroblast growth factor (FGF)-18 protein, certain of its downstream target genes and respective expressed proteins, in particular sonic hedgehog (Shh), Shh protein, β-catenin, β-catenin protein, and the Wnt family of proteins that stimulate β-catenin, and the respective nucleotide sequences encoding this protein, particularly for inducing cartilage formation,... Agent: Hasse & Nesbitt LLC

20100137212 - Use of glp-1 receptor agonists for the treatment of gastrointestinal disorders: The present invention describes the methods of using incretin mimetics such as GLP-1 receptor agonists, particularly exenatide, to treat short bowel syndrome and spastic or hyperactive esophageal motor disorders.... Agent: Davis Wright Tremaine LLP/los Angeles

20100137220 - Blood sugar-modulating polypeptides: e

20100137219 - Methods and compositions for inhibiting binding ige to a high affinity receptor: The invention provides methods and compositions for inhibiting binding of IgE to a high affinity receptor. The methods and compositions are useful in the treatment of allergic diseases and allergy symptoms in mammals.... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20100137222 - Basic peptides and their use as combined antibacterial-antifungine agents: The invention relates to peptides, and peptide variants thereof, in which substantially all of the amino sequence of said peptide are the same, for use in the treatment of a mixed microbial infection.... Agent: Speckman Law Group PLLC

20100137223 - Neuropeptide-2 receptor (y-2r) agonists and uses thereof: e

20100137221 - Peptides that interact with topoisomerase i and methods thereof: Disclosed are compositions and methods for treating cancer comprising peptides that can act synergistically with chemotherapeutic agents.... Agent: Ballard Spahr LLP

20100137224 - Method of reducing injury to mammalian cells: A method of inhibiting the binding between N-methyl-D-aspartate receptors and neuronal proteins in a neuron the method comprising administering to the neuron an effective inhibiting amount of a peptide replacement agent for the NMDA receptor or neuronal protein interaction domain that effect said inhibition of the NMDA receptor neuronal protein.... Agent: Townsend And Townsend And Crew, LLP

20100137225 - Phage displayed cell binding peptides: This disclosure provides the construction, expression, and selection of the mutated genes that encode novel Trp cage polypeptides with desirable binding properties, as well as the novel Trp cage polypeptides themselves. The substances or targets bound by these novel Trp cage polypeptides may be but need not be proteins or... Agent: Nastech Pharmaceutical Company Inc Mdrna, Inc.

20100137226 - Fatigue-reducing agent: A pharmaceutical product, a functional food or the like has been demanded which can reduce the fatigue in a tired person and enables the tired person to lead a fulfilled life. Disclosed is a fatigue-reducing agent. The fatigue-reducing agent comprises ornithine or a salt thereof and glutathione or a salt... Agent: Darby & Darby P.C.

20100137227 - Methods and compositions for treating conditions: The invention relates to compositions comprising of SEQ NO: 1-244, 248-249, and any homologs, analogs, and fragments thereof. Such compositions can be used to treat, prevent, and modulate pain, inflammation, and metabolic processes in various organisms including plants and animals. Such compositions can be formulated with an acceptable pharmaceutical excipient... Agent: Wilson, Sonsini, Goodrich & Rosati

20100137229 - Method of enhancing lysosomal alpha-galactosidase a: A method of enhancing the activity of lysosomal α-Galactosidase A (α-Gal A) in mammalian cells and for treatment of Fabry disease by administration of 1-deoxy-galactonojirimycin and related compounds.... Agent: Baker Botts L.L.P.

20100137230 - New pyridin-2-one compounds: The present invention relates to compounds of the formula (I) that are useful antimicrobial agents and effective against a variety of multi-drug resistant bacteria:... Agent: Dann, Dorfman, Herrell & Skillman

20100137228 - Drugs, foods or drinks with the use of algae-derived physiologically active substances: foods, drinks, cosmetics, etc. containing as the active ingredient at least one member selected from the group consisting of the above-mentioned compound, its aldehyde, its hydrate and 2-O-methylated derivatives thereof and soluble sugar compounds containing the above compound. This compound also shows, for example, an apoptosis-inducing activity, a carcinostatic activity... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20100137231 - 6\"-amino-6\"-deoxygalactosylceramides: This invention relates to galactosylceramide compounds.... Agent: Merchant & Gould PC

20100137232 - Composition comprising a diuretic and a cardiac glycoside for the treatment of dna viral infections of the eye: DNA viral infections of the eye are treated or prevented by the application of a composition including a diuretic and/or a cardiac glycoside dissolved in a water/ethanol solution wherein the level of the ethanol is adjusted to be acceptable to the eye.... Agent: Caesar, Rivise, Bernstein, Cohen & Pokotilow, Ltd.

20100137233 - Active substance combinations with insecticides and acaricide properties: The novel active compound combinations comprising compounds of the formula (I) and spinetoram have very good insecticidal and/or acaricidal properties.... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20100137234 - 10-substituted macrolide antibiotics: Disclosed herein are 10-desmethyl, 10 substituted-macrolides, their preparation, pharmaceutical compositions containing them, their use and methods of treatment using them. The 10-desmethyl macrolides are particularly useful as antibiotics.... Agent: Cantor Colburn, LLP

20100137235 - Methods for concomitant administration of colchicine and macrolide antibiotics: Methods for concomitant administration of colchicine together with one or more macrolide antibiotics, e.g., clarithromycin, are disclosed. Such methods reduce the dangers commonly associated with such concomitant administration and provide additional benefits.... Agent: Cantor Colburn, LLP

20100137236 - Compositions comprising a gpr109 ligand for treating disorders of the digestive tract and/or cancer: Pharmaceutical compositions containing an effective amount of a ligand for GPR109 to decrease intracellular cAMP levels of a subject in combination with an effective amount of a DNA methyl transferase inhibito to reduce or inhibit downregulation of GPR109 in the intestinal epithelial cells of the subject relative to a control... Agent: Pabst Patent Group LLP

20100137408 - Antisense antibacterial method and compound: A method and antisense compound for inhibiting the growth of pathogenic bacterial cells are disclosed. The compound contains no more than 12 nucleotide bases and has a targeting nucleic acid sequence of no fewer than 10 bases in length that is complementary to a target sequence containing or within 10... Agent: Seed Intellectual Property Law Group PLLC

20100137404 - Compositions and methods for altering gene expression: Compositions and methods for regulating gene expression in a growing animal are disclosed.... Agent: Colgate-palmolive Company

20100137409 - Compositions and methods for the treatment of diseases associated with aberrant cilia assembly and regulation: Compositions and methods are provided for identifying agents which have efficacy for the treatment of disorders related to aberrant cilial structure and function, including polycystic kidney disease.... Agent: Dann, Dorfman, Herrell & Skillman

20100137410 - Oncogenic all-1 fusion proteins for targeting drosha-mediated microrna processing: Disclosed are compositions and methods for reducing the proliferation of ALL cancer cells through targeted interactions with ALL1 fusion proteins.... Agent: Macmillan Sobanski & Todd, LLC

20100137411 - Ras-mediated epigenetic silencing effectors and uses thereof: The invention relates to methods for inhibiting gene silencing, methods for inhibiting cell proliferation, methods for inhibiting Ras mediated tumor growth, methods for screening for regulators of FAS expression, and methods for identifying inhibitors of Ras mediated tumor growth.... Agent: Wolf Greenfield & Sacks, P.C.

20100137405 - Rna interference mediated inhibition of cyclic nucleotide type 4 phosphodiesterase (pde4b) gene expression using short interfering nucleic acid (sina): The present invention relates to compounds, compositions, and methods for the study, diagnosis, and treatment of traits, diseases and conditions that respond to the modulation of cyclic nucleotide type 4 phosphodiesterase (PDE4B) gene expression and/or activity, including PDE4B1, PDE4B2, and PDE4B3 gene expression and/or activity. The present invention is also... Agent: Merck C/o Sirna Therapeutics, Inc.

20100137406 - Rna interference mediated inhibition of cyclic nucleotide type 4 phosphodiesterase (pde4b) gene expression using short interfering nucleic acid (sina): The present invention relates to compounds, compositions, and methods for the study, diagnosis, and treatment of traits, diseases and conditions that respond to the modulation of cyclic nucleotide type 4 phosphodiesterase (PDE4B) gene expression and/or activity, including PDE4B1, PDE4B2, and PDE4B3 gene expression and/or activity. The present invention is also... Agent: Merck C/o Sirna Therapeutics, Inc.

20100137407 - Single-chain circular rna and method of producing the same: The present invention relates to a single-chain circular RNA having a sustained or slow-releasing RNA interference effect, characterized in that the single-chain circular RNA comprises a sense strand sequence, an antisense strand sequence complementary to the sense strand sequence, identical or different two loop sequences between the sense strand and... Agent: Foley And Lardner LLP Suite 500

20100137416 - Cadherin-11-mediated modulation of hair growth: The present invention provides for methods of inhibiting hair growth, comprising decreasing the level of CAD1 1 mRNA and/or protein in hair follicle cells of a subject. The present invention further provides for methods of promoting hair growth, comprising increasing the level of CADI 1 mKNA and/or protein in hair... Agent: Baker Botts L.L.P.

20100137412 - Lentivirus pseudotyped with influenza hemagglutinin and methods of use: Highly effective pseudotyping of lentiviral vector with influenza HA, NA and M2 packaging gene constructs at the proper ratios. Lentivirus vector pseudotyped with influenza HA, especially pseudotyped with H5 and neuraminidase. Methods of inducing immune responses to influenza antigens or for transducing genes into cells to which influenza antigens bind... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20100137413 - Micrornaome: MicroRNAs (miRNAs) are a class of small noncoding RNAs that have important regulatory roles in multicellular organisms. The public miRNA database contains 321 human miRNA sequences, 234 of which have been experimentally verified. To explore the possibility that additional miRNAs are present in the human genome, we have developed an... Agent: Banner & Witcoff, Ltd.

20100137414 - Modulation of factor 11 expression: Disclosed herein are antisense compounds and methods for decreasing Factor 11 and treating or preventing thromboembolic complications in an individual in need thereof. Examples of disease conditions that can be ameliorated with the administration of antisense compounds targeted to Factor 11 include thrombosis, embolism, and thromboembolism, such as, deep vein... Agent: Jones Day For Isis Pharmaceuticals, Inc.

20100137415 - Vector for gene therapy: The present invention provides a retroviral vector containing a transcription unit comprising a transcription regulatory sequence and a gene encoding a polypeptide having single-stranded RNA-specific endoribonuclease activity which is placed so that its expression can be controlled by the regulatory sequence, wherein the unit is placed so that the direction... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20100137238 - Method for increasing hair growth: The present invention provides a method for stimulating hair growth, which comprises applying a composition containing at least one energy-inducing compound selected from the group consisting of 5′-AMP and ATP. Such a composition is particularly effective in increasing the DNA synthesis in dermal papilla cells.... Agent: Karen A. Lowney Estee Lauder

20100137237 - Process for the preparation of an (rp)-8-substituted camps: This invention relates to a process for the preparation of an (Rp)-8-substituted adenosine-3′,5′-cyclic phosphorothioic acid, or a salt or ester thereof, which comprises P-amidating 8-bromoadenosine-3′,5′-cyclic phosphoric acid, and reacting the P-amidate with a base and with carbon disulphide to yield (Rp)-8-bromoadenosine-3′,5′-cyclic phosphorothioic acid or a salt or ester thereof.... Agent: Sughrue Mion, PLLC

20100137239 - Gemcitabine combination therapy: The present invention provides compositions and methods for the treatment of cell proliferative disorders using at least one DAC inhibitor and gemcitabine.... Agent: Choate, Hall & Stewart LLP

20100137240 - Use of nucleoside derivatives as anti-koi herpes virus in fish: The present invention relates to the use of N-phosphonylmethoxyethyl nucleoside analogs for manufacturing a medicament for the treatment or prevention of Koi Herpes virus infections in fish, especially in carps.... Agent: Clark & Elbing LLP

20100137241 - Imidated biopolymer adhesive and hydrogel: Biologically compatible polymers carry an imide and can be used as an adhesive, a hydrogel or both. A second biologically compatible polymer reactive with the imidated polymer can be used therewith to seal openings.... Agent: Edwards Angell Palmer & Dodge LLP

20100137242 - Paromomycin supplemented feedingstuffs for poultry species and use thereof for prophylaxis of histomoniasis, reduction of the horizontal spreading of histomoniasis, and for improved weight gain and feed conversion: Disclosed is the continuous supplementation of poultry feeding stuffs with paromomycin and the resulting effects of prophylaxis against histomoniasis, ensuing decrease of mortality and the reduction of horizontal spreading of the disease. Also observed are improved zoo-technical performances, increase in weight gain and feed efficiency, both in healthy as well... Agent: Fleit Gibbons Gutman Bongini & Bianco Pl

20100137245 - Heteerocyclyl-substituted thiazoles as crop protection agents: s

20100137243 - Oxazolidinone and/or isoxazoline as antibacterial agents: Compounds of Formula (I), or a pharmaceutically-acceptable salt, or an in-vivo-hydrolysable ester thereof, and compounds as shown in Formula (I) wherein C is for example (D), (E), (F); wherein A and B are independently selected from (i) and (ii); R2a to R3b are independently selected from hydrogen and fluorine; R1a... Agent: Morgan Lewis & Bockius LLP

20100137244 - Preparation and utility of hmg-coa reductase inhibitors: Chemical syntheses and medical uses of novel modulators of 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase and diastereomeric mixtures of isomers, individual diastereomers, pharmaceutically acceptable salts, solvates, or prodrugs thereof, the chemical synthesis thereof, and the medical use of such compounds for the treatment and/or management of hypercholesterolemia, dyslipidemia, coronary artery disease,... Agent: Global Patent Group - Apx

20100137246 - Anti-inflammatory compositions and methods: Certain embodiments disclosed relate to compositions, including therapeutic compositions, methods, devices, and systems that modulate at least one inflammatory response or reaction. According to various embodiments, the compositions, methods, devices, and systems relate to modulating one or more of Toll-like receptors, Src family kinases, NF-kB molecules, proteases, or proteasomes.... Agent: Searete LLC Clarence T. Tegreene

20100137247 - Anti-inflammatory compositions and methods: Certain embodiments disclosed relate to compositions, including therapeutic compositions, methods, devices, and systems that modulate at least one inflammatory response or reaction. According to various embodiments, the compositions, methods, devices, and systems relate to modulating one or more of Toll-like receptors, Src family kinases, NF-kB molecules, proteases, or proteasomes.... Agent: Searete LLC Clarence T. Tegreene

20100137248 - Boron-containing compounds, uses and preparation thereof: There are provided compounds of formulas (I) to (XIV) and compositions comprising such compounds. Such compounds and compositions are particularly useful for treating inflammation and/or pain, or for water treatment.... Agent: Bereskin And Parr LLP/s.e.n.c.r.l., S.r.l.

20100137249 - Compositions for regulating or modulating quorum sensing in bacteria, methods of using the compounds, and methods of regulating or modulating quorum sensing in bacteria: The present disclosure encompasses compounds and compositions that are useful as specific AI-2 antagonists for the control of bacterial quorum sensing. Although the AI-2 antagonists according to the present disclosure may not have bactericidal effect, their ability to attenuate virulence, drug resistance, and/or biofilm formation have therapeutic benefits. In addition,... Agent: Thomas, Kayden, Horstemeyer & Risley, LLP

20100137250 - Naphthylacetic acids: and pharmaceutically acceptable salts and esters thereof, wherein X, Q, and R1-R6 are defined in the detailed description and claims. In addition, the present invention relates to methods of manufacturing and using the compounds of formula I as well as pharmaceutical compositions containing such compounds. The compounds of formula I... Agent: Hoffmann-la Roche Inc. Patent Law Department

20100137251 - Functional role for cannabinoids in autonomic stability during sleep: The present invention relates generally to pharmacological methods for the prevention or amelioration of sleep-related breathing disorders via administration of cannabimimetic agents and combinations thereof.... Agent: Marshall, Gerstein & Borun LLP

20100137252 - Ophthalmic composition: The ophthalmic composition of the invention comprises (A) lecithin and (B) at least one refrigerant selected from the group consisting of camphor, borneol, eucalyptus oil, and bergamot oil. In the ophthalmic composition, the odor of lecithin is efficiently masked by the refrigerant. The odor of lecithin after aging is also... Agent: Wenderoth, Lind & Ponack, L.L.P.

20100137253 - Therapeutic compound and treatments: Compositions and uses associated with the MT477 family of compounds are disclosed. Particular structural features and properties of the compounds are described in detail. Uses include administering an MT477 family member to a patient for therapeutic purposes. Compositions include chemicals belonging to the MT477 family and pharmaceuticals that contain such... Agent: Ropes & Gray LLP

20100137255 - Creatine phosphate analog prodrugs, compositions and uses thereof: Membrane permeable prodrugs of creatine phosphate analogs, pharmaceutical compositions comprising membrane permeable prodrugs of creatine phosphate analogs, and methods of treating diseases such as ischemia, heart failure, and neurodegenerative disorders comprising administering prodrugs of creatine phosphate analogs, or pharmaceutical compositions thereof are disclosed.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20100137254 - Phosphoramidate alkylator prodrugs: Phosphoramidate alkylator prodrugs can be used to treat cancer when administered along or in combination with one or more anti-neoplastic agents.... Agent: Townsend And Townsend And Crew, LLP

20100137256 - Device and method for treating human body: A method for contouring the body by destroying adipose tissue is disclosed. This method can reduce the circumference of the treated area, improve skin contour irregularities and smooth the appearance of the skin surface. The method is also used as a body treatment before and after a liposuction procedure.... Agent: Nasser Ashgriz Heydary Hamilton PC Suite 1200

20100137257 - Method for alleviating pain using sphingosine-1-phosphate and related compounds, and assays for identifying such compounds: Methods for alleviating pain comprising administering to a subject sphingosine-1-phosphate, functional fragments and derivatives thereof, and other compounds, and assays for identifying such compounds.... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20100137258 - Thiophosphi(o)nic acid derivatives and their therapeutical applications: or on different positions, said substituents being selected in the group comprising: OH, OR, (CH2)n1OH, (CH2)n1OR, COOH, COOR, (CH2)n1C00H, (CH2)n1COOR, C1-C3 alkyl, cycloalkyl, (CH2)n1-alkyl, aryl, (CH2)n1-aryl, halogen, CF3, SO3H, (CH2)xPO3H2, with x=0, 1 or 2, B(OH)2, formula (V), NO2, SO2NH2, SO2NHR; SR, S(O)R, SO2R, benzyl; R being such as above... Agent: Nixon & Vanderhye, PC

20100137259 - Compound for inhibiting trpa1 function and use thereof: The present invention relates to a TRPA1 activation inhibitor, more precisely a TRPA1 activity inhibitor containing isopentenyl pyrophosphate and a method for inhibiting pain containing the step of administering isopentenyl pyrophosphate to a subject. Isopentenyl pyrophosphate of the present invention can regulate pain caused by TRPA1, so that it can... Agent: Greenlee Winner And Sullivan P C

20100137260 - compound for inhibiting trpv3 function and use thereof: The present invention relates to a TRPV3 (transient receptor potential vanilloid 3) activity inhibitor, more precisely to a method for inhibiting TRPV3 activity including the step of treating isopentenyl pyrophosphate and a method for treating skin disease containing the step of administering isopentenyl pyrophosphate to a subject with skin disease... Agent: Greenlee Winner And Sullivan P C

20100137261 - Method for treating aortic stenosis with non-antibacterial tetracycline formulations: The present invention is for a method for treating aortic stenosis in a mammal in need thereof. The method comprises administering an effective amount of a non-antibacterial tetracycline formulation, to the mammal.... Agent: Ronald J Baron Hoffmann & Baron

20100137262 - Low calcemic, highly antiproliferative, analogs of calcitriol: The disclosure provides compounds, compositions and methods using these compounds and compositions to stimulate the differentiation of cells and inhibit excessive cell proliferation of certain cells, including cancer cells and skin cells, which may be useful in the treatment of diseases characterized by abnormal cell proliferation and/or cell differentiation such... Agent: Dla Piper LLP (us)

20100137263 - Assay for the detection of biomarkers associated with pregnancy related conditions: The invention relates to screening methods for determination of the risk of preterm delivery and/or pregnancy associated conditions. The methods involve detection of the level of one or more biomarkers in a biological sample from the patient. In particular, in embodiments of the invention there are provided methods for determining... Agent: Merchant & Gould PC

20100137264 - Progestational 3-(6,6-ethylene-17b-hydroxy-3-oxo-17a-pregna-4-ene-17a-yl)propionic acid g-lactones: Described herein are 3-(6,6-ethylene-17β-hydroxy-3-oxo-17α-pregna-4-ene-17α-yl)propionic acid γ-lactone derivatives having progestational and aldosterone antagonistic activity. Also described herein are methods of preparing and using these novel compounds.... Agent: Meyertons, Hood, Kivlin, Kowert & Goetzel, P.C.

20100137265 - Treatment of conditions relating to hormone deficiencies by administration of progestins: The present invention includes methods for preventing endometrial hyperplasia associated with estrogen therapy through the administration of a progestin agent. The methods presented may include starting the administration of a progestin agent at a high dose, and then lowering the dose.... Agent: Myers Bigel Sibley & Sajovec

20100137267 - Formulations for treatment of adipose tissue, cutaneous tissue and disorders, and muscular tissue: Compositions, formulations, methods, and systems for treating regional fat deposits and fat-related conditions, dermal conditions, and muscular conditions. Methods comprise administering a composition comprising at least one compound that reduces desensitization of beta adrenergic receptors, for example a glucocorticosteroid, and/or at least one long-acting beta-2 adrenergic receptor agonist, for example,... Agent: Wilson, Sonsini, Goodrich & Rosati

20100137268 - Phthalazinone modulators of h1 receptors and/or ltc4 receptors: The present invention relates to new phthalazinone modulators of H1 receptor activity and/or modulators of LTC4 production, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20100137266 - Treatment of insulin resistance and disorders associated therewith: The present invention provides the use of an LXR antagonist, or a physiologically-acceptable pro-drug therefor, in the manufacture of a medicament for combating insulin resistance or a disorder associated therewith. Further provided is a compound being an ester or carbamate of a hydroxycholesterol, a pharmaceutical composition of such a compound... Agent: Knobbe Martens Olson & Bear LLP

20100137269 - Novel c-17-heteroaryl steroidal cyp17 inhibitors/antiandrogens: synehesis, in vitro biological activities, pharmacokinetics and antitumor activity: Described are steroidal C-17 benzoazoles, pyrimidinoazoles (azabenzoazoles) and diazines. Methods for their synthesis are also described, which include methods having a step of nucleophilic vinylic “addition-elimination” substitution reaction of 3β-acetoxy-17-chloro-16-formylandrosta-5,16-diene or analogs thereof and benzoazole or pyrimidinoazole nucleophiles and methods having a palladium catalyzed cross-coupling reaction of 17-iodoandrosta-5,16-dien-3β-ol or analogs... Agent: Wilson, Sonsini, Goodrich & Rosati

20100137270 - Modulation of prostaglandin/cyclooxygenase metabolic pathways: A variety of diseases and disorders associated with the metabolic pathways involved in the activities of cyclooxygenase and the synthesis of prostaglandins, for example type 2 diabetes mellitus and its sequelae, ischemic vascular diseases, pain associated with inflammation, inflammatory skin conditions, spinal cord injury, peripheral neuropathy, multiple sclerosis, inflammatory bowel... Agent: Greenlee Winner And Sullivan P C

20100137271 - Pharmaceutical compositions and dosage forms for administration of hydrophobic drugs: Pharmaceutical compositions and dosage forms for administration of hydrophobic drugs are provided. The pharmaceutical compositions include a therapeutically effective amount of a hydrophobic drug, preferably a steroid; a solubilizer, and a surfactant. The synergistic effect between the hydrophobic drug and the solubilizer results in a pharmaceutical formulation with improved dispersion... Agent: Wilson, Sonsini, Goodrich & Rosati

20100137272 - Zinc salt of isothiazolone compound, method for reducing irritation caused by isothiazolone compound, antibacterial and antifungal method using zinc salt of isothiazolone compound, and antibacterial and antifungal composition: a

20100137273 - Novel 2-azetidinone derivatives as cholesterol absorption inhibitors for the treatment of hyperlipidaemic conditions: Compounds of formula (I): (wherein variable groups are as defined within) pharmaceutically acceptable salts, solvates, solvates of such salts and prodrugs thereof and their use as cholesterol absorption inhibitors for the treatment of hyperlipidaemia are described. Processes for their manufacture and pharmaceutical compositions containing them are also described.... Agent: Pepper Hamilton LLP

20100137279 - 4-methylpyridopyrimidinone compounds: m

20100137276 - Compounds which potentiate ampa receptor and uses thereof in medicine:

20100137278 - Pyrazine compounds as phosphodiesterase 10 inhibitors: Pyrazine compounds, and compositions containing them, and processes for preparing such compounds. Provided herein also are methods of treating disorders or diseases treatable by inhibition of PDE10, such as obesity, non-insulin dependent diabetes, schizophrenia, bipolar disorder, obsessive-compulsive disorder, and the like.... Agent: Amgen Inc.

20100137277 - Pyridine compounds and their use as p2y12 antagonists: The present invention relates to certain new pyridin analogues of Formula (I) to processes for preparing such compounds, to their utility as P2Y12 inhibitors and as anti-trombotic agents etc, their use as medicaments in cardiovascular diseases as well as pharmaceutical compositions containing them.... Agent: Pepper Hamilton LLP

20100137274 - Substituted oxazolidinones and their use in the field of blood coagulation: e

20100137275 - Triaminopyrimidine derivatives as inhibitors of cdc25 phosphatase: The present invention relates to the novel triaminopyrimidine derivatives of formula (I) in which R1, R2, W, R3, R4, and R5 are variable groups. These products have a Cdc25-phosphatase-inhibiting activity. The invention also relates to a process for synthesizing these compounds and also to therapeutic compositions containing these products and... Agent: Hunton & Williams LLP Intellectual Property Department

20100137280 - Azetidin compounds suitable for treating disorders that respond to modulation of the serotonin 5-ht6 receptor: wherein A is C1-C6-alkyl, C1-C6-haloalkyl, C1-C6-hydroxyalkyl, C2-C6-alkenyl, C2-C6-halo-alkenyl, C3-C6-cycloalkyl, aryl-C1-C4-alkyl, aryl-C2-C4-alkenyl, aryl or hetaryl, is a single or double bond; X1 and X2 are N, CRx1, NRx2, or CRx3Rx4; Rx1, Rx3 and Rx4 are H, halogen, CN, NO2, C1-C6-alkyl, C1-C6-alkoxy, C1-C6-alkylcarbonyl, etc. or two geminal radicals Rx3 and Rx4... Agent: Abbott Laboratories C/o Polsinelli Shughart PC

20100137281 - Heterocyclic compound and use thereof: e

20100137282 - Tricyclic nitrogen containing compounds as antibacterial agents: Tricyclic nitrogen containing compounds and their use as antibacterials. Z1 and Z2 are independently selected from CH and N.... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100137283 - Inhibitors of the hiv integrase enzyme: i

20100137284 - Compositions for the treatment and prevention of heart disease and methods of using same: The combination of nitric oxide generating compounds which are not dependent upon aldehyde dehydrogenase for bioactivation, or are specifically targeted to nNOS or the sarcoplasmic reticulum of cardiac muscle cells, and xanthine oxidase inhibitors are effective in the treatment of heart disease, specifically congestive heart failure and ischemic coronary disease.... Agent: Wilson Sonsini Goodrich & Rosati Adamas Pharmaceuticals, Inc.

20100137285 - Small molecule modulators of cytokine activity: and pharmaceutically acceptable derivatives thereof, wherein m, p, R1, R2, R3 and R4 are as described generally and in classes and subclasses herein, and additionally provides pharmaceutical compositions thereof, and methods for the use thereof for the treatment of any of a number of diseases, disorders or conditions associated with... Agent: Choate, Hall & Stewart LLP

20100137286 - Arylcyclohexylethers of dihydrotetraazabenzoazulenes: wherein R1, R2 and R3 are as described herein, their manufacture, and pharmaceutical compositions containing them. The compounds according to the invention act as V1a receptor modulators, and in particular as V1a receptor antagonists. The active compounds of the present invention are useful as therapeutics acting peripherally and centrally in... Agent: Hoffmann-la Roche Inc. Patent Law Department

20100137287 - Aryl-and heteroaryl-substituted tetrahydrobenzo-1,4-diazepines and use thereof to block reuptake of norepinephrine, dopamine, and serotonin: The aryl- and heteroaryl-substituted tetrahydrobenzo-1,4-diazepine derivative compounds of the present invention are represented by formulae 1(A-D) having the following structure: where the substituents X and R1-R8 are as defined herein.... Agent: Nixon Peabody LLP - Patent Group

20100137288 - Indazoles, benzothiazoles, benzoisothiazoles, benzisoxazoles, pyrazolopyridines, isothiazolopyridines, and preparation and uses thereof: The present invention relates generally to the field of ligands for nicotinic acetylcholine receptors (nACh receptors), activation of nACh receptors, and the treatment of disease conditions associated with defective or malfunctioning nicotinic acetylcholine receptors, especially of the brain. Further, this invention relates to novel compounds (e.g., indazoles and benzothiazoles), which... Agent: Millen, White, Zelano & Branigan, PC

20100137289 - Methods and compositions for ameliorating thiazide induced hyperlipidemia: Male Disclosed herein are compositions for ameliorating the lipid producing effects of thiazide therapy. Particularly exemplified herein are compositions containing a thiazide and allopurinol, or some other xanthine oxidase inhibitor.... Agent: Beusse Wolter Sanks Mora & Maire

20100137290 - Oxazolidinone antibiotic derivatives: l

20100137291 - Nitrosated nonsteroidal antiinflammatory compounds, compositions and methods of use: The invention describes novel nitrosated nonsteroidal antiinflammatory drugs (NSAIDs) and pharmaceutically acceptable salts thereof, and novel compositions comprising at least one nitrosated NSAID, and, optionally, at least one compound that donates, transfers or releases nitric oxide, stimulates endogenous synthesis of nitric oxide, elevates endogenous levels of endothelium-derived relaxing factor or... Agent: Wilmerhale/dc

20100137292 - Pharmaceutical formulations of meloxicam: This invention is a novel pharmaceutical formulation of aqueous EDTA (Ethylene diamine tetraacetic acid) free solution of meloxicam in combination with meglumin for administration by oral or parenteral route, comprising one or more pharmaceutically acceptable excipients which is comprising N,N dimethylacetamide and propylene glycol for treating mammals, preferably animals.... Agent: The Nath Law Group

20100137293 - Combination therapy for the treatment of diabetes and conditions related thereto and for the treatment of conditions ameliorated by increasing a blood glp-1 level: The present invention concerns combination of an amount of a GPR119 agonist with an amount of a dipeptidyl peptidase IV (DPP-IV) inhibitor such that the combination provides an effect in lowering a blood glucose level or in increasing a blood GLP-1 level in a subject over that provided by the... Agent: Fish & Richardson P.C.

20100137294 - Compounds, compositions and methods for controlling invertebrate pests: The present application discloses the Tv-stp-1 serine/threonine phosphatase gene from Trichostrongylus vitrinus, and compounds that are useful as invertebrate control agents.... Agent: Sheridan Ross PC

20100137295 - 3-substituted-[1,2,3]-benzotriazinone compound for enhancing glutamatergic synaptic responses: This invention relates to the prevention and treatment of cerebral insufficiency, including enhancement of receptor functioning in synapses in brain networks responsible for higher order behaviors. These brain networks are involved in cognitive abilities related to memory impairment, such as is observed in a variety of dementias, and in imbalances... Agent: Coleman Sudol Sapone, P.C.

20100137296 - N-phenyl anthranilic acid derivatives and uses thereof: Compounds that can be used as openers or blockers of voltage-dependent potassium channels, and which are useful in the treatment of conditions such as central or peripheral nervous system disorders through the modulation of potassium ion flux through voltage-dependent potassium channels and/or depressing or enhancing cortical and/or peripheral neuron activity,... Agent: Martin D. Moynihan D/b/a Prtsi, Inc.

20100137297 - Spiroindalones: The present invention relates to spiroindalone compounds useful as HIF prolyl hydroxylase inhibitors to treat anemia and like conditions.... Agent: Merck

20100137298 - Biaryl sulfonamides and methods for using same: The present invention relates to biaryl sulfonamides and their use as, for example, metalloproteinase inhibitors.... Agent: Woodcock Washburn LLP/wyeth LLC

20100137299 - Spiro-oxindole compounds and their use as therapeutic agents: This invention is directed to spiro-oxindole compounds, as stereoisomers, enantiomers, tautomers thereof or mixtures thereof; or pharmaceutically acceptable salts, solvates or prodrugs thereof, for the treatment and/or prevention of sodium channel-mediated diseases or conditions, such as pain.... Agent: SeedIPLaw Group PLLC

20100137300 - Indolizine acetic acid derivatives as crth2 antagonists: The specific compounds of this list: {7-cyano-2-methyl-1-[4-(morpholine-4-sutfonyl)benzyl]indolizin-3-yl}acetic acid, {1-(3-chloro-4-ethanesulfonylbenzyl)-7-cyano-2-methylindolizin-3-yl}acetic acid, {1-[3-chloro4-(morpholine-4-sulfonyl)benzyl]-7-cyano-2-methylindolizin-3-yl}acetic acid, {1-(3-chloro-4-ethanesulfonylphenylsulfanyl)-7-cyano-2-methylindolizin-3-yl}acetic acid, {1-[3-chloro-4-(morpholine-4-sutfonyl)phenylsutfanyl]-7-cyano-2-methylindolizin-3-yl}acetic acid, {7-cyano-1-(6-fluoroquinolin-2-ylmethyl)-2-methylindolizin-3-yl}acetic acid are ligands of the CRTH2 receptor and are useful in the treatment of respiratory diseases.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20100137301 - Substituted indolealkanoic acids: Disclosed are substituted indolealkanoic acids useful in the treatment of chronic complications arising from diabetes mellitus. Also disclosed are pharmaceutical compositions containing the compounds and methods of treatment employing the compounds, as well as methods for their synthesis.... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20100137302 - Fused thiazole derivatives as kinase inhibitors: A series of 6,7-dihydro[1,3]thiazolo[5,4-c]pyridin-4(5H)-one derivatives, and analogues thereof, which are substituted in the 2-position by an optionally substituted morpholin-4-yl moiety, being selective inhibitors of PI3 kinase enzymes, are accordingly of benefit in medicine, for example in the treatment of inflammatory, autoimmune, cardiovascular, neurodegenerative, metabolic, oncological, nociceptive or ophthalmic conditions.... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20100137303 - New compound 255: Compounds of formula (I) and their pharmaceutically acceptable salts are described. Processes for their preparation, pharmaceutical compositions containing them, their use as medicaments and their use in the treatment of bacterial infections are also described.... Agent: Astrazeneca R&d Boston

20100137305 - Aminopyrimidines useful as kinase inhibitors: The present invention relates to compounds useful as inhibitors of Aurora protein kinases. The invention also provides pharmaceutically acceptable compositions comprising those compounds and methods of using the compounds and compositions in the treatment of various disease, conditions, and disorders. The invention also provides processes for preparing compounds of the... Agent: Vertex Pharmaceuticals Inc.

20100137306 - Heterocyclic trpv1 receptor ligands: and pharmaceutically acceptable derivatives thereof, compositions comprising an effective amount of a compound of formulae I(a)-I(d) or a pharmaceutically acceptable derivative thereof, and methods for treating or preventing a condition such as pain, UI, an ulcer, IBD and IBS, comprising administering to an animal in need thereof an effective amount... Agent: Dechert LLP

20100137304 - Novel crystalline forms of the anti-cancer compound zd1839: which is known inter alia by way of the code number ZD1839. In particular, the invention concerns a first solvate that occurs in the presence of methanol which is designated as Form 2 ZD1839 MeOH solvate, a second solvate that occurs in the presence of dimethyl sulphoxide which is designated... Agent: Astrazeneca R&d Boston

20100137307 - Novel 1,2,3,4,-tetrahydroquinoxaline derivative which has, as substituent, phenyl group having sulfonic acid ester structure or sulfonic acid amide structure introduced terein and has glucocorticoid receptor-binding activity: The compounds represented in general formula (1) or a salt thereof are useful for glucocorticoid receptor modulators. In the formula, R1 represents a lower alkyl group, a lower cycloalkyl group, an aryl group and the like; R2 represents a hydrogen atom, a lower alkyl group and the like; R3 represents... Agent: Frishauf, Holtz, Goodman & Chick, PC

20100137308 - Quinoxaline compounds and use thereof: The present invention is related to quinoxaline compounds of Formula (I) in particular for the treatment of autoimmune disorders and/or inflammatory diseases, cardiovascular diseases, neurodegenerative diseases, bacterial or viral infections, kidney diseases, platelet aggregation, cancer, transplantation, graft rejection or lung injuries.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20100137309 - Fungicides phenyl-pyrimidnyl-amino derivatives: The present invention relates to phenyl-pyrimidinyl-amino derivatives of formula (I) wherein Q1 and p, Ra to Rc, L1, Y, L2 and Q2 represent various substituents, their process of preparation, preparation intermediate compounds, their use as fungicide active agents, particularly in the form of fungicide compositions, and methods for the control... Agent: Ostrolenk Faber Gerb & Soffen

20100137310 - Renin inhibitors: The invention provides compounds, pharmaceutical compositions, kits, method of preparing, and method of using the compounds which exhibit renin and other S9 proteases activities and consist of the formula:—wherein the variables are as defined herein.... Agent: Takeda San Diego, Inc.

20100137311 - Substituted pyrimidine derivatives: e

20100137312 - Novel aromatic heterocyclic carboxylic acid amide derivatives useful as potassium channel modulators: This invention relates to novel aromatic heterocyclic carboxylic acid amide derivatives of formula (I) that are found to be potent modulators of potassium channels and, as such, are valuable candidates for the treatment of diseases or disorders as diverse as those which are responsive to the modulation of potassium channels.... Agent: Birch Stewart Kolasch & Birch

20100137314 - Harmful organism control composition: i

20100137313 - Heterocyclic derivatives and methods of use thereof: Compounds of formula (I) and their pharmaceutically acceptable salts are described. Processes for their preparation, pharmaceutical compositions containing them, their use as medicaments and their use in the treatment of bacterial infections are also described.... Agent: Astrazeneca R&d Boston

20100137315 - Sphingosine kinase inhibitors and methods of their use: The invention relates to compounds, pharmaceutical compositions thereof, and methods for inhibiting sphingosine kinase and for treating or preventing hyperproliferative disease, inflammatory disease, or angiogenic disease.... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20100137316 - Morpholine compounds, pharmaceutically acceptable salts thereof, pharmaceutical compositions, and methods of use thereof: wherein R1, R2, R3, and n have any of the values defined in the specification, and pharmaceutically acceptable salts thereof, that are useful as agents in the treatment of conditions including urinary disorders, pain, premature ejaculation, ADHD and fibromyalgia. Also provided are pharmaceutical compositions comprising one or more compounds of... Agent: Pfizer Inc. Patent Department

20100137317 - 1,2-disubstituted heterocyclic compounds: 1,2-disubstituted heterocyclic compounds which are inhibitors of phosphodiesterase 10 are described. Also described are processes, pharmaceutical compositions, pharmaceutical preparations and pharmaceutical use of the compounds in the treatment of mammals, including human(s) for central nervous system (CNS) disorders and other disorders which may affect CNS function. Among the disorders which... Agent: Fish & Richardson PC

20100137318 - Bicyclic heterocyclic compound: wherein R1 represents a C3-10 branched alkyl group which may be substituted; R2 represents a hydrogen atom or a C1-4 alkyl group which may be substituted; R3 represents a C1-4 alkyl group which may be substituted or a halogen atom; R4 represents a C1-4 alkyl group which may be substituted;... Agent: Sughrue-265550

20100137319 - Pyrrolotriazine compounds useful as kinase inhibitors and methods of treating kinase-associated conditions therewith: The invention relates to at least one pyrrolotriazine derivative, at least one pharmaceutical composition comprising at least one pyrrolotriazine derivative, and at least one method of using at least one pyrrolotriazine derivative to treat at least one kinase associated condition.... Agent: Jones Day

20100137320 - Gamma secretase modulators: e

20100137321 - Imidazo[1,2-a]azines and their use as pharmaceuticals: in which R, R1 to R3, X, Y and n have the meanings indicated in the claims, which modulate the transcription of endothelial nitric oxide (NO) synthase and are valuable pharmacologically active compounds. Specifically, the compounds of formula I upregulate the expression of the enzyme endothelial NO synthase and can... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20100137323 - Benzo-fused compounds for use in treating metabolic disorders:

20100137325 - Biphenyl compounds useful as muscarinic receptor antagonists: wherein a, b, c, d, f, W, Q, Y, R1, R2, and R3 are as defined in the specification. The compounds of formula I are muscarinic receptor antagonists. The invention also provides pharmaceutical compositions containing such compounds, processes and intermediates for preparing such compounds and methods of using such compounds... Agent: Theravance, Inc.

20100137326 - Novel 4-cyano, 4-amino, and 4-aminomethyl derivatives of pyrazolo[1,5-a]pyridines, pyrazolo[1,5-c]pyrimidines and 2h-indazole compounds and 5-cyano, 5-amino, and 5-aminomethyl derivatives of imidazo[1,2-a]pyridines, and imidazo[1,5-a]pyrazines as cyclin d: In its many embodiments, the present invention provides a novel class of 4-cyano, 4-amino, and 4-aminomethyl derivatives of pyrazolo[1,5-a]pyridine, pyrazolo[1,5-c]pyrimidine, and 2H-Indazole compounds and 5-cyano, 5-amino, and 5-aminomethyl derivatives of imidazo[1,2-a]pyridine and imidazo[1,5-a]pyrazine compounds as inhibitors of cyclin dependent kinases, methods of preparing such compounds, pharmaceutical compositions containing one or... Agent: Merck Patent Department (k-6-1, 1990)

20100137322 - Novel n-(8-heteroaryltetrahydronaphtalene-2yl) or n-(5-heteroarylchromane-3-yl) carboxamide derivatives for the treatment of pain: The present invention relates to new compounds of formula (I) and to pharmaceutical composition containing said compounds and to the use of said compounds in therapy. The present invention further relates to processes for the preparation of said compounds and to new intermediates useful in the preparation thereof.... Agent: Astra Zeneca Pharmaceuticals Lp Global Intellectual Property

20100137324 - Rho-kinase inhibitors: Disclosed are compounds and derivatives thereof, their synthesis, and their use as Rho-kinase inhibitors. These compounds of the present invention are useful for inhibiting tumor growth, treating erectile dysfunction, and treating other indications mediated by Rho-kinase, e.g., coronary heart disease.... Agent: Millen, White, Zelano & Branigan, P.C.

20100137327 - Novel semicarbazide and carbonylhydrazide derivatives useful as potassium channel modulators: This invention relates to novel semicarbazide and carbonylhydrazide derivatives that are found to be potent modulators of potassium channels and, as such, they are valuable candidates for the treatment of diseases or disorders as diverse as those which are responsive to modulation of potassium channels.... Agent: Birch Stewart Kolasch & Birch

20100137328 - Tricyclic anilide heterocyclic cgrp receptor antagonists: Compounds of formula I: wherein variables A1, A2, B, m, n, J, R4, G1, G2, G3 and Y are as described herein, which are antagonists of CGRP receptors and which are useful in the treatment or prevention of diseases in which the CGRP is involved, such as migraine. The invention... Agent: Merck

20100137329 - Derivatives of 1-piperazine- and 1-homopiperazine-carboxylates, preparation method thereof and use of same as inhibitors of the faah enzyme: Wherein m, R1 and R2 are as defined herein. The invention also relates to the use of the compound in therapeutics. More specifically, the compounds of the invention are inhibitors of the FAAH enzyme, and therefore, can be used for the treatment of various disorders associated with FAAH enzyme, which... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20100137330 - Use: as a free base or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for the prevention and/or treatment of bone-related disorders, osteoporosis and increasing bone formation, bone mineral density. The present invention further relates to a method of prevention and/or treatment of these disorders.... Agent: Astra Zeneca Pharmaceuticals Lp Global Intellectual Property

20100137331 - Quinolines useful as modulators of ion channels: The present invention relates to compounds useful as inhibitors of ion channels. The invention also provides pharmaceutically acceptable compositions comprising the compounds of the invention and methods of using the compositions in the treatment of various disorders.... Agent: Vertex Pharmaceuticals Inc.

20100137332 - Piperazine modulators of nk-1 receptors: The present invention relates to new piperazine modulators of NK-1 receptors, pharmaceutical compositions thereof, and methods of use thereof.... Agent: Global Patent Group - Apx

20100137333 - Antifungal composition and methods for using: An antifungal composition is provided according to the present invention. The antifungal composition comprises an effective amount of an antifungal component to provide antifungal properties to skin tissue, an effective amount of a skin bonding polymer component to provide a sustained release of the antifungal component over a prolonged period... Agent: Merchant & Gould PC

20100137334 - Piperidine and piperazine derivatives: Compounds of general formula (Ia): in which R1, A1, m, X, n, Y and R3 have any of the meanings given in the specification, have affinity for sigma receptors and are useful in the treatment of disorders of the central nervous system.... Agent: Paul N. King King PLLC

20100137335 - Metabolites of (thio) carbamoyl-cyclohexane derivatives: The present invention relates to metabolites of (thio)carbamoyl cyclohexane derivatives, particularly, metabolites of trans-4-{2-[4-(2,3-dichlorophenyl)-piperazin-1-yl]-ethyl}-N,N-dimemylcarbamoyl-cyclohexylamine and pharmaceutically acceptable salts thereof, to pharmaceutical compositions containing the same and to their use in the treatment and/or prevention of a conditions which requires modulation of dopamine receptors.... Agent: Fish & Richardson P.C.

20100137337 - Co-crystals: The present invention relates to co-crystals of cyprodinil or pyrimethanil and a co-crystal forming compound which has at least one organic acid functional group. In particular, the present invention relates to co-crystals of cyprodinil and benzoic acid, succinic acid, fumaric acid, maleic acid, oxalic acid, pyrazine carboxylic acid, glycolic acid,... Agent: Syngenta Crop Protection , Inc. Patent And Trademark Department

20100137338 - Inhibitors of akt activity: Invented are novel pyrazole compounds, the use of such compounds as inhibitors of protein kinase B activity and in the treatment of cancer and arthritis.... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100137336 - Novel amido derivatives and their use as positive allosteric modulators of metabotropic glutamate receptors: v

20100137339 - Amorphous form of n--n-methyl-acetamide: The present invention relates to an amorphous form of N-{2-Fluoro-5-[3-(thiophene-2-carbonyl)-pyrazolo[1,5-a]pyrimidin-7-yl]-phenyl}-N-methyl-acetamide, methods for its preparation, its use as a therapeutically active agent and pharmaceutical compositions comprising the novel form.... Agent: Birch Stewart Kolasch & Birch

20100137340 - Fused pyrimidinone compounds as mglur ligands: The invention relates to compounds of Formula (I) wherein the substituents are as defined in claim 1; to compositions comprising said compounds and to their use as pharmaceutical agents.... Agent: Novartis Institutes For Biomedical Research, Inc.

20100137341 - Dna polymerase inhibitors composition and methods: A topical composition containing a DNA polymerase inhibitor for removing hair as well as methods of inducing hair loss is described.... Agent: Pearl Cohen Zedek Latzer, LLP

20100137342 - Methods for treating vascular disruption disorders: Disclosed is (4-Methoxy-phenyl)-methyl-(2-methyl-quinazolin-4-yl)-amine hydrochloride effective as a vascular disrupting agent. (4-Methoxy-phenyl)-methyl-(2-methyl-quinazolin-4-yl)-amine hydrochloride is useful in the treatment of a variety of clinical conditions that are responsive to disruption of the vascular system, and in particular to its use in treating vascular macular degeneration.... Agent: Myriad Pharmaceuticals, Inc. C/o Cpa Global

20100137343 - Substituted quinazolines: This invention relates to the discovery of 3- and 5-substituted analogues of the selective platelet lowering agent anagrelide with reduced potential for cardiovascular side-effects which should lead to improved patient compliance and safety in the treatment of myeloproliferative diseases. More specifically, the present invention relates to certain imidazoquinazoline derivatives which... Agent: Darby & Darby P.C.

20100137344 - Induction of analgesia in neuropathic pain: The present invention relates to agents which are capable of inducing analgesia in chronic neuropathic pain, associated methods and uses thereof. In particular, the present invention provides compounds capable of activating the TRPM8 receptor for the treatment of chronic neuropathic pain.... Agent: Hoxie & Associates LLC

20100137345 - Prophylactic and therapeutic use of sirtuin inhibitors in tnf-alpha mediated pathologies: The invention relates to the use of sirtuin inhibitors for reducing TNF-alpha production by cells and organisms. The invention also concerns prophylactic and therapeutic applications of sirtuin inhibitors in TNF-alpha mediated pathologies, such as various inflammatory and autoimmune disorders.... Agent: Knobbe Martens Olson & Bear LLP

20100137346 - Desferrithiocin analogue actinide decorporation agents: A pharmaceutical composition comprising a non-toxic effective amount of an actinide decorporation agent and a pharmaceutically acceptable carrier therefore, the actinide decorporation agent comprising a hexacoordinate desferrithiocin analogue capable of chelating an actinide in vivo and a method for removing an actinide from the tissue of a human or nonhuman... Agent: Wolf Greenfield & Sacks, P.C.

20100137347 - Substituted arylcyclopentenes as therapeutic agents: Disclosed herein is a compound of the formula (I). Therapeutic methods, compositions, and medicaments, related thereto are also disclosed.... Agent: Allergan, Inc.

20100137349 - Antimicrobial oxazolidinone, hydantoin and imidazolidinone compositions: s

20100137348 - Pharmaceutical formulations: salts of 8-[-methyl]-8-phenyl-1,7-diaza-spiro[4.5]decan-2-one and treatment methods using the same: Pharmaceutical formulations containing salts of (5S,8S)-8-[{(1R)-1-(3,5-Bis-(trifluoromethyl)phenyl]-ethoxy}-methyl]-8-phenyl-1,7-diazaspiro[4.5]decan-2-one, represented by Formula I, are disclosed. Disclosed also are methods of treatment utilizing such dosage forms.... Agent: Monte Browder, Esq. Opko Health Inc.

20100137350 - Methods for preparing dehydrocavidine, dehydroapocavidine or their composition, their use and medicinal compositon containing them: A method for preparing dehydrocavidine, dehydroapocavidine and their respective composition is provided. The composition is first prepared by isolating and purifying the quaternary ammonium alkaloid components from the medicinal plant “Yan Huang Lian” (Corydalis saxicola Bunting) through the processes of solvent extraction, water-phase organic extraction, crystallization and recrystallization, and then... Agent: Ipfortune LLC

20100137351 - Imidazoacridinone derivative compounds and methods for their use: m

20100137352 - Pharmaceutical compositions comprising dextromethorphan and quinidine for the treatment of neurological disorders: Pharmaceutical compositions and methods for treating neurological disorders by administering same are provided. The compositions comprise dextromethorphan in combination with quinidine.... Agent: Townsend And Townsend And Crew, LLP

20100137353 - Tricyclic compounds as antibacterials: Tricyclic nitrogen containing compounds and their use as antibacterials.... Agent: Glaxosmithkline Global Patents -us, Uw2220

20100137354 - Derivatives of fluorene, anthracene, xanthene, dibenzosuberone and acridine and uses thereof: Chemical agents, such as disulfonamide derivatives of fluorene, anthracene, xanthene, dibenzosuberone and acridine, and similar heterocyclic ring structures, including salts thereof, that act as anti-cancer and anti-tumor agents, especially where such agents modulate the activity of the Wnt/β-catenin signaling pathway, and serve to reduce β-catenin levels present in cells, such... Agent: Alan J Grant C/o Carella Byrne Bain Gilfillan Cecchi Stewart

20100137356 - Azaindole-indole coupled derivatives, preparation methods and uses thereof: A novel class of azaindole-indole coupled derivatives, their preparation methods, pharmaceutical compositions containing the same and the uses thereof. The common structural feature of these derivatives is that they are coupled by azaindole and indole bi-molecule at different positions, forming extended pi-conjugated systems. Such derivatives inhibited cell growth and proliferation... Agent: Hamre, Schumann, Mueller & Larson, P.C.

20100137355 - Nitrogenous heterocyclic compounds, preparation thereof and use thereof as antibacterial medicaments: n

20100137357 - Compositions and methods for hyperhidrosis: The present disclosure relates, according to some embodiments, to compositions, systems, and methods for ameliorating, preventing, and/or treating (collectively “treating”) hyperhidrosis and/or excessive perspiration (collectively “hyperhidrosis”). For example, a method for treating hyperhidrosis may comprise administering (e.g., topically administering) a composition comprising an anticholinergic compound (e.g., an ipratropium compound) to... Agent: King & Spalding LLP

20100137358 - Solifenacin compositions: Compositions and/or formulations comprising solifenacin or a salt thereof and processes for preparing the same. Certain compositions and formulations contain a stable amorphous form of solifenacin succinate.... Agent: Dr. Reddy''s Laboratories, Inc.

20100137359 - Caspase inhibitors and uses thereof: m

20100137360 - Trpv1 antagonists:

20100137361 - Tetrahydro-quinolinylurea derivatives: The tetrahydro-quinolinylurea derivative of the present invention has vanilloid receptor (VR1) antagonistic activity, and can be used for the prophylaxis and treatment of diseases associated with VR1 activity, in particular for the treatment of urological diseases or disorders, such as detrusor overactivity (overactive bladder), urinary incontinence, neurogenic detrusor overactivity (detrusor... Agent: Barbara A. Shimei Director, Patents & Licensing

20100137364 - 6-aminoisoquinoline compounds: 6-Amino isoquinoline compounds are provided that influence, inhibit or reduce the action of a kinase. Pharmaceutical compositions including therapeutically effective amounts of the 6-aminoisoquinoline compounds and pharmaceutically acceptable carriers are also provided. Various methods using the compounds and/or compositions to affect disease states or conditions such as cancer, obesity and... Agent: Michael Best & Friedrich LLP

20100137362 - Heterocyclic hydrazide compound and pesticidal use of the same: A hydrazide compound represented by the formula (I), an N-oxide thereof or suitable salt thereof: has excellent pesticidal activity.... Agent: Birch Stewart Kolasch & Birch

20100137363 - Substituted indoles and methods of their use: The present invention relates generally to substituted indoles and methods of using them.... Agent: Wyeth LLC Patent Law Group

20100137365 - Long chain n-alkyl compounds and oxa-derivatives thereof: Long chain N-alkyl amino and imino compounds, oxa-substituted derivatives thereof, and pharmaceutical compositions including such compounds are described. The long chain N-alkyl group is a C8-C16 alkyl group. The long chain N-alkyl compounds and oxa-substituted derivatives thereof can be used in the treatment of viral infections, in particular hepatitis B... Agent: Foley And Lardner LLP Suite 500

20100137366 - 4- [2- (4-methylphenylsulfanyl) phenyl] piperidine for the treatment of irritable bowel syndrome (ibs): The use of 4-[2-(4-methylphenylsulfanyl)phenyl]piperidine or a pharmaceutically acceptable salt thereof in the treatment of irritable bowl syndrome.... Agent: Darby & Darby P.C.

20100137367 - Novel crystalline bepotastine metal salt hydrate, method for preparing same, and pharmaceutical composition comprising same: The present invention discloses a non-hygroscopic crystalline bepotastine metal salt hydrate, a method for preparing same, and a pharmaceutical composition comprising same for treating or preventing a histamine-mediated disease or an allergic disease.... Agent: Sughrue Mion, PLLC

20100137368 - Pyridine derivatives as fast dissociating dopamine 2 receptor antagonists: The present invention relates to (1-benzyl-piperidin-4-yl)-(pyridin-2-yl)-amines that are fast dissociating dopamine 2 receptor antagonists, processes for preparing these compounds, pharmaceutical compositions comprising these compounds as an active ingredient. The compounds find utility as medicines for treating or preventing central nervous system disorders, for example schizophrenia, by exerting an antipsychotic effect... Agent: Philip S. Johnson Johnson & Johnson

20100137369 - Flowable pharmaceutical depot: Flowable pharmaceutical depots are described. The flowable pharmaceutical depot includes a polyester, such as a polylactic acid or a poly(trimethylene carbonate) endcapped with a primary alcohol and a pain relieving therapeutic agent, such as a post operative pain relieving therapeutic agent. Method of making and using the same are also... Agent: Medtronic Attn: Noreen Johnson -IPLegal Department

20100137370 - Use of 4 cyclopropylmethoxy-n-(3,5 dichloro-1 oxido-pyridin-4 yl)-5-(methoxy)pyridine-2 carboxamide for the treatment of spinal cord traumas: The present invention relates to the use of 4-cyclopropylmethoxy-N-(3,5-dichloro-1-oxidopyridin-4-yl)-5-(methoxy)pyridine-2-carboxamide, in the form of a hydrate, of a solvate, of a base or of an addition salt with an acid, for the preparation of a medicament for use in the treatment of spinal cord traumas.... Agent: Andrea Q. Ryan Sanofi-aventis U.s. LLC

20100137371 - Novel pharmaceutical compounds: The instant invention provides compounds of Formula (I) which are leukotriene biosynthesis inhibitors. Compounds of formula (I) are useful as anti-asthmatic, anti-allergic, anti-inflammatory, cytoprotective and anti-artherosclerotic agents.... Agent: Merck

20100137372 - Isoxazoline compounds and their use in pest control: An isoxazoline compound represented by the formula (I): wherein the substituents are as defined in the description, has controlling activity against pests.... Agent: Birch Stewart Kolasch & Birch

20100137373 - Pesticidal composition comprising a strigolactone derivative and an insecticide compound:

20100137374 - Solid formulations of carboxamide arthropodicides:

20100137375 - Emulsifiable concentrate:

20100137376 - Amide compound and method for controlling plant disease using the same:

20100137377 - Novel compounds: Novel substituted benzamide based inhibitors, their use in therapy, pharmaceutical compositions comprising the compounds, the use of said compounds in the manufacture of medicaments, and therapeutic methods comprising the administration of said compounds are described. The present compounds modulate the activity of 11β-hydroxysteroid dehydrogenase type 1 (11βHSD1) and are accordingly... Agent: High Point Pharmaceuticals, LLC

20100137378 - Pyridine compounds for the treatment of prostaglandin mediated diseases: Compounds of formula (I) or a pharmaceutically acceptable derivative thereof: wherein X, Y, Z, R2a, R2b, R3a, R3b, R8, R9, and Rx are as defined in the specification, a process for the preparation of such compounds, pharmaceutical compositions comprising such compounds and the use of such compounds in medicine (EP,... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B482

20100137379 - Antimicrobial lubricant compositions: Antimicrobial lubricant compositions are disclosed. The antimicrobial lubricant compositions are particularly useful in providing antimicrobial capability to a wide-range of medical devices. The compositions include an oil lubricant. Representative lubricants may include polydimethyl siloxane, trifluoropropyl copolymer polysiloxane, and a copolymer of dimethylsiloxane and trifluoropropylmethylsiloxane. The compositions include rheology modifiers as... Agent: David W. Highet, Vp & ChiefIPCounsel Becton, Dickinson And Company

20100137380 - Hypoxic conditioning in patients with exercise limiting conditions: Patients having exercise limiting conditions and those at risk of developing such conditions are exposed to a regimen of hypoxic conditions that simulate various altitude conditions. The exposure is of a temporary nature, being from a few hours to most of a day or night in any one day and... Agent: Irving M. Fishman C/o Cohen, Tauber, Spievack & Wagner

20100137381 - Acetamide derivatives as potassium channel modulators: This invention relates to novel acetamide derivatives that are found to be potent modulators of ion channels, in particular potassium channels and chloride channels, and, as such, are valuable candidates for the treatment of diseases or disorders as diverse as those which are responsive to the modulation of potassium channels.... Agent: Birch Stewart Kolasch & Birch

20100137383 - Novel salts and polymorphs of desazadesferrothiocin polyether analogues as metal chelation agents: Disclosed herein are new salts and polymorphs of desazadesferrithiocin polyether (DADFT-PE) analogues, as well as pharmaceutical compositions comprising them and their application as metal chelation agents for the treatment of disease. Methods of chelation of iron and other metals in a human or animal subject are also provided for the... Agent: Global Patent Group - Fkb

20100137382 - Therapeutic formulations of desoxyepothilones: Formulations of desoxyepothilones are stable before and after dilution into aqueous media.... Agent: Fox Rothschild LLP Bristol-myers Squibb

20100137384 - Anthelmintic composition: The invention relates to a novel formulation having the advantage of including triclabendazole in solution. In addition a further anthelmintic may be included. The formulation is made by mixing the abamectin and benzyl alcohol and mixing this with triclabendazole and butyl dioxitol. The mix is then heated to dissolve the... Agent: Judy Jarecki-black Ph.d., J.d.

20100137385 - Insecticidal substituted amino heterocyclic and heteroaryl derivatives: Certain substituted amino heterocyclic and heteroaryl derivatives have provided unexpected insecticidal and acaricidal activity. These compounds are represented by formula (I): wherein R, R1, R2, R3, R4, A, B and Q are fully described herein. In addition, compositions comprising an insecticidally effective amount of at least one compound of formula... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20100137386 - Tnik inhibitor and the use: r

20100137387 - Beta-keto-amide derivatives useful as ion channel modulators: This invention relates to novel β-keto-amide derivatives that are found to be potent modulators of ion channels, and in particular potassium channels and chloride channels, and, as such, are valuable candidates for the treatment of diseases or disorders as diverse as those which are responsive to the modulation of potassium... Agent: Birch Stewart Kolasch & Birch

20100137388 - Therapeutic pro-antibiotic agents and methods of use thereof: The present invention provides for therapies characterized in part by co-administration or combination of antibiotic agents with medicinal compositions comprising as the pro-antibiotic active ingredient either a compound represented by a formula [I] or a pharmaceutically acceptable composite thereof; [wherein X represents oxygen, sulfur, NH, or N-alkyl; R1 and R2... Agent: Ade & Company Inc.

20100137390 - 1,3-dihydroimidazole-2-thione derivatives as inhibitors of dopamine-beta-hydroxylase: Compounds of formula I and a method for their preparation are described, where R1, R2 and R3 are the same or different and signify hydrogens, halogens, alkyl, nitro, amino, alkylcarbonylamino, alkylamino or dialkylamino group; R4 signifies -alkyl-aryl or alkyl heteroaryl; X signifies CH2, oxygen atom or sulphur atom; n is... Agent: Conley Rose, P.C.

20100137389 - Topical formulation: The invention relates to composition and related therapeutic methods including at least one antihyperthyroid drug formulated for transdermal administration. Because the formulation is formulated for transdermal administration, the formulation is easier to administer than existing formulations which are administered orally to animals. Issues surrounding transdermal administration versus oral administration have... Agent: Sheridan Ross PC

20100137391 - Histamine h3 agonist for use as therapeutic agent for a lipid/glucose metabolic disorder: Disclosed are: novel use of an agonist histamine receptor H3 (e.g., Imetit) for prevention of obesity or the reduction of food intake; a method for evaluation of a compound for use as a therapeutic agent targeted to histamine receptor HR protein; and a compound provided by the method.... Agent: Merck

20100137392 - Therapy for the treatment of disease: Disclosed herein are pharmaceutical compositions comprising oxybutynin, or a free base thereof or a pharmaceutically acceptable salt thereof, and pilocarpine, or a free base thereof or a pharmaceutically acceptable salt thereof. Also disclosed are methods of treating a patient suffering from overactive bladder comprising administering to the patient the above... Agent: Techlaw LLP

20100137393 - Prediction and prophylactic treatment of type 1 diabetes: An in vitro method for predicting the onset of type 1 diabetes (T1 D) in a subject, comprises the steps of: (a) measuring the concentration of at least one amino acid, amino acid derivative or amino acid metabolite in a biological sample taken from the subject; (b) determining the subject's... Agent: Castellano PLLC

20100137394 - Pyrazole inhibitors of wnt signaling: The invention provides inhibitors of Wnt signaling that are useful as a therapeutic agents for treating malignancies where the compounds have the general formula I: wherein R1 to R7 and Z are as defined herein.... Agent: Genentech, Inc.

20100137395 - Process for the sulfinylation of a pyrazole derivative: The present invention relates to a process for the sulfinylation of a pyrazole derivative, characterized in that 5-amino-1-[2,6-dichloro-4-(trifluoromethyl)phenyl]-1H-pyrazole-3-carbonitrile (II) is reacted with a sulfinylating agent selected from trifluoromethylsulfinic acid, trifluoromethylsulfinic acid anhydride, and a trifluoromethylsulfinate alkaline or alkaline earth metal salt and mixtures of the acid and/or the salt(s), in... Agent: Brinks, Hofer, Gilson & Lione

20100137396 - Treatment of esophageal high grade dysplasia using photodynamic therapy: A method for treatment of esophageal high grade dysplasia comprising the steps of: injecting HPPH in a physiologically compatible medium into a patient having high grade dysplasia tissue to provide a dose level of 3 through 5 mg/m2 of body surface area, waiting for a time period of 24 through... Agent: Michael L. Dunn

20100137397 - Chemical compounds: A compound of the formula (1) or a pharmaceutically-acceptable salt: possess glycogen phosphorylase inhibitory activity and accordingly have value in the treatment of disease states associated with increased glycogen phosphorylase activity such as 2 diabetes. Processes for the manufacture of compounds and pharmaceutical compositions containing them are described.... Agent: Astrazeneca R&d Boston

20100137399 - Preventive and/or therapeutic agent for urine collection disorder accompanying lower urinary tract obstruction: wherein R represents optionally substituted aliphatic acyl optionally having an unsaturated bond, hydroxyalkyl, aliphatic acyloxyalkyl, lower alkoxy, carboxy, lower alkoxycarbonyl, aryl(lower alkoxy)carbonyl, carbamoyl, (mono- or dialkyl)carbonyl or cyano(lower alkyl), optionally halogenated aromatic acyl, furoyl, or pyridylcarbonyl; R1 represents cyano or carbamoyl; and R2 represents lower alkyl optionally having a halogen... Agent: Sughrue Mion, PLLC

20100137398 - Use of hdac inhibitors for the treatment of gastrointestinal cancers: The present invention relates to the use of an HDAC inhibitor for the preparation of a medicament for the treatment of gastrointestinal cancers; a method of treating a warm-blooded animal, especially a human, having gastrointestinal cancer, comprising administering to said animal a therapeutically effective amount of an HDAC inhibitor, especially... Agent: Novartis Corporate Intellectual Property

20100137401 - 2-methylprop anamides and their use as pharmaceuticals: The present invention relates to inhibitors of 11-β hydroxyl steroid dehydrogenase type 1, antagonists of the mineralocorticoid receptor (MR), and pharmaceutical compositions thereof. The compounds of the invention can be useful in the treatment of various diseases associated with expression or activity of 11-β hydroxyl steroid dehydrogenase type 1 and/or... Agent: Fish & Richardson PC

20100137400 - Pharmaceutical formulation containing an hmg-coa reductase inhibitor and method for the preparation thereof: The present invention relates to improved pharmaceutical formulation for oral administration comprising a therapeutically effective quantity of an HMG-CoA reductase inhibitor, and more particularly Fluvastatin, Atorvastatin or salts thereof in combination with a linear sulphated polysaccharide such as Carrageenan and a method for the preparation thereof.... Agent: Akc Patents

20100137402 - N-[(4,5-diphenyl-2-thienyl)methyl]amine derivatives, their preparation and their therapeutic application: e

20100137403 - Method for enhancing cognition or inhibiting cognitive decline: A method for enhancing cognition or inhibiting cognitive decline in a subject comprises selecting a Ca2+ channel blocker that is effective, when administered intravenously to an animal in a nontoxic amount, to increase NF-κB expression in the brain of the animal; and administering the selected Ca2+ channel blocker to the... Agent: Harness, Dickey, & Pierce, P.l.c

20100137417 - Glucagon receptor antagonists, preparation and therapeutic uses: The present invention discloses novel compounds of Formula (I) or pharmaceutically acceptable salts thereof which have glucagon receptor antagonist or inverse agonist activity, as well as methods of using these compounds and intermediates and methods for preparing such compounds. In another embodiment, the invention discloses pharmaceutical compositions comprising N compounds... Agent: Eli Lilly & Company

20100137418 - Method for treating atherosclerosis or restenosis using microtubule stabilizing agent: The present invention is a method of preventing or reducing atherosclerosis or restenosis, and a pharmaceutical preparation used therefore. In particular, it is a method of preventing or reducing atherosclerosis or restenosis after arterial injury by treatment with a low dose of a microtubule stabilizing agent such as taxol or... Agent: Klarquist Sparkman, LLP

20100137419 - Anti-cancer agent: Disclosed is a novel anti-cancer agent which is less likely to be excreted from a cancer cells and is suitable for the local treatment against a cancer cell. The anti-cancer agent comprises a rotaxane compound represented by chemical formula (I) as an active ingredient. The rotaxane compound is composed of... Agent: Oblon, Spivak, Mcclelland Maier & Neustadt, L.L.P.

20100137420 - Methods and compositions for diagnosis and treatment of multiple sclerosis: Biological markers for multiple sclerosis, and their use in the diagnosis and prognosis of the disease, are described. Also described are methods for treating multiple sclerosis by administering an inhibitor of cathepsin B activity or a neuroprotective composition comprising a modified terpenoid compound. Also described are isolated polypeptide biomarkers, polynucleotides... Agent: Foley Hoag, LLP (w/jhv)

20100137422 - Novel phenanthrenequinone-based compound and pharmaceutical composition containing the same for the treatment or prevention of disease involving metabolic syndrome: Provided is a pharmaceutical composition for the treatment and/or prevention of disease involving metabolic syndromes, comprising (a) a therapeutically effective amount of a particular compound represented by Formula 1 as defined in the specification, or isomer, prodrug, or solvate or thereof, and (b) a pharmaceutically acceptable carrier, a diluent or... Agent: Birch Stewart Kolasch & Birch

20100137421 - Small molecule therapeutics, synthesis of analogues and derivatives and methods of use: Provided herein are compounds that are inducers of apoptosis activators of caspases and pharmaceutically acceptable derivatives thereof. Also provided are methods of synthesis of the compounds and methods for treatment of diseases in which there is uncontrolled cell growth and spread of abnormal cells, such as cancers, by administering the... Agent: Jones Day

20100137423 - Antioxidative composition containing acacia bark derivative: It is intended to provide a composition which is useful in preventing or treating tumor. Namely, a composition for preventing and/or treating tumor which is characterized by containing a component originating in the bark of a tree belonging to the genus Acacia.... Agent: Birch Stewart Kolasch & Birch

20100137425 - Inhibition and treatment of prostate cancer metastasis: The present invention provides compounds and methods of inhibiting and treating metastatic prostate cancer. The compounds include MEK4 inhibitors. In another aspect the invention provides methods of identifying inhibitors of metastatic prostate cancer by screening for inhibitors of MEK4.... Agent: Casimir Jones, S.c.

20100137424 - Pharmaceutical compositions comprising nebivolol or a nebivolol analogue: The disclosed pharmaceutical compositions for oral administration comprising as the active medicinal ingredient nebivolol, a nebivolol analogue or a pharmaceutically acceptable acid addition salt thereof and a wetting agent. The ratio of the wetting agent to the active ingredient is less than 0.025. The application also relates to methods of... Agent: Greenlee Winner And Sullivan P C

20100137426 - Method for generating reference controls for pharmacogenomic testing: Reference controls for use with pharmacogenomic testing, and methods for their identification, preparation, and use, are disclosed. The reference controls can confirm that pharmacogenomic testing correctly identifies individuals that do or do not have the mutation of interest, in both clinical trial and patient treatment settings. The reference controls can... Agent: Intellectual Property / Technology Law

20100137427 - Softgel of nlkj for treating prostate diseases: A softgel of NLKJ for the treatment of prostate diseases, comprising 0.05˜1.0 g of NLKJ and 0.05˜1.5 mg of an antioxidant, said NLKJ having the following physicochemical parameter: acid value<0.56, iodine value 95.0-107.00, saponification value 185.00-195.00, specific gravity 0.914-0.918 (20° C.), and refractive index 1.470-1.475 (20° C.). The inhibition of... Agent: Lei Yu

20100137428 - Oxygen containing heterocycles as glycine transporter inhibiting compounds: s

20100137429 - Composition for transdermal or transmucosal administration: The present invention provides a composition for transdermal or transmucosal administration, which is useful as an anti-Alzheimer's drug, an antiparkinson drug, an antidepressant, a psychoactive drug, or a therapeutic agent for drug dependence. The composition for transdermal or transmucosal administration comprising an effective dose of a racemate or an optically... Agent: Wenderoth, Lind & Ponack, L.L.P.

20100137430 - Treating androgen decline in aging male (adam)-associated conditions with sarms: This invention provides methods for treatment and inhibition of a male subject having an Androgen Decline in Aging Male (ADAM)-associated condition, for example sexual dysfunction, decreased sexual libido, erectile dysfunction, hypogonadism, sarcopenia, osteopenia, osteoporosis, an alteration in cognition and mood, depression, anemia, hair loss, obesity, muscle loss, dry eye, memory... Agent: Pearl Cohen Zedek Latzer, LLP

20100137431 - Use of substances that act as cascade inhibitors of the raf/mek/erk signal cascade, for producing a medicament to treat dna and rna viruses: The invention consists in that substances acting as cascade inhibitors of the Raf/MEK/ERK signaling pathway, in particular MEK inhibitors, are used for the production of a drug for the preventive and antiviral therapy against DNA and RNA viruses, in particular against intranuclear-replicating negative strand RNA viruses, for instance influenza or... Agent: Mark D. Wieczorek

20100137432 - Ophthalmic composition comprising a prostaglandin: The present invention relates to a pharmaceutical composition suitable for ophthalmic use comprising one or more prostaglandin derivatives or salts, a stabilizing amount of polyethylene glycol hydroxystearate and pharmaceutically acceptable vehicle.... Agent: Westerman, Hattori, Daniels & Adrian, LLP

20100137433 - Production of rosmarinic acid from spearmint and uses thereof: The present invention provides plants and plant tissues of spearmint (Mentha spicata) with enhanced rosmarinic acid levels, and extracts derived there from. Methods and compositions for production and use of rosmarinic acid from spearmint as a nutraceutical are also provided. In particular, an edible beverage derived from plant tissues of... Agent: Fulbright & Jaworski L.L.P.

20100137434 - Methods and compositions for administration of 3-halopyruvate and related compounds for the treatment of cancer: The present disclosure relates to the discovery that compounds of the invention, particularly 3-bromopyruvate and related compounds, can be safely administered at concentrations effective for the treatment of cancer when formulated with an acidity of greater than or equal to pH of 2 and less than or equal to a... Agent: Foley Hoag, LLP (w/jhv)

20100137435 - Monoacetyldiacylglycerol derivative for the treatment of sepsis: The uses of mono acetyl diacyl glycerol derivatives extracted from deer antler for immunomodulating agent disclosed. Medical supplies and health foods containing the same as an effective ingredient also disclosed. Mono acetyl diacyl glycerol derivatives shows significantly effect for immuno modulation including immune enhancing. In the case of inducing cancer... Agent: Elmore Patent Law Group, PC

20100137436 - Bipolar trans carotenoid salts and their uses: The invention relates to trans carotenoid salt compounds, methods for making them, methods for solubilizing them and uses thereof. These compounds are useful in improving diffusivity of oxygen between red blood cells and body tissues in mammals including humans.... Agent: Nixon & Vanderhye, PC

20100137437 - composition for inactivating an enveloped virus: The present invention relates generally to the field of prevention of diseases caused by enveloped viruses. More particularly, this invention concerns a composition for inactivating an enveloped virus comprising at least one non phospholipid Lipid Vesicle (nPLV) able to interact with said enveloped virus and an agent that enhances the... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20100137438 - Isovaline for treatment of pain: The invention provides for the use of isovaline or a pharmaceutically acceptable salt thereof for the treatment of Pain in a mammalian subject in some preferred embodiments, the invention provides for the treatment of acute and chronic Pain syndromes where other drug therapies have limited efficacy or unacceptable toxicity in... Agent: Barnes & Thornburg LLP

20100137439 - Use of aminolevulinic acid and derivatives thereof: The invention provides the use of a photosensitiser which is 5-aminolevulinic acid (5-ALA) or a derivative (e.g. an ester) of 5-ALA, or a pharmaceutically acceptable salt thereof, in the manufacture of a composition for use in methods of photodynamic therapy (PDT) on an animal, wherein said PDT comprises: (a) administering... Agent: Kenyon & Kenyon LLP

20100137440 - Lysine riboswitches, structure-based compound design with lysine riboswitches, and methods and compositions for use of and with lysine riboswitches: The lysine riboswitch is a target for antibiotics and other small molecule therapies. Compounds can be used to stimulate, active, inhibit and/or inactivate the lysine riboswitch.... Agent: Patent Correspondence Arnall Golden Gregory LLP

20100137441 - N-acetylcysteine amide (nac amide) for the treatment of diseases and conditions associated with oxidative stress: Methods and compositions comprising N-acetylcysteine amide (NAC amide) and derivatives thereof are used in treatments and therapies for human and non-human mammalian diseases, disorders, conditions and pathologies. Pharmaceutically or physiologically acceptable compositions of NAC amide or derivatives thereof are administered alone, or in combination with other suitable agents, to reduce,... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c

20100137442 - Sustained release particulate oral dosage forms of (r)-baclofen and methods of treatment: Sustained release particulate oral dosage forms of (R)-baclofen prodrugs and methods of treating a disease comprising orally administering such dosage forms are disclosed.... Agent: Dorsey & Whitney, LLP Intellectual Property Department

20100137443 - Ibuprofen for topical administration: Set forth herein is a preparation of ibuprofen (2-(4-isobutylphenyl)propionic acid) in the free acid form that is suitable for topical administration. The topical ibuprofen formulation is prepared by dissolving the free acid form of ibuprofen, or preparing a homogeneous suspension of the free acid form of ibuprofen, in the presence... Agent: Sunstein Kann Murphy & Timbers LLP

20100137444 - Ketone compounds and compositions for cholesterol management and related uses: The present invention relates to novel ketone compounds, compositions comprising ketone compounds, and methods useful for treating and preventing cardiovascular diseases, dyslipidemias, dysproteinemias, and glucose metabolism disorders comprising administering a composition comprising a ketone compound. The compounds, compositions, and methods of the invention are also useful for treating and preventing... Agent: Brinks Hofer Gilson & Lione/ann Arbor

20100137445 - Plant disease control agent, and plant disease control method: wherein X1 represents a fluorine atom or a methoxy group; X2 represents a hydrogen atom, a halogen atom, a C1-C4 alkyl group, a C2-C4 alkenyl group, a C1-C4 haloalkyl group, a C1-C4 alkoxy group, a C1-C4 alkylthio group, a C1-C4 hydroxyalkyl group and so on; Z1 represents an oxygen atom... Agent: Wenderoth, Lind & Ponack, L.L.P.

20100137446 - Naphthalene compounds, a process for their preparation and pharmaceutical compositions containing them: e

20100137447 - Method for the production of adsorbates of a rasagiline salt having a water-soluble adjuvant: The present invention relates to an adsorbate of a pharmaceutically compatible rasagiline salt comprising at least one pharmaceutically compatible adjuvant, wherein the at least one pharmaceutically compatible adjuvant is a water-soluble, organic solvent and the rasagiline salt is present in the adsorbate as an amorphous substance.... Agent: Smith Patent Consulting, LLC

20100137448 - Methods for treating neuropsychiatric disorders with nmda receptor antagonists: The present invention relates to compositions and methods for treating a human patient afflicted with a neuropsychiatric disorder. Specifically, the invention provides for compositions and methods of modulating or antagonizing the activity of neuronal NMDA receptors, wherein such antagonistic activity is capable of modulating the glutamate induced excitatory response of... Agent: Wilson Sonsini Goodrich & Rosati Adamas Pharmaceuticals, Inc.

20100137449 - Substituted 1,3-cyclopentadione multi-target protein kinase modulators of cancer, angiogenesis and the inflammatory pathways associated therewith: Compounds and methods for multi-targeted protein kinase modulation for angiogenesis, cancer treatment or the inflammatory pathways associated with those conditions are disclosed. The compounds and methods disclosed are based on substituted 1,3-cyclopentadione compounds.... Agent: Mcdermott Will & Emery

20100137450 - Process for the preparation of aqueous formaldehyde solutions: Aqueous formaldehyde solutions are prepared and the formaldehyde content of the aqueous formaldehyde solutions produced is determined by an online analytical method. The desired formaldehyde content can subsequently be established by addition of water so that an aqueous formaldehyde solution having a defined formaldehyde content (formalin) is obtained.... Agent: Bayer Material Science LLC

20100137451 - Compositions and methods for treating hoof diseases: The present invention is generally directed to compositions and methods for the treatment of an infectious disease of the foot of an animal. One aspect of the invention is directed to a method for preventing and/or treating one or more infectious diseases of the hoof in animals, comprising: preparing a... Agent: Heslin Rothenberg Farley & Mesiti PC

20100137452 - Aqueous compositions having protected hydrophilic actives: Aqueous compositions comprising hydrophilic actives and block copolymers comprising at least one block of copolymerized ethylene oxide and at least one block of a polymerized alkylene oxide, the alkylene comprising at least 4 carbon atoms, are described, along with methods of stabilizing hydrophilic actives and methods of increasing compatibility among... Agent: The Dow Chemical Company

20100137453 - Polyurea product as thixotropic rheology modifying agent: A thixotropic agent comprising a first polyurea reaction product of a first polyisocyanate with a first amine and a second polyurea reaction product of a second polyisocyanate with a second amine different from the first polyurea reaction product precipitated in the presence of the colloidal particles of the first reaction... Agent: Howrey LLP-hn

20100137454 - Silicone polymer emulsions: Silicone oil-in-water emulsions containing a polysiloxane containing polymer is prepared by first preparing a polysiloxane containing polymer by the polymerisation of siloxane containing monomers and/or oligomers in the presence of an inert organopoly siloxane and/or an organic fluid, a suitable catalyst and optionally an end-blocking agent; and quenching the reaction... Agent: Howard & Howard Attorneys PLLC

20100137455 - N-vinylcaprolactam-based copolymers and the use thereof as solubilizers: Copolymers for use in solubilizing substances which are insoluble in water, substances which are only sparingly soluble in water, and combinations thereof; such copolymers comprising: (a) 60 to 99% by weight of N-vinylcaprolactam; and (b) 1 to 40% by weight of at least one other monomer selected from the group... Agent: Connolly Bove Lodge & Hutz, LLP

20100137456 - Polysaccharides functionalized by tryptophan derivatives: The present invention relates to novel polysaccharide derivatives, predominantly comprising glycosidic bonds of (1,4), (1,3) and/or (1,2) type, functionalized by at least one tryptophan derivative. It also relates to processes for the synthesis thereof, to their uses as pharmaceutical excipient and to the pharmaceutical compositions comprising them.... Agent: Oliff & Berridge, PLC

Previous industry: Perfume compositions
Next industry: Colloid systems and wetting agents; subcombinations thereof; processes of


RSS FEED for 20141002: xml
Integrate FreshPatents.com into your RSS reader/aggregator or website to track weekly updates.
For more info, read this article.


Thank you for viewing Drug, bio-affecting and body treating compositions patents on the FreshPatents.com website. These are patent applications which have been filed in the United States. There are a variety ways to browse Drug, bio-affecting and body treating compositions patent applications on our website including browsing by date, agent, inventor, and industry. If you are interested in receiving occasional emails regarding Drug, bio-affecting and body treating compositions patents we recommend signing up for free keyword monitoring by email.

Results in 5.24403 seconds