FREE patent keyword monitoring and additional FREE benefits. /images/triangleright (1K) REGISTER now for FREE triangleleft (1K)
Fresh Patents freshpatentsnav7_icons (5K)
browse patent apps by agents browse patent apps by inventors browse patent apps by industry browse patents by location monitor patent applications
    




USPTO Class 514  |  Browse by Industry: Previous - Next | All     monitor keywords
07/2007 | Recent  |  08: Feb | Jan |  | 07: Dec  | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan |  | 06: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | 

Drug, bio-affecting and body treating compositions inventions 07/07

Recently published patent applications awaiting approval from the USPTO. Recent week's RSS XML file available below.
Listing format for abstract view: USPTO application #, Title, Abstract excerpt,Patent Agent. Listing format for list view: USPTO National Class full category number, title of the patent application.

  07/26/2007 > patent applications in patent subcategories.

20070173449 - Method of protection from ischemic disease: A therapeutic or prophylactic treatment method of ischemia, such as due to myocardial infarction, by administering thrombopoietin, alone or in combination with other drugs, to a patient suffering from or at risk of cardiac injury, such as myocardial ischemia. The thrombopoietin is administered in a concentration such that the subject's... Agent: Quarles & Brady LLP

20070173484 - Process for the preparation of risedronate sodium hemi-pentahydrate: The present invention relates to an improved process for the selective crystallization of 3-pyridyl-1-hydroxyethylidene-1,1-bisphosphonic acid sodium in pure hemi-pentahydrate form of Formula (I), by first converting 3-pyridyl-1-hydroxyethylidene-1,1-bisphosphonic acid into organic amine salt and then by replacing it with sodium salt.... Agent: Jay R Akhave

20070173434 - Antidiabetic oxazolidinediones and thiazolidinediones: Phenoxyphenyl and phenoxybenzyl oxazolidine-2,4-diones and thiazolidine-2,4-diones of formula (I) are agonists or partial agonists of PPAR gamma and are useful in the treatment and control of hyperglycemia that is symptomatic of type II diabetes, as well as dyslipidemia, hyperlipidemia, hypercholesterolemia, hypertriglyceridemia, and obesity that are often associated with type 2... Agent: Merck And Co., Inc

20070173435 - Stabilized hemoglobin solutions: A hemoglobin solution packaged in a flexible oxygen-impermeable container system. The container system includes a multi-layer film having at least a product contact layer, an oxygen and moisture barrier layer and an exterior layer. The flexible container system further includes an interface port for filling the flexible container with the... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20070173437 - Bisubstrate inhibitors of protein tyrosine kinases as therapeutic agents: A bisubstrate inhibitor of Src kinases, having a nucleotide or N-heteroaromatic moiety; and a peptide/phosphopeptide, peptidomimetic, or phosphopeptide mimic moiety. The moieties are linked by a rigid or a flexible linker. The nucleotide or N-heteroaromatic moiety is ATP, ATP-mimics, N-heteroaromatics including purine-based derivatives, pyrimidine-based derivatives such as 2,4-diamino-5-substituted pyrimidine derivatives,... Agent: Gauthier & Connors, LLP

20070173436 - Compositions and methods for enhancing drug delivery across and into epithelial tissues: This invention provides compositions and methods for enhancing delivery of drugs and other agents across epithelial tissues, including the skin, gastrointestinal tract, pulmonary epithelium, ocular tissues and the like. The compositions and methods are also useful for delivery across endothelial tissues, including the blood brain barrier. The compositions and methods... Agent: Morrison & Foerster LLP

20070173439 - Interleukin-18 binding proteins, their preparation and use: Interleukin-18 binding proteins which are capable of binding IL-18 and of modulating and/or blocking IL-18 activity are provided. Methods for the isolation and recombinant production, DNAs encoding them. DNA vectors expressing them, vectors useful for their expression in humans and other mammals, antibodies against them are also provided. Therapeutic uses... Agent: Ivor R. Elrifi Mintz, Levin, Cohn, Ferris,

20070173438 - [psi[ch2nh]pg4] glycopeptide antibiotic analogs: [ψ[CH2NH]PG4] glycopeptide antibiotic analogs are reengineered forms of glycopeptides that exhibit antimicrobial activity against both wild type and glycopeptide antibiotic resistant strains of microorganisms. For example, [ψ[CH2NH]Tpg4] vancomycin aglycon is a reengineered form of vancomycin that exhibits antimicrobial activity (MIC=31 μg/mL) against both wild type and VanA resistant organism (E.... Agent: The Scripps Research Institute

20070173440 - Methods and pharmaceutical compositions for the treatment and prevention of hepatitis c infection: #

20070173443 - C-terminal p53 palindromic peptide that induces apoptosis of cells with aberrant p53 and uses thereof: Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides... Agent: Cooper & Dunham, LLP

20070173442 - Combination therapy with glatiramer acetate and mitoxantrone for the treatment of multiple schlerosis: The subject invention provides a method of treating a subject afflicted with a form of multiple sclerosis comprising periodically administering to the subject an amount of glatiramer acetate and an amount of mitoxantrone, wherein the amounts when taken together are effective to alleviate a symptom of the form of multiple... Agent: Cooper & Dunham, LLP

20070173441 - Inhibitors of n ethymalemide sensitive factor: Methods and compositions for blocking exocytosis by inhibition of proteins that regulate exocytosis, such as N-ethylmaleimide Sensitive Factor (NSF), are provided. The compositions include multidomain fusion peptides containing a domain that causes the fusion peptide to cross the cellular membrane (e.g. a domain from the TAT protein of HIV) and... Agent: Whitham, Curtis & Christofferson & Cook, P.C.

20070173447 - Method for treating osteoporosis by intranasal delivery of teriparatide with an anti-resorptive agent: A method for treating osteoporosis in a mammal by administering intranasally a therapeutically effective amount of a PTH formulation to the mammal in combination with administration of an anti-resorptive agent. The PTH formulation can contain teriparatide.... Agent: Nastech Pharmaceutical Company Inc

20070173446 - Method of administering porcine b-domainless fviii: The present invention provides a method of administering porcine B-domainless factor VIII (OBI-1) to a patient having factor VIII deficiency to provide more rapid and effective protection against bleeding episodes, compared to formerly available methods, or to provide more effective protection to such patients during non-bleeding periods. This invention is... Agent: Greenlee Winner And Sullivan P C

20070173454 - Methods for slowing senescence and treating and preventiing diseases associated with senescence: The present invention relates to a method for slowing, preventing or delaying senescence or treating or preventing a disease associated with senescence by administering a therapeutically effective amount of at least one physiological agent that decreases or regulates the blood level, production, function or activity of LH or FSH, or... Agent: Covington & Burling, LLP Attn: Patent Docketing

20070173445 - Methods for treating viral infection using il-28 and il-29: IL-28A, IL-28B, IL-29, and certain mutants thereof have been shown to have antiviral activity on a spectrum of viral species. Of particular interest is the antiviral activity demonstrated on viruses that infect liver, such as hepatitis B virus and hepatitis C virus. In addition, IL-28A, IL-28B, IL-29, and mutants thereof... Agent: Zymogenetics, Inc. Intellectual Property Department

20070173453 - Methods of preventing or treating brain ischemia or brain injury: The present invention relates to use of Narp inhibitor in order to promote or enhance recovery from ischemic events, particularly focal ischemia of the central nervous system, as well as for preventing or diminishing chronic degenerative changes.... Agent: Cooper & Dunham LLP

20070173451 - Methods of using soluble heterodimeric cytokine receptor: A soluble receptor that binds to IL-20 having two polypeptide subunits, IL-22R and IL-20RB. The two subunits are preferably linked together. In one embodiment one subunit is fused to the constant region of the light chain of an immunoglobulin, and the other subunit is fused to the constant region of... Agent: Marshall, Gerstein & Borun LLP

20070173444 - Peptides and compounds that bind to the il-5 receptor: Interleukin 5 (IL-5) receptor ligands are described and methods of use thereof claimed.... Agent: Dorsey & Whitney LLP

20070173450 - Process for the synchronization of ovulation for timed breeding without heat detection: A method for synchronizing ovulation in sows and gilts by a single injection of hormones is disclosed. A hormone, gonadotropin releasing hormone (GnRH), luteinizing hormone (LH), follicle stimulating hormone (FSH), human chorionic gonadotropin (hCG), analogues, derivatives, agonists or combinations thereof is administered to an open sow post weaning at a... Agent: Patrea L. Pabst Pabst Patent Group LLP

20070173448 - Solution for removing cataracts via liquefracture: An improved solution for use in the removal of cataractous lenses via liquefracture is described. The liquefracture solution contains a viscosity-enhancing agent to increase the residence time of the solution in the heating chamber of the liquefracture handpiece, thereby increasing the expulsion force of the solution from the handpiece (i.e.,... Agent: Alcon

20070173452 - Use of glp-1 analogs and derivatives administered peripherally in regulation of obesity: This invention relates the use of glucagon-like peptides such as GLP-1, a GLP-1 analog, or a GLP-1 derivative in methods and compositions for reducing body weight.... Agent: Eli Lilly & Company

20070173456 - Preptin fragments and methods of use: Methods for increasing osteoblast proliferation with N-terminal fragments of preptin are provided herein.... Agent: Fish & Richardson PC

20070173455 - Specific antagonists for glucose-dependent insulinotropic polypeptide (gip): In one embodiment, this invention provides an antagonist of glucose-dependent insulinotropic polypeptide (GIP) consisting essentially of a 24 amino acid polypeptide corresponding to positions 7-30 of the sequence of GIP. In another embodiment, this invention provides a method of preventing and treating obesity and non-insulin dependent diabetes mellitus (Type II)... Agent: Edwards Angell Palmer & Dodge LLP

20070173457 - Tau-conotoxin peptides: The invention relates to relatively short peptides (termed τ-conotoxins herein), about 10-25 residues in length, which are naturally available in minute amounts in the venom of the cone snails or analogous to the naturally available peptides, and which preferably include two disulfide bonds.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20070173458 - Neo-tryptophan: The invention provides a novel amino acid, neo-tryptophan, as well as polypeptides containing this novel amino acid such as neurotensin analogs. In addition, the invention provides neo-tryptophan derivatives, serotonin-like neo-tryptophan derivatives, and polypeptides containing such derivatives. The invention also provides methods for making neo-tryptophan, neo-tryptophan derivatives, serotonin-like neo-tryptophan derivatives, and... Agent: Fish & Richardson P.C.

20070173459 - Mixtures and methods for the induction of resistance in plants: Mixtures are described comprising two or more compounds selected from at least two of the following groups: i) salicylic acid and/or its functional analogous products (ESA), ii) promoting compounds (PRO) and iii) modulating compounds (MOD), and their use for stimulating the natural defence systems of plants and for inducing resistance... Agent: James V. Costigan Hedman & Costigan

20070173460 - Compositions comprising lignin and methods of making and using the same: Lignins have a number of bioactivities including the inhibition of cellular proliferation and inhibition of thrombus formation which are applicable for their use in coating for medical devices and pharmaceuticals. As such, a composition comprising lignins and methods for making and using the same are provided herein.... Agent: Leydig Voit & Mayer, Ltd

20070173461 - Glycoside prodrug of 5- aminosalicylic acid: g

20070173462 - Treatment of diseases associated with the use of antibiotics: This invention relates to the treatment or prevention of diseases associated with the use of antibiotics or cancer chemotherapies or antiviral therapies, such as colitis, pseudomembranous colitis, antibiotic associated diarrhea and infections due to C difficile, C. perfringens, Staphylococcus species including methicillin-resistant Staphylococcus aureus (MRSA) or Enterococcus including vancomycin-resistant enterococci... Agent: Cohen, Pontani, Lieberman & Pavane

20070173463 - Method and composition for treating otitis media: A combination of agents for use at the time of placement of tubes in the eardrums is presented specifically to address both the issue of infection and the issue of tube obstruction from blood. Tube placement for chronic fluid behind the eardrum or recurrent ear infections is one of the... Agent: Burns & Levinson LLP

20070173464 - Oral ribavirin pharmaceutical compositions: The invention relates to oral pharmaceutical compositions for the prevention and/or the treatment of viral diseases. This invention also addresses methods of prevention and/or treatment of these viral diseases, using these oral compositions. One of the main problems considered in the present invention is to enhance the efficiency of anti-viral... Agent: Patton Boggs LLP

20070173477 - Beta secretase polypeptides: Disclosed are novel genes encoding beta secretase polypeptides. Also disclosed are methods of making and using the polypeptides.... Agent: Amgen Inc.

20070173474 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP

20070173475 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP

20070173465 - Expression of zeta negative and zeta positive nucleic acids using a dystrophin gene: Disclosed is expression of zeta negative and zeta positive nucleic acids or nucleic acid complexes using a dystrophin gene in a process for providing nucleic acid expression in a striated (skeletal or cardiac) muscle cell for the purpose of providing a change to the endogenous properties of the cell for... Agent: Mirus Corporation

20070173472 - Methods and reagents for the treatment of apoptosis-related disorders: The present invention relates to novel uses and reagents relating to apoptosis-related disorders. In particular, modulation of PI3K class IIα activity is shown to influence apoptosis, and PI3K class IIα is thought to be cellular survival factors. Based on these findings the present invention provides therapeutic methods and pharmaceutical compositions... Agent: Novartis Corporate Intellectual Property

20070173470 - Methods for delivering extracellular target into cells: The invention relates to a method for intracellular delivery of substances, comprising the steps of suspending the substance in aqueous solution and providing sufficient speed to enable the suspended substance to penetrate the cell surface and become incorporated into the cell. This method does not require the accompaniment or aid... Agent: Harness, Dickey & Pierce, P.L.C

20070173466 - Methods of treating inflammatory diseases associated with bone destruction: The present invention relates to methods for treating inflammatory diseases accompanied by bone destruction, comprising the step of administering a viral vector comprising a gene which inhibits signal transduction mediated by fibroblast growth factor-2 (FGF2)-FGF receptor 1-Ras-Raf-MAP kinase to a diseased region. Furthermore, the present invention relates to therapeutic compositions... Agent: Clark & Elbing LLP

20070173476 - Modified polynucleotides for use in rna interference: Methods and compositions for performing RNA interference comprising a wide variety of stabilized siRNAs suitable for use in serum-containing media and for in vivo applications, such as therapeutic applications, are provided. These siRNAs permit effective and efficient applications of RNA interference to applications such as diagnostics and therapeutics through the... Agent: Workman Nydegger (f/k/a Workman Nydegger & Seeley)

20070173469 - Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5' ends: The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides immunomers for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunomers of the invention comprise at least two oligonucleotides linked... Agent: Wayne A. Keown Keown & Associates

20070173471 - Morphogen compositions and methods of use thereof to treat heart disorders: Disclosed are compositions and methods for preventing, treating, or reducing symptoms associated with a myocardial or related disorder such as an infarction. In one embodiment, the method includes administering a therapeutically effective amount of a nucleic acid encoding at least one morphogen; or an effective fragment thereof. Preferred morphogens include... Agent: Edwards Angell Palmer & Dodge LLP

20070173468 - Novel endonuclease of immune cell, process for producing the same and immune adjuvant using the same: The present invention relates to a novel endonuclease enzyme which is secreted from immune cell and recognizes bacterial DNA as foreign agent and processes it to produce about 10 bp single-stranded oligonucleotide including CpG motif which is involved in immune response. Also, the present invention relates to a process for... Agent: Akerman Senterfitt

20070173467 - Rna interference mediated inhibition of cholesteryl ester transfer protein (cetp) gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating cholesteryl ester transfer protein (CETP) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways of CETP gene... Agent: Mcdonnell, Boehnen, Hulbert And Berghoff, LLP

20070173473 - Rna interference mediated inhibition of proprotein convertase subtilisin kexin 9 (pcsk9) gene expression using short interfering nucleic acid (sina): The present invention relates to compounds, compositions, and methods for the study, diagnosis, and treatment of traits, diseases and conditions that respond to the modulation of Proprotein Convertase Subtilisin Kexin 9 (PCSK9) gene expression and/or activity. The present invention is also directed to compounds, compositions, and methods relating to traits,... Agent: Mcdonnell, Boehnen, Hulbert And Berghoff, LLP

20070173478 - Compositions for the enhanced treatment of depression: For treatment of endogenous depression, there is taken in combination an antidepressant, particularly an SSRI or SNRA, and a precursor or inducer of a neurotransmitter, e.g. L-phenylalanine, tyramine or L-tryptophan. Optionally, the patient also takes vitamin B12.... Agent: Stites & Harbison PLLC

20070173480 - Formulations for mediating inflammatory bowel disorders: The invention provides formulations and methods for mediating inflammation, in particular an inflammatory bowel disorder such as necrotizing enterocolitis, and for. Further, the formulations are effective in lowering blood cholesterol and decreasing blood cholesterol absorption. The formulations comprise at least one ganglioside, which may be selected from the group consisting... Agent: Borden Ladner Gervais LLP

20070173479 - Methods using sulodexide for the treatment of bladder disease: The present invention concerns methods for the treatment of bladder related diseases and, in particular, inflammatory bladder diseases such as interstitial cystitis, by administration of sulodexide.... Agent: Jones Day

20070173481 - Compositions and methods for preventing infection: This invention relates to cholesterol-sequestering agents and methods of using cholesterol-sequestering agents to prevent infection. The compositions of the invention can be used to reduce or prevent maternal to fetal transmission of a microorganism and/or to reduce or eliminate a microorganism present in a blood sample or a blood product.... Agent: Lisa A. Haile, J.d., Ph.d. Dla Piper US LLP

20070173482 - Agents for preventing and treating disorders involving modulation of the ryr receptors: and salts, hydrates, solvates, complexes, and prodrugs thereof. The present invention further provides methods for synthesizing compounds of Formula I. The invention additionally provides pharmaceutical compositions comprising the compounds of Formula I and methods of using the pharmaceutical compositions of Formula I to treat and prevent disorders and diseases associated... Agent: Wilmerhale/columbia University

20070173483 - Pyrrolopyrimidines and related analogs as hsp90-inhibitors: Pyrrolopyrimidines and related analogs are described and demonstrated to have utility as Heat Shock Protein 90 (HSP90) inhibiting agents used in the treatment and prevention of various HSP90 mediated disorders, e.g., proliferative disorders. Methods of synthesis and use of such compounds are also described and claimed.... Agent: Wilson Sonsini Goodrich & Rosati

20070173485 - Platinum complexes with mononitrile-containing ligands: Disclosed herein are novel platinum-based complexes possessing one nitrile substituent group (mononitrile) covalently-bonded to the platinum, one or more nitrogen donor ligands capable of forming hydrogen bonds with the bases in DNA or RNA and leaving groups (i.e., L1 and L2 )which can be hydrolyzed iii vivo to active species,... Agent: Scott A.whitaker, Ph.d., J.d. Sr. Intellectual Property Counsel

20070173486 - Azetidinecarboxamide derivatives and their use in the treatment of cb1 receptor mediated disordrs: Compounds of formula (I) and their use in therapy, particularly for the treatment of a disorder mediated by CB1 receptors, such as obesity, wherein: R1 is aryl or heteroaryl; R2 is alkyl, aryl or heteroaryl; R3 is alkyl, aryl, heteroaryl, NR9R10, OR15, or NR16C(O)R17; Y is C═O, C═S, SO2, or... Agent: Banner & Witcoff, Ltd.

20070173487 - S1p receptor modulating compounds and use thereof: The present invention relates to compounds of the general formula (I) that have activity as S1P receptor modulating agents and the use of such compounds to treat diseases associated with inappropriate S1P receptor activity. The compounds may be used as immunomodulators, e.g., for treating or preventing diseases such as autoimmune... Agent: Goodwin Procter LLP Patent Administrator

20070173489 - Inhibitors of the gpib-vwf interaction, their preparation and use: in which R1, R2, A, B, D, E, n, m or o have the meanings indicated below. The compounds of the formula I are valuable pharmacologically active compounds. They are reversible inhibitors of the interaction between the plasma protein von Willebrand factor (vWF) and the blood platelet receptor glycoprotein Ib-IX-V... Agent: Clark & Elbing LLP

20070173488 - Pyrazolothiazole protein kinase modulators: The present invention provides pyrazolothiazole kinase modulators, methods of treating certain disease states, such as cancer, and pharmaceutical composition thereof.... Agent: Townsend And Townsend And Crew, LLP

20070173490 - Inhibitors of the gpib-vwf interaction, their preparation and use: The present invention relates to novel solid forms of (4R)-1-[4-(2-chloro-5-fluorobenzoyl)amino-3-methoxybenzoyl]-1,2,3,5-tetrahydro-spiro[4H-1-benzazepine-4,1′-[2]cyclopentene]-3′-carboxylic acid (formula (I)) useful for treating and/or preventing conditions such as diabetic nephropathy, renal disease, renal failure and congestive heart failure.... Agent: Philip S. Johnson Johnson & Johnson

20070173491 - Substituted lactams as inhibitors of abeta protein production: having drug and bio-affecting properties, their pharmaceutical compositions and methods of use. These novel compounds inhibit the processing of amyloid precursor protein and, more specifically, inhibit the production of Aβ-peptide, thereby acting to prevent the formation of neurological deposits of amyloid protein. More particularly, the present invention relates to the... Agent: Kelley Drye & Warren LLP

20070173492 - 1,2-diaza-dibenzo[e,h]azulenes for the treatment of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of 1,2-diaza-dibenzo[e,h]azulenes and of their pharmacologically acceptable salts and solvates for the use in the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the neurochemical equilibrium of biogenic... Agent: Darby & Darby P.C.

20070173493 - 1-oxadibenzo[e,h]azulenes for the treatment of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of 1-oxadibenzo[e,h]azulenes and of their pharmacologically acceptable salts and solvates in pharmaceutical formulation for the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the neurochemical equilibrium of biogenic... Agent: Darby & Darby P.C.

20070173495 - Heterocycles as nicotinic acid receptor agonists for the treatment of dyslipidemia: e

20070173494 - Diaza heterocyclic sulfonamide derivatives and their uses:

20070173496 - Novel polymorph e of olanzapine and preparation of anhydrous non-solvated crystalline polymorphic form i of 2-methyl-4(4-methyl-1-piperazinyl)-10h-thieno[2,3-b][1,5] benzodiazepine (olanzapine form i) from the polymorphic olanzapine form e: The invention provides an Olanzapine pseudopolymoph Form E. The invention provides methods of preparing polymorphic Olanzapine Form E employing rapid crystallization and seeding. The invention provides methods of preparing anhydrous Olanzapine Form I from the Olanzapine Form E by step-wise drying.... Agent: Novartis Corporate Intellectual Property

20070173497 - 11-hydroxy-5h-pyrrolo[2,1-c][1,4] benzodiazepin-5-one derivatives as key intermediates for the preparation of c2 substituted pyrrolobenzodiazepines: The present inventors have developed a key intermediate for the production of C2 substituted PBDs, which has a leaving group at the C2 position, a carbamate protecting group at the N10 position and a protected hydroxy group at the C11 position. In a first aspect, the present invention comprises a... Agent: Michael Best & Friedrich, LLP

20070173498 - Melanin concentrating hormone antagonist: R1 and R2 are independently hydrogen atom or a hydrocarbon group which may have substituents; R1 and R2, together with the adjacent nitrogen atom, may form a nitrogen-containing hetero ring which may have substituents; R2 may form a spiro ring together with Ar; or R2, together with the adjacent nitrogen... Agent: Edwards Angell Palmer & Dodge LLP

20070173500 - Substituted 3-(5-membered unsaturated heterocyclyl-1, 3-dihydro-indol-2-one's and derivatives thereof as kinase inhibitors: The present invention relates to organic molecules capable of modulating tyrosine kinase signal transduction in order to regulate, modulate and/or inhibit abnormal cell proliferation.... Agent: Allergan, Inc.

20070173499 - Use of benzonaphthoazulenes for the manufacture of pharmaceutical formulations for the treatment and prevention of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of benzonaphthoazulenes and of their pharmaceutically acceptable salts and solvates for the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the neurochemical equilibrium of biogenic amines or other... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475

20070173501 - Substituted 3-(5-membered unsaturated heterocyclyl-1, 3-dihydro-indol-2-one's and derivatives thereof as kinase inhibitors: The present invention relates to organic molecules capable of modulating tyrosine kinase signal transduction in order to regulate, modulate and/or inhibit abnormal cell proliferation.... Agent: Allergan, Inc.

20070173502 - Novel urea derivatives, method for preparing same, use thereof as medicines, pharmaceutical compositions and novel use:  radical. In which the two nitrogen atoms are linear or form a cyclic radical, X represents carbonyl, alkylene or alkenylene, linear or branched, containing at most 6 carbon atoms optionally interrupted by oxygen or sulphur, R4, R5 and R6 represent hydrogen, a protective group of the nitrogen, alkyl, cycloalkyl, aryl... Agent: Amgen Inc.

20070173504 - Calcium channel antagonists: The present invention provides novel calcium channel antagonists, and methods of treating disease sates using the novel antagonists.... Agent: Townsend And Townsend And Crew, LLP

20070173503 - Novel 4-benzimidazol-2-ylpyridazin-3-one derivatives: e

20070173505 - A2a adenosine receptor antagonists: The invention is based on the discovery that compounds of formula (I) possess unexpectedly high affinity for the A2a adenosine receptor, and can be useful as antagonists thereof for preventing and/or treating numerous diseases, including Parkinson's disease. In one embodiment, the invention features a compound of formula (I).... Agent: Biogen Idec Inc Patent And Trademark Coordinator

20070173506 - Thiazole compounds and methods of use: e

20070173507 - Dairyl-substituted five-membered heterocycle derivative: wherein X5 represents sulfur atoms and the like, A1 represents carbon atoms and the like, A2 represents nitrogen atoms and the like and A ring represents phenyl group and the like, having mGluR1 inhibiting effect, and being usefull for preventing or treating convulsion, acute pain, inflammatory pain, chronic pain, brain... Agent: Merck And Co., Inc

20070173508 - Tricyclic inhibitors of 5-lipoxygenase: Described herein are compounds and pharmaceutical compositions containing such compounds, which inhibit the activity of 5-lipoxygenase (5-LO). Also described herein are methods of using such 5-LO inhibitors, alone and in combination with other compounds, for treating respiratory, cardiovascular, and other leukotriene-dependent or leukotriene mediated conditions, diseases, or disorders.... Agent: Wilson Sonsini Goodrich & Rosati

20070173509 - Imidazole compounds: Imidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor expression, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson

20070173510 - Imidazole compounds: Imidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor expression, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson

20070173512 - Imidazole compounds: Imidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor expression, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson

20070173513 - Imidazole compounds: Imidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor expression, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson

20070173511 - Cyclohexyl sulfonamide derivatives: i

20070173514 - Methods for suppressing an immune response or treating a proliferative disorder:

20070173515 - Delta opioid receptor agonist compounds: Compositions and methods for treatment of sexual dysfunctions by administering to a subject a pharmaceutical composition comprising a delta opioid receptor agonist in an amount effective to delay the onset of ejaculation in the subject during sexual stimulation.... Agent: Marianne Fuierer Moore & Van Allen PLLC

20070173516 - Pyrazine kinase inhibitors: The present invention relates to compounds useful as inhibitors of protein kinases. The invention also provides pharmaceutically acceptable compositions comprising those compounds and methods of using the compounds and compositions in the treatment of various disease, conditions, and disorders. The invention also provides processes for preparing compounds of the inventions.... Agent: Vertex Pharmaceuticals Inc.

20070173517 - Synthesis of 6,7-dihydro-5h-imidazo[1,2-a]imidazole-3-sulfonic acid amides: e

20070173518 - Cristalline and amorphous form of a triazolo (4,5-d) pyridimine compound: The invention provides new forms of a chemical compound of formula (I). The invention relates to forms of a chemical compound (I), in particular to crystalline and amorphous forms, more particularly four crystalline forms and an amorphous form. The invention further relates to processes for the preparation of such forms,... Agent: Nixon & Vanderhye, PC

20070173519 - Pyrazolopyrimidine derivatives or pharmaceutically acceptable salts thereof: A pyrazolopyrimidine derivative represented by formula (1) and pharmaceutically acceptable salt thereof exhibit excellent inhibitory activity against MAPKAP-K2. Accordingly, medicines containing this compound as an active ingredient are expected to be effective for treating diseases mediated by MAPKAP-K2 such as, for example, inflammatory disorder, autoimmune diseases, destructive osteopathy, cancer and/or... Agent: Sughrue Mion, PLLC

20070173521 - Beta-secretase modulators and methods of use: wherein R1, W, B, R3, R4, R5, i and j are defined herein. The invention also comprises pharmaceutical compositions including one or more compounds of Formula I, methods of use for these compounds, including treatment of AD and related diseases, by administering the compound(s) of Formula I, or compositions including... Agent: Amgen Inc.

20070173520 - Crystalline forms of a pyridinyl-sulfonamide and their use as endothelin receptor antagonists: Crystalline forms A and B of 5-methyl-pyridine-2-sulfonic acid [6-methoxy-5-(2-methoxy-phenoxy)-2-pyridin-4-yl-pyrimidin-4-yl]-amide of formula (I) are described, whereby form B is the most stable form. 5-methyl-pyridine-2-sulfonic acid [6-methoxy-5-(2-methoxy-phenoxy)-2-pyridin-4-yl-pyrimidin-4-yl]-amide also forms solvates with, for example, ethanol, acetone, tetrahydrofuran, methanol, isopropanol, 2-butanone and dichloromethane.... Agent: Wenderoth, Lind & Ponack, L.L.P.

20070173522 - 4-(2-phenylsulfanyl-phenyl)-1,2,3,6- tetrahydropyridine derivatives as serotonin reuptake inhibitors: The invention provides compounds represented by the general formula (I) wherein the substituents are defined in the application. The compounds are useful in the treatment of an affective disorder, including depression, anxiety disorders including general anxiety disorder and panic disorder and obsessive compulsive disorder.... Agent: Darby & Darby P.C.

20070173523 - Process for the preparation of 17-n-substituted-carbamoyl-4-aza-androst-1-en-3-ones: The present invention relates to a process for producing 17-N-substituted-carbamoyl-4-aza-androst-1-en-3-ones of formula 1, including Finasteride and Dutasteride.... Agent: Ivor M. Hughes, Barrister & Solicitor, Patent & Trademark Agents

20070173524 - \"novel ido inhibitors and methods of use: Compounds, compositions and methods for the treatment of malignancy are disclosed.... Agent: Dann, Dorfman, Herrell & Skillman

20070173525 - Tyrosine kinase inhibitors: The present invention relates to compounds that are capable of inhibiting, modulating and/or regulating signal transduction of both receptor-type and non-receptor type tyrosine kinases. The compounds of the instant invention possess a core structure that comprises a benzazocine moiety. The present invention is also related to the pharmaceutically acceptable salts,... Agent: Merck And Co., Inc

20070173526 - Compounds and methods for treating dyslipidemia: The present invention discloses compounds of formula (I) wherein A, n, q, K, W, X, Y; Z, R1, R2, R3, R4, R5, and R6 are as defined herein and their pharmaceutical compositions and methods of use are disclosed as useful for treating dyslipidemia and its sequelae.... Agent: Eli Lilly & Company

20070173527 - Histone deacetylase inhibitors: e

20070173528 - Process for preparing solifenacin: Provided are new intermediates of solifenacin and methods for their preparation, as well as methods of preparing solifenacin and solifenacin succinate.... Agent: Kenyon & Kenyon LLP

20070173530 - 6-aminoisoquinoline compounds: 6-Amino isoquinoline compounds are provided that influence, inhibit or reduce the action of a kinase. Pharmaceutical compositions including therapeutically effective amounts of the 6-aminoisoquinoline compounds and pharmaceutically acceptable carriers are also provided. Various methods using the compounds and/or compositions to affect disease states or conditions such as cancer, obesity and... Agent: Michael Best & Friedrich, LLP

20070173529 - Sulfated bis-cyclic agents: Sulfated bis-cyclic compounds that are potent anticoagulants and methods for their manufacture are provided. The sulfated compounds are bis-cyclic moieties comprised of an isoquinoline ring joined to a phenyl ring with the general chemical structure formula (I) where R2 is hydrogen or a sulfate moiety, R3 is either hydrogen or... Agent: Whitham, Curtis & Christofferson & Cook, P.C.

20070173531 - Compound: l

20070173532 - New piperidine antibiotics:

20070173533 - Substituted 3-phenylpiperidine compounds, their preparation and use:

20070173534 - Pyridinic sulfonamide derivatives method of production and use thereof: New pyridinic sulfonamide derivatives represented by a general formula (I), wherein R1 represents a mono- or polyhalogenated C1-12-alkyl or a mono- or polyhalogenated C3-8-cycloalkyl group. The method of production of such derivatives and their use as active therapeutic substance in the treatment of diseases such as inflammation, arthrosis, cancer, angiogenesis... Agent: Jacobson Holman PLLC

20070173535 - Oxadiazoles having antiproliferative activity: Oxadiazole derivatives of general formula (1) in which X, Y, R and R2 have the meanings defined in the disclosure. The compounds have antiproliferative activity against a number of human tumors cell lines and can therefore be used for the preparation of antitumor medicaments.... Agent: Young & Thompson

20070173536 - Crystalline forms of zolmitriptan: The present invention is directed to a novel crystalline form of Zolmitriptan, herein designated as Form A, and several novel solvates of Zolmitriptan, herein designated as Form B, C, D, E, F, and G, processes for the preparation thereof and pharmaceutical compositions comprising these crystalline forms.... Agent: Ciba Specialty Chemicals Corporation Patent Department

20070173537 - Indazole compound and pharmaceutical use thereof: The present invention can provide a cancer treatment drug containing, as an active ingredient, a substance selected from the group consisting of an indazole compound of the following formula (I), a pharmaceutically acceptable salt, a hydrate, a water adduct and a solvate:... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070173538 - Pharmaceutical formulation for delivery of receptor tyrosine kinase inhibiting (rtki) compounds to the eye: The present invention relates to development of efficacious pharmaceutical compositions comprising a poorly water soluble active compound in a therapeutically effective amount and a co-solvent in a suitable amount to treat or prevent diseases due to ocular neovascularization and enhanced vascular permeability. In preferred aspects the composition is in the... Agent: Alcon

20070173539 - Use of malonomicin and analogs in fungicidal applications: The present invention is related to the use of malonomicin compounds and derivatives in fungicidal applications and to new derivatives of malonomicin.... Agent: Dow Agrosciences LLC

20070173540 - Dnt-benzenesulfonate and methods of preparation thereof: (S)—N,N-Dimethyl-3-(1-naphthalenyloxy)-3-(2-thienyl)propanamine benzenesulfonate (DNT-benzenesulfonate) and polymorphs of DNT-benzenesulfonate, compositions of DNT-benzenesulfonate and its polymorphs, processes for the preparation of DNT-benzenesulfonate and its polymorphs, and processes for the preparation of duloxetine hydrochloride from DNT-benzenesulfonate are provided.... Agent: Kenyon & Kenyon LLP

20070173541 - Dnt-succinate and methods of preparation thereof: (S)-N,N-Dimethyl-3-(1-naphthalenyloxy)-3-(2-thienyl)propanamine succinate (DNT-succinate) and polymorphs of DNT-succinate, compositions of DNT-succinate and its polymorphs, processes for the preparation of DNT-succinate and its polymorphs, and processes for the preparation of duloxetine hydrochloride from DNT-succinate are provided.... Agent: Kenyon & Kenyon LLP

20070173542 - Peptide deformylase inhibitors: Novel PDF inhibitors and novel methods for their use are provided.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20070173543 - Synthesis of polycyclic procyanidins: A method for preparing A-type procyanidins is provided by reacting flavylium salts with catechins and analogs thereof, under anhydrous conditions in alcohol.... Agent: Schwegman, Lundberg, Woessner & Kluth, P.A.

20070173545 - Activation of hypoxia-inducible gene expression: The present invention relates to the elucidation of specific molecular features of endogenous 2-oxoacid molecules and their derivatives for activating hypoxia-inducible gene expression by inactivating hypoxia-inducible factor hydroxylating enzymes. This invention identifies agents that can be used to induce tissue vascularization, treat anemias, induce tolearance to stroke and heart attacks,... Agent: Morgan Lewis & Bockius LLP

20070173544 - Compounds for the treatment of metabolic disorders: Agents useful for the treatment of various metabolic disorders, such as insulin resistance syndrome, diabetes, hyper-lipidemia, fatty liver disease, cachexia, obesity, atherosclerosis and arteriosclerosis are disclosed. Formula (I) wherein n is 1 or 2; m is 0 to 4; q is 0 or 1; t is 0 or 1; R2... Agent: Lewis J. Kreisler

20070173546 - Selective androgen receptor modulators and method of use thereof: This invention provides SARM compounds and uses thereof in treating a variety of diseases or conditions in a subject, including, inter-alia, a muscle wasting disease and/or disorder or a bone-related disease and/or disorder.... Agent: Pearl Cohen Zedek Latzer, LLP

20070173547 - Method for producing dry powders of one or several carotenoids: The invention relates to a method for producing dry powders of one or several carotenoids, said method being characterised in that a) one or several carotenoids are suspended in an aqueous molecularly dispersed or colloidally dispersed solution of a mixture consisting of trehalose and at least one protein-containing protective colloid... Agent: Connolly Bove Lodge & Hutz, LLP

20070173548 - Malonamic acids and derivatives thereof as thyroid receptor ligands: The present invention relates to novel thyroid receptor ligands and, more particularly, relates to malonamic acids and derivatives thereof of Formula I, which are useful in the treatment of obesity, overweight condition, hyperlipidemia, glaucoma, cardiac arrhythmias, skin disorders, thyroid disease, hypothyroidism, thyroid cancer and related disorders and diseases such as... Agent: Warner-lambert Company

  
07/19/2007 > patent applications in patent subcategories.

20070167362 - Medicines containing nerve growth factor for assisting losing weight and methods for assisting losing weight using same: A medicine for assisting losing weight contains nerve growth factor. Further, a method for assisting losing weight includes administering an effective amount of this medicine for assisting losing weight to a subject in need thereof.... Agent: Sughrue Mion, PLLC

20070167399 - Therapeutic drug for traumatic neural disease (disorder) and/or motor function disorder: The object is to provide a therapeutic drug for traumatic neural disease (disorder) and/or motor function disorder, more particularly, a therapeutic drug for traumatic neural disease (disorder) and/or motor function disorder derived from spinal cord injury. A keratan sulfate oligosaccharide or a derivative thereof was found to have an effect... Agent: Tarolli, Sundheim, Covell & Tummino L.L.P.

20070167349 - Estrogen cancer therapy: Disclosed are methods for selecting a treatment for, and then treating various types of cancers in males and females, comprising delivery of an anti-cancer drug conjugated to a poly (amino acid) polymer, optionally in combination with estrogen therapy.... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20070167351 - Peptide/lipid complex formation by co-lyphilization: The invention relates to the formation of peptide/lipid vesicles and complexes through the co-lyophilization of peptides, preferably that are able to adopt an amphipathic alphahelical conformation, and one or more lipids. A single solution which solubilizes both the peptides and lipids or two separate solutions may be lyophilized.... Agent: Warner-lambert Company

20070167350 - Quinaldine based semisquaraines and squaraine dyes, process for preparation thereof and use thereof: The present invention provides quinaldine-based semisquaraines, symmetrical and unsymmetrical squaraine dyes represented by the general formulae 1, 2 and 3 and/or pharmaceutically acceptable derivatives thereof as sensitizers for photodynamic therapeutical and industrial applications. These symmetrical and unsymmetrical squaraine dyes posses absorption which extends well into the photodynamic window (650-800 nm)... Agent: Nixon & Vanderhye, PC

20070167352 - Methods and compositions for oxygen transport comprising a method for making a high oxygen affinity modified hemoglobin: The present invention relates to blood products, and more particularly to compositions comprising a modified oxygenated hemoglobin having a high affinity for oxygen and methods for making such compositions. Such compositions according to the present invention have better stability to autooxidation and superior oxygen carrying characteristics.... Agent: Gordon & Rees LLP

20070167353 - Prodrug composition: A prodrug composition is provided which includes a pharmaceutical species and an amino acid having a covalent bond to the pharmaceutical species. A particular pharmaceutical species is adenosine arabinoside, also known as Ara A and by the trade name vidarabine. Ara A prodrugs of the present invention have increased bioavailability... Agent: Gifford, Krass, Sprinkle,anderson & Citkowski, P.c

20070167355 - Dietary and pharmaceutical compositions for management and treatment of oxidative stress: Inhibition of TNF alpha prooxidant action is achieved after administration of biodegradable N-Acetyl-glucosamine-N-acetyl-muramyl-peptides released after specific endopeptidase and lysozyme digestion of the genus Lactobacillus and Bifidum. This invention also provides a medical food for dietary management of all conditions with elevated Gamma Glutamyl Transferase activity and concurrent alterations of NF-κB... Agent: Vladimir Slesarev

20070167356 - Glycosulfopeptide inhibitors of leukocyte rolling and methods of use thereof: Compounds, compositions and methods for treating conditions characterized by leukocyte rolling are described. The compounds contain glycosulfopeptide structures comprising sulfated tyrosines and sialyated, fucosylated N-acetyllactosamino glycans. The glycosulfopeptides may be conjugated or complexed to other compounds for enhancing serum half-life or for controlled release, for example. Examples of conditions treated... Agent: Dunlap, Codding & Rogers P.C.

20070167354 - Hydrogels for modulating cell migration and matrix deposition: A biodegradable matrix for inducing cell migration therein, wherein two peptides are covalently linked to the matrix, a first peptide being cleavable by natural proteases and the other comprising a cell-attracting peptide. The first peptide is cleavable by tissue metalloproteinases. The second peptide contains the cell-attracting peptide RGD. Also disclosed... Agent: Needle & Rosenberg, P.C.

20070167357 - Dab9 derivatives of lipopeptide antibiotics and methods of making and using the same: The present invention provides Dab9 derivatives of amphomycin-type lipopepetide antibiotics that display antimicrobial activity against Gram-positive bacteria, methods and intermediates for synthesizing the compounds and methods of using the compounds in a variety of contexts, including in the treatment and prevention of infections.... Agent: Darby & Darby P.C.

20070167358 - Prevention and treatment of ocular side effects with a cyclosporin: Therapeutic methods are disclosed herein.... Agent: Allergan, Inc.

20070167373 - Combined use of a glp-1 compound and a modulator of diabetic late complications: Methods and uses for treatment of diabetic late complications comprising administration of a GLP-1 compound and a modulator of diabetic complications.... Agent: Novo Nordisk, Inc. Patent Department

20070167364 - Compositions and methods for enhanced mucosal delivery of parathyroid hormone: Pharmaceutical compositions and methods are described comprising at least a parathyroid hormone peptide (PTH) preferably PTH1-34 and one or more mucosal delivery-enhancing agents for enhanced nasal mucosal delivery of PTH, for treating or preventing osteoporosis or osteopenia in a mammalian subject, preferably a human.... Agent: Nastech Pharmaceutical Company Inc

20070167365 - Compositions and methods for modulating blood-brain barrier transport: This invention provides conjugates of therapeutic or active agents with melanotransferrin or with other ligands of a melanotransferrin receptor, melanotransferrin receptor modulators, and related compositions and methods for modulating blood-brain barrier transport by, providing methods of screening and selecting such conjugates, ligands, and modulators in vitro and in vivo, and... Agent: Marshall, Gerstein & Borun LLP

20070167368 - Dried blood factor composition comprising trehalose: A method for preparing a stable dried composition of blood factor product containing a stabilizing amount of trehalose in the absence of a stabilizing amount of albumin is disclosed.... Agent: Morrison & Foerster LLP

20070167367 - Heterodimeric four helix bundle cytokines: Heterodimeric proteins comprising two helical bundle cytokines are disclosed. One of the polypeptides comprises zsig81 and a second polypeptide which comprises either p19 (aka IL-12A) or p35 (aka IL-12A). The proteins may be produced as fusion proteins or expressed as a single chain. The heterdimeric protein comprising zsig81 and p19... Agent: Zymogenetics, Inc. Intellectual Property Department

20070167360 - Methods for treating multiple sclerosis: This invention provides a method for treating a subject afflicted with multiple sclerosis comprising administering to the subject a therapeutically effective amount of soluble receptor for advanced glycation endproducts (sRAGE). This invention further provides a method for inhibiting CD4+ T-cell migration comprising contacting the CD4+ T-cell with soluble receptor for... Agent: Cooper & Dunham, LLP

20070167369 - Novel use of isolated polypeptide comprising four fas-1 domains, em1 domain and rgd motif: The present invention relates to the novel use of a polypeptide comprising an isolated polypeptide comprising EMI domain, four fas-1 domains and RGD motif of βig-h3. More particularly, the invention relates to a method for the inhibition of the adhesion, migration and/or proliferation of endothelial cells, and/or for the inhibition... Agent: Buchanan, Ingersoll & Rooney PC

20070167371 - Ocular tear growth factor-like protein: The present invention relates to a novel lacrimal gland protein (designated lacritin) and the nucleic acid sequences encoding that protein. Lacritin has activity as a growth factor on both human corneal epithelial cells and on the lacrimal acinar cells that produce it. Accordingly, one embodiment of the present invention is... Agent: University Of Virginia Patent Foundation

20070167372 - Ocular tear growth factor-like protein: The present invention relates to a novel lacrimal gland protein (designated lacritin) and the nucleic acid sequences encoding that protein. Lacritin has activity as a growth factor on both human corneal epithelial cells and on the lacrimal acinar cells that produce it. Accordingly, one embodiment of the present invention is... Agent: University Of Virginia Patent Foundation

20070167370 - Peptide analogues of gip for treatment of diapetes, insulin resistance and obesity: The present invention provides peptide analogues which are antagonists of gastric inhibitory peptide (GIP). The peptides, based on GIP 1-42 include substitutions and/or modifications which have enhanced resistance to degradation by the enzyme dipeptidyl peptidase IV (DPP IV). The invention also provides a process of N terminally modifying GIP and... Agent: Kirkpatrick & Lockhart Preston Gates Ellis LLP Formerly Kirkpatrick & Lockhart Nicholson Graham()

20070167366 - Peptide with putative role in cytoskeletal protection: The invention relates to a novel peptide conjugate useful for stabilizing the actin cytoskeleton of mammalian cells. More particularly, the invention relates to a conjugate of a peptide found within the sequence of a bacterium's major outer sheath protein and bovine serum albumin (BSA), and the use of this conjugate... Agent: Woodcock Washburn LLP

20070167359 - Pharmaceutical composition comprising proteins and/or polypeptides and colloidal particles: A pharmaceutical composition for parenteral administration comprising a therapeutically effective amount of a protein or polypeptide and colloidal particles. The particles comprise approximately 1-20 mole percent of an amphipathic lipid derivatized with a biocompatible hydrophilic polymer. The protein or polypeptide is selected from the group consisting of (a) proteins or... Agent: Nath & Associates

20070167363 - Specific antagonists for glucose-dependent insulinotropic polypeptide (gip): In one embodiment, this invention provides an antagonist of glucose-dependent insulinotropic polypeptide (GIP) consisting essentially of a 24 amino acid polypeptide corresponding to positions 7-30 of the sequence of GIP. In another embodiment, this invention provides a method of preventing and treating obesity and non-insulin dependent diabetes mellitus (Type II)... Agent: Edwards Angell Palmer & Dodge LLP

20070167361 - Use of factor xiii for stimulating the perfusion of ischemic tissue: Subject of the present invention is the use of a Factor XIII-preparation preferably in injectable form for the treatment of diseases which are associated with disturbed blood perfusion of the tissue following transient or permanent ischemia.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20070167374 - Specific antagonists for glucose-dependent insulinotropic polypeptide (gip): In one embodiment, this invention provides an antagonist of glucose-dependent insulinotropic polypeptide (GIP) consisting essentially of a 24 amino acid polypeptide corresponding to positions 7-30 of the sequence of GIP. In another embodiment, this invention provides a method of preventing and treating obesity and non-insulin dependent diabetes mellitus (Type II)... Agent: Edwards Angell Palmer & Dodge LLP

20070167375 - Peptide analogs capable of enhancing stimulation of a glioma-specific ctl response: The invention provides a peptide derived from the interleukin-13 receptor α2, which serves as a HLA-A2-restricted cytotoxic T lymphocyte (CTL) epitope. The invention can be used as a vaccine for glioma and can be formulated into compositions for medical or veterinary use. In addition, the invention provides the use of... Agent: Leydig Voit & Mayer, Ltd

20070167376 - Hexa-, hepta-, and octapeptides having antiangiogenic activity: Compounds of formula (SEQ ID NO:1), which are useful for treating conditions that arise from or are exacerbated by angiogenesis, are described. Also disclosed are pharmaceutical compositions comprising these compounds, methods of treatment using these compounds, and methods of inhibiting angiogenesis.... Agent: Robert Deberardine Abbott Laboratories

20070167377 - Inhibitors of glycinamide ribonucleotide transformylase: Potent human inhibitors of human glycinamide ribonucleotide transformylase and of aminoimidazole carboxamide ribonucleotide transformylase are designed, synthesized, and characterized.... Agent: The Scripps Research Institute

20070167378 - Compounds useful for the treatment of diseases associated with the formation of amyloid fibrils: R2 is a hydrogen atom, a C1-C6 alkyl group, a glycosyl; a C1-C6 polyhydroxyalkyl; —C(═O)—Rf group, where Rf is a C1-C6 alkyl group; or a —CH2—COO—Rg group, where Rg is a hydrogen atom or a C1-C6 alkyl group; and pharmaceutically acceptable salts thereof, which are useful in the treatment of... Agent: Intellectual Property / Technology Law

20070167379 - Use of spinosyns for wound healing: A spinosyn or a physiologically acceptable derivative or salt thereof for promoting or accelerating wound healing in humans.... Agent: Eli Lilly & Company

20070167382 - Crystalline and amorphous forms of telithromycin: Provided is telithromycin which melts at a range of 175° C. to 185° C. Also provided are solid states of telithromycin and processes for the preparation thereof.... Agent: Kenyon & Kenyon LLP

20070167381 - Macrolides with antiinflammatory activity: Macrolide compounds of formula (I) wherein X, R, R1, R2, R3 and R4, have the meanings as defined in the specification, pharmaceutically acceptable salts thereof, pharmaceutical compositions containing them as active ingredient and the use thereof in the treatment and prophylaxis of inflammatory diseases, are described.... Agent: Lucas & Mercanti, LLP

20070167380 - Taste masked compositions of erythromycin a and derivatives thereof: A pharmaceutical composition includes erythromycin A or a derivative thereof and alginic acid. The alginic acid provides taste masking of the erythromycin A or derivative. The erythromycin A derivative may be clarithromycin and the alginic acid may be one or both of alginic acid and its salt. The salt may... Agent: Ranbaxy Inc.

20070167383 - Nucleoside compounds for treating viral infections: Disclosed are compounds, compositions and methods for treating viral infections caused by a flaviviridae family virus, such as hepatitis C virus.... Agent: Foley & Lardner LLP

20070167385 - Antisense oligonucleotides (odn) against smad7 and uses in medical field thereof: The invention relates to antisense oligonucleotidic sequences (ODN) against Smad7 suitably modified, and their uses in medical field as therapeutic biological agents, in particular in the treatment of chronic inflammatory bowel disease, such as Crohn's disease and ulcerative colitis.... Agent: Young & Thompson

20070167389 - Compositions, devices and methods for treatment of huntington's disease through intracranial delivery of sirna: The present invention provides devices, small interfering RNAs, and methods for treating a neurodegenerative disorder comprising the steps of surgically implanting a catheter so that a discharge portion of the catheter lies adjacent to a predetermined infusion site in a brain, and discharging through the discharge portion of the catheter... Agent: Fox Rothschild LLP Princeton Pike Corporate Center

20070167390 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP

20070167391 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP

20070167392 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP

20070167394 - Methods and compositions for diagnosing and suppressing metastasis thereof: Disclosed is a method for determining metastatic potential of tumors, a method and a composition for treating/suppressing metastasis of cancers, as well as a method for obtaining a metastasis suppressor. A particular aspect of the invention relates to a method and a composition of evaluating expression levels of connective tissue... Agent: Wpat, PC Intellectual Property Attorneys

20070167384 - Modified polynucleotides for use in rna interference: Methods and compositions for performing RNA interference comprising a wide variety of stabilized siRNAs suitable for use in serum-containing media and for in vivo applications, such as therapeutic applications, are provided. These siRNAs permit effective and efficient applications of RNA interference to applications such as diagnostics and therapeutics through the... Agent: Workman Nydegger (f/k/a Workman Nydegger & Seeley)

20070167387 - Novel artificial nucleic acids of n-o bond crosslinkage type: where Base is an aromatic heterocyclic group or the like optionally having a substituent; R1, R2 and R3 are each a hydrogen atom, a protective group for an amino group, a protective group for a hydroxyl group, a phosphate group, or —P(R4)R5 [where R4 and R5 are each a hydroxyl... Agent: Birch Stewart Kolasch & Birch

20070167388 - Nucleotide sequences promoting the trans-membrane transport of nucleic acids: The present invention relates to a novel system for the trans-membrane transport including the cellular uptake/delivery of nucleic acids, substances that contain a nucleic acid component, recombinant genetic material or substances that can be attached to a nucleic acid, in biological systems. In particular, the present invention relates to a... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20070167386 - Remedy for cardiac failure containing ask1 inhibitor as active ingredient and method for screening the same: The present invention provides a drug for at least one of prevention and treatment of cardiac failure capable of suppressing cardiac depression and the onset of cardiac failure in ventricular remodeling, and a method for screening the drug. The drug for at least one of prevention and treatment of cardiac... Agent: Hamre, Schumann, Mueller & Larson, P.C.

20070167393 - Rna interference mediated inhibition of gene expression using chemically modified short interfering nucleic acid (sina): The present invention concerns methods and reagents useful in modulating gene expression in a variety of applications, including use in therapeutic, diagnostic, target validation, and genomic discovery applications. Specifically, the invention relates to synthetic chemically modified small nucleic acid molecules, such as short interfering nucleic acid (siNA), short interfering RNA... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20070167395 - Compositions and methods for treating diabetes: Low molecular weight modified alginate and/or low molecular weight modified pectin, particularly modified citrus pectin (MCP), is useful in a composition for the treatment of diabetes, when administered to a diabetic individual. For instance, a composition comprising MCP is administered to an individual in an amount sufficient to reduce a... Agent: Steven B. Kelber, Esq.

20070167396 - Methods and compositions for cholesterol reduction in mammals: Provided herein are nutraceutical compositions and methods of formulating nutraceutical compositions for administration to regulate mammalian blood lipids. Also provided are methods of using purified exopolysaccharides for applications such as reducing cholesterol in mammals. Also provided are algal extracts containing nutraceutical small molecules including carotenoids and polyunsaturated fatty acids.... Agent: Solazyme, Inc.

20070167397 - Methods and compositions for joint lubrication: The invention provides novel polysaccharide molecules with high levels of viscosity. These compositions can be used for lubricating the joints of mammals to treat diseases of the joint such as osteoarthritis. Also provided are methods of using polysaccharides for applications such as lubricating joints. Also provided are methods of generating... Agent: Solazyme, Inc.

20070167398 - Methods and compositions for reducing inflammation and preventing oxidative damage: Provided herein are nutraceutical compositions with antioxidant properties. Also provided are methods of using polysaccharides for applications such as reducing inflammation, providing oxidation in mammalian tissue, and other uses. Also provided are algae capable of incorporating exogenously provided monosaccharides into polysaccharides synthesized in vivo to aid in antioxidant activity.... Agent: Solazyme, Inc.

20070167400 - Chitosan oligosaccharides and uses thereof: The present invention is directed towards compositions and methods for reducing or controlling inflammation and for treating inflammatory disease processes and other pathological conditions. The present invention relates to mixtures comprising at least one oligosaccharide of chitosan or a component thereof as novel pharmaceuticals, dietary supplements or cosmetic compositions containing... Agent: Ogilvy Renault LLP

20070167401 - Novel cyclodextrin derivatives, method for the preparation thereof and use thereof for the solubilization of pharmacologically active substances: The invention relates to a compound corresponding to general formula (I) wherein n is a whole number from 1-6, m is a whole number equal to 5, 6 or 7, R1 is an OH group, all R1s are identical, Z is an NHX group, X is a hydrogen atom, and... Agent: Young & Thompson

20070167402 - Product of coprecipitation of sparingly soluble substance and water-soluble polymer and process for producing the same: The present invention provides a coprecipitate of 2-(1-isopropoxycarbonyloxy-2-methylpropyl)-7,8-dimethoxy-4(5H), 10-dio xo-2H-1,2,3-triazolo[4,5-c][1]benzazepine and a water-soluble polymer, excellent in solubility and absorbability.... Agent: Heller Ehrman LLP

20070167403 - Remedy for spinal canal stenosis: A remedy for spinal canal stenosis which comprises a combination of a compound having EP2 agonism with a compound having EP3 agonism. A drug comprising a combination of a compound having EP2 agonism with a compound having EP3 agonism shows an efficacy in a rat gait disorder model induced by... Agent: Sughrue-265550

20070167404 - Surgical compositions for reducing the incidence of adhesions: A method of preventing or reducing the incidence of post-operative adhesions in or associated with a body cavity, which comprises introducing into the body cavity a composition containing an aqueous solution or suspension or gel formulation containing the polysaccharide dextrin.... Agent: Myers Bigel Sibley & Sajovec

20070167405 - Galectins -1 and -4 in tumor development: Methods of prognosis and of prophylactic and therapeutic treatment of tumors based on the involvement of galectin-1 and galectin-4 in tumor development are described.... Agent: Morrison & Foerster LLP

20070167406 - Dihydropyridine derivatives for use as human neutrophil elastase inhibitors: The invention relates to novel dihydropyridine derivatives, of Formula (I) processes for their preparation, and their use in medicaments, especially for the treatment of chronic obstructive pulmonary diseases, acute coronary syndrome, acute myocardial infarction and heart failure development.... Agent: Jeffrey M. Greenman

20070167407 - Quaternary ammonium borate compositions and substrate preservative solutions containing them: Termite repellant treated cellulosic substrates and methods or producing the same.... Agent: Edgar Spielman Albemarle Corporation

20070167409 - Compounds and methods for treating toll-like receptor 2-related diseases and conditions: The present invention relates to compounds and methods useful in the prevention or treatment of diseases or conditions associated with Toll-like receptor 2 activation.... Agent: Clark & Elbing LLP

20070167408 - Novel alkyl phospholipid derivatives with reduced cytotoxicity and uses thereof: The present invention provides novel alkyl phospholipid derivatives with reduced cytotoxicity that are useful for treating various diseases and/or pathophysiological conditions in mammals, preferably humans, that are caused by microorganisms, in particular bacteria, fungi, protozoa and/or viruses. Such alkyl phospholipids can be employed as single drugs or in the course... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070167410 - Immunosuppressant compounds and compositions: The present invention relates to immunosuppressants, processes for their production, their uses and pharmaceutical compositions containing them. The invention provides a novel class of compounds useful in the treatment or prevention of diseases or disorders mediated by lymphocyte interactions, particularly diseases associated with EDG receptor mediated signal transduction.... Agent: Genomics Institute Of The Novartis Research Foundation

20070167411 - Compositions for treating angina: A method of treating angina in a mammal includes administering pyridoxal-5′-phosphate, pyridoxal, pyridoxine, pyridoxamine, 3-acylated analogues of pyridoxal, 3-acylated analogues of pyridoxal-4,5-aminal, pyridoxine phosphonate analogues, or pharmaceutical compositions thereof.... Agent: Merchant & Gould PC

20070167412 - Halocombstatins and methods of synthesis thereof: The invention relates to novel compounds denominated halocombstatins. The halocombstatins are derivatives of combretastatin A-3, and include compounds that exhibit cancer growth cell inhibition against a panel of human cancer cell lines and the murine P388 leukemia, as well as activity as inhibitors of tubulin polymerization and inhibitors of the... Agent: Fennemore Craig

20070167413 - Novel heterocycles: The present invention relates to novel heterocyclic compounds of the general formula (I), their derivatives, analogs, tautomeric forms, stereoisomers, polymorphs, hydrates, solvates, pharmaceutically acceptable salts and compositions, metabolites and prodrugs thereof. The present invention more particularly provides novel hetereocycles of the general formula (I). Also included is a method of... Agent: Oliff & Berridge, PLC

20070167414 - Novel antibacterial agents: The present invention provides novel compounds of the general formula (I), their derivatives, their analogs, their tautomeric forms, their stereoisomers, their polymorphs, their hydrates, their solvates, their pharmaceutically acceptable salts and pharmaceutically acceptable compositions containing them. The present invention more particularly provides novel oxazolidinone derivatives of the general formula (I).... Agent: Oliff & Berridge, PLC

20070167415 - Tetracycline compounds for treatment of cryptosporidium parvum related disorders: Methods and compositions for treating Cryptosporidium parvum related disorders in a mammal are discussed. Several novel tetracycline compounds useful for treating Cryptosporidium parvum related disorders are also included.... Agent: Lahive & Cockfield, LLP

20070167416 - Formulations and uses of 2-hydroxy-5-phenylazobenzoic acid derivatives: A method of increasing the bioavailability of 5-aminosalicylate compound by administration of an oral dosage form with food is provided, as well as an article of manufacture comprising an oral dosage form of 5-aminosalicylate compound in a suitable container and associated with printed labeling which describes the increased bioavailability of... Agent: Edwards Angell Palmer & Dodge LLP

20070167417 - Process for the production of a sterol-rich composition: The invention relates to a process for the production of a sterol ester-rich composition. A sterol composition, a glyceride composition, a fatty acid alkyl ester and an esterification catalyst are combined to form a reaction mixture. Esterification of sterol(s) takes place in the mixture, providing sterol ester(s). The new process... Agent: Arent Fox PLLC

20070167418 - Progesterone/testosterone cream for erectile dysfunction: We have found a consistent pattern of hormonal abnormalities in patients with ERECTILE DYSFUNCTION. Our study group included men from age 21 to 88 years old. By helping to correct the hormonal imbalance of progesterone and testosterone towards normal values, most of the men in our study were able to... Agent: Steven W. Ferguson, Md, Cmd

20070167419 - Treatment for embolic stroke: Provided herein are methods and compositions for treating stroke that include contacting a subject suffering from a stroke with (1) an antioxidant; (2) an antioxidant and one or more of (i) a thrombolytic agent, (ii) an NMDA receptor antagonist and (iii) a spin trap agent; or (3) a thrombolytic agent... Agent: Buchanan, Ingersoll & Rooney LLP

20070167420 - Process for preparing a crystalline form of halobetasol propionate: The present invention provides a process for preparing a crystalline form of halobetasol propionate, comprising the step of crystallizing halobetasol propionate from absolute ethanol or a mixture of ethanol and water, wherein the crystalline form of halobetasol propionate is characterized by an x-ray powder diffraction pattern having peaks at 10.0,... Agent: Taro Pharmaceuticals U.s.a., Inc. C/o Venable LLP

20070167422 - Pharmaceutical compositions comprising 17-allylamino-17-demethoxygeldanamycin: A pharmaceutical formulation comprising (a) 17-allylamino-17-demethoxy-geldanamycin; (b) an ester of d-α-tocopheryl succinate and polyethylene glycol; and (c) a pharmaceutically acceptable, water-miscible organic solvent.... Agent: Kosan Biosciences, Inc

20070167421 - Pyrimidine derivatives and use thereof as agricultural and horticultural fungicides: p

20070167423 - Quinoline and quinazoline derivatives having affinity for 5ht1-type receptors:

20070167424 - Aztreonam l-lysine and methods for the preparation thereof: The present invention relates to the L-lysine salt of aztreonam and methods for making the L-lysine salt of aztreonam.... Agent: Cooley Godward Kronish LLP Attn: Patent Group

20070167425 - Compound capable of binding s1p receptor and pharmaceutical use thereof: wherein ring A is a cyclic group; ring B is a cyclic group which may have substituent(s); X is a spacer having 1 to 8 atoms in its main chain, etc.; Y is a spacer having 1 to 10 atoms in its main chain, etc.; n is 0 or 1,... Agent: Sughrue-265550

20070167426 - Compounds for the treatment of inflammatory disorders and microbial diseases: e

20070167427 - 1,2,4-triazolo[4,3-a]pyridines useful in the treatment of gastrointestinal disorders:

20070167428 - Thienopyrroles as antagonists of gnrh: The invention relates to a group of novel thieno-pyrrole compounds of Formula (I) wherein: R1, R2, R3, R4 and R5 are as defined in the specification, which are useful as