|
FREE patent keyword monitoring and additional FREE benefits. |
![]() |
|
|
USPTO Class 514 | Browse by Industry: Previous - Next | All 07/2007 | Recent | 09: Oct | Sept | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | | 08: Dec | Nov | Oct | Sp | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | | 07: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | | 06: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Drug, bio-affecting and body treating compositions inventions 07/07Recently published patent applications awaiting approval from the USPTO. Recent week's RSS XML file available below.Listing format for abstract view: USPTO application #, Title, Abstract excerpt,Patent Agent. Listing format for list view: USPTO National Class full category number, title of the patent application. 07/26/2007 > patent applications in patent subcategories. 20070173449 - Method of protection from ischemic disease: A therapeutic or prophylactic treatment method of ischemia, such as due to myocardial infarction, by administering thrombopoietin, alone or in combination with other drugs, to a patient suffering from or at risk of cardiac injury, such as myocardial ischemia. The thrombopoietin is administered in a concentration such that the subject's... Agent: Quarles & Brady LLP 20070173484 - Process for the preparation of risedronate sodium hemi-pentahydrate: The present invention relates to an improved process for the selective crystallization of 3-pyridyl-1-hydroxyethylidene-1,1-bisphosphonic acid sodium in pure hemi-pentahydrate form of Formula (I), by first converting 3-pyridyl-1-hydroxyethylidene-1,1-bisphosphonic acid into organic amine salt and then by replacing it with sodium salt.... Agent: Jay R Akhave 20070173434 - Antidiabetic oxazolidinediones and thiazolidinediones: Phenoxyphenyl and phenoxybenzyl oxazolidine-2,4-diones and thiazolidine-2,4-diones of formula (I) are agonists or partial agonists of PPAR gamma and are useful in the treatment and control of hyperglycemia that is symptomatic of type II diabetes, as well as dyslipidemia, hyperlipidemia, hypercholesterolemia, hypertriglyceridemia, and obesity that are often associated with type 2... Agent: Merck And Co., Inc 20070173435 - Stabilized hemoglobin solutions: A hemoglobin solution packaged in a flexible oxygen-impermeable container system. The container system includes a multi-layer film having at least a product contact layer, an oxygen and moisture barrier layer and an exterior layer. The flexible container system further includes an interface port for filling the flexible container with the... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP 20070173437 - Bisubstrate inhibitors of protein tyrosine kinases as therapeutic agents: A bisubstrate inhibitor of Src kinases, having a nucleotide or N-heteroaromatic moiety; and a peptide/phosphopeptide, peptidomimetic, or phosphopeptide mimic moiety. The moieties are linked by a rigid or a flexible linker. The nucleotide or N-heteroaromatic moiety is ATP, ATP-mimics, N-heteroaromatics including purine-based derivatives, pyrimidine-based derivatives such as 2,4-diamino-5-substituted pyrimidine derivatives,... Agent: Gauthier & Connors, LLP 20070173436 - Compositions and methods for enhancing drug delivery across and into epithelial tissues: This invention provides compositions and methods for enhancing delivery of drugs and other agents across epithelial tissues, including the skin, gastrointestinal tract, pulmonary epithelium, ocular tissues and the like. The compositions and methods are also useful for delivery across endothelial tissues, including the blood brain barrier. The compositions and methods... Agent: Morrison & Foerster LLP 20070173439 - Interleukin-18 binding proteins, their preparation and use: Interleukin-18 binding proteins which are capable of binding IL-18 and of modulating and/or blocking IL-18 activity are provided. Methods for the isolation and recombinant production, DNAs encoding them. DNA vectors expressing them, vectors useful for their expression in humans and other mammals, antibodies against them are also provided. Therapeutic uses... Agent: Ivor R. Elrifi Mintz, Levin, Cohn, Ferris, 20070173438 - [psi[ch2nh]pg4] glycopeptide antibiotic analogs: [ψ[CH2NH]PG4] glycopeptide antibiotic analogs are reengineered forms of glycopeptides that exhibit antimicrobial activity against both wild type and glycopeptide antibiotic resistant strains of microorganisms. For example, [ψ[CH2NH]Tpg4] vancomycin aglycon is a reengineered form of vancomycin that exhibits antimicrobial activity (MIC=31 μg/mL) against both wild type and VanA resistant organism (E.... Agent: The Scripps Research Institute 20070173440 - Methods and pharmaceutical compositions for the treatment and prevention of hepatitis c infection: # 20070173443 - C-terminal p53 palindromic peptide that induces apoptosis of cells with aberrant p53 and uses thereof: Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides... Agent: Cooper & Dunham, LLP 20070173442 - Combination therapy with glatiramer acetate and mitoxantrone for the treatment of multiple schlerosis: The subject invention provides a method of treating a subject afflicted with a form of multiple sclerosis comprising periodically administering to the subject an amount of glatiramer acetate and an amount of mitoxantrone, wherein the amounts when taken together are effective to alleviate a symptom of the form of multiple... Agent: Cooper & Dunham, LLP 20070173441 - Inhibitors of n ethymalemide sensitive factor: Methods and compositions for blocking exocytosis by inhibition of proteins that regulate exocytosis, such as N-ethylmaleimide Sensitive Factor (NSF), are provided. The compositions include multidomain fusion peptides containing a domain that causes the fusion peptide to cross the cellular membrane (e.g. a domain from the TAT protein of HIV) and... Agent: Whitham, Curtis & Christofferson & Cook, P.C. 20070173447 - Method for treating osteoporosis by intranasal delivery of teriparatide with an anti-resorptive agent: A method for treating osteoporosis in a mammal by administering intranasally a therapeutically effective amount of a PTH formulation to the mammal in combination with administration of an anti-resorptive agent. The PTH formulation can contain teriparatide.... Agent: Nastech Pharmaceutical Company Inc 20070173446 - Method of administering porcine b-domainless fviii: The present invention provides a method of administering porcine B-domainless factor VIII (OBI-1) to a patient having factor VIII deficiency to provide more rapid and effective protection against bleeding episodes, compared to formerly available methods, or to provide more effective protection to such patients during non-bleeding periods. This invention is... Agent: Greenlee Winner And Sullivan P C 20070173454 - Methods for slowing senescence and treating and preventiing diseases associated with senescence: The present invention relates to a method for slowing, preventing or delaying senescence or treating or preventing a disease associated with senescence by administering a therapeutically effective amount of at least one physiological agent that decreases or regulates the blood level, production, function or activity of LH or FSH, or... Agent: Covington & Burling, LLP Attn: Patent Docketing 20070173445 - Methods for treating viral infection using il-28 and il-29: IL-28A, IL-28B, IL-29, and certain mutants thereof have been shown to have antiviral activity on a spectrum of viral species. Of particular interest is the antiviral activity demonstrated on viruses that infect liver, such as hepatitis B virus and hepatitis C virus. In addition, IL-28A, IL-28B, IL-29, and mutants thereof... Agent: Zymogenetics, Inc. Intellectual Property Department 20070173453 - Methods of preventing or treating brain ischemia or brain injury: The present invention relates to use of Narp inhibitor in order to promote or enhance recovery from ischemic events, particularly focal ischemia of the central nervous system, as well as for preventing or diminishing chronic degenerative changes.... Agent: Cooper & Dunham LLP 20070173451 - Methods of using soluble heterodimeric cytokine receptor: A soluble receptor that binds to IL-20 having two polypeptide subunits, IL-22R and IL-20RB. The two subunits are preferably linked together. In one embodiment one subunit is fused to the constant region of the light chain of an immunoglobulin, and the other subunit is fused to the constant region of... Agent: Marshall, Gerstein & Borun LLP 20070173444 - Peptides and compounds that bind to the il-5 receptor: Interleukin 5 (IL-5) receptor ligands are described and methods of use thereof claimed.... Agent: Dorsey & Whitney LLP 20070173450 - Process for the synchronization of ovulation for timed breeding without heat detection: A method for synchronizing ovulation in sows and gilts by a single injection of hormones is disclosed. A hormone, gonadotropin releasing hormone (GnRH), luteinizing hormone (LH), follicle stimulating hormone (FSH), human chorionic gonadotropin (hCG), analogues, derivatives, agonists or combinations thereof is administered to an open sow post weaning at a... Agent: Patrea L. Pabst Pabst Patent Group LLP 20070173448 - Solution for removing cataracts via liquefracture: An improved solution for use in the removal of cataractous lenses via liquefracture is described. The liquefracture solution contains a viscosity-enhancing agent to increase the residence time of the solution in the heating chamber of the liquefracture handpiece, thereby increasing the expulsion force of the solution from the handpiece (i.e.,... Agent: Alcon 20070173452 - Use of glp-1 analogs and derivatives administered peripherally in regulation of obesity: This invention relates the use of glucagon-like peptides such as GLP-1, a GLP-1 analog, or a GLP-1 derivative in methods and compositions for reducing body weight.... Agent: Eli Lilly & Company 20070173456 - Preptin fragments and methods of use: Methods for increasing osteoblast proliferation with N-terminal fragments of preptin are provided herein.... Agent: Fish & Richardson PC 20070173455 - Specific antagonists for glucose-dependent insulinotropic polypeptide (gip): In one embodiment, this invention provides an antagonist of glucose-dependent insulinotropic polypeptide (GIP) consisting essentially of a 24 amino acid polypeptide corresponding to positions 7-30 of the sequence of GIP. In another embodiment, this invention provides a method of preventing and treating obesity and non-insulin dependent diabetes mellitus (Type II)... Agent: Edwards Angell Palmer & Dodge LLP 20070173457 - Tau-conotoxin peptides: The invention relates to relatively short peptides (termed τ-conotoxins herein), about 10-25 residues in length, which are naturally available in minute amounts in the venom of the cone snails or analogous to the naturally available peptides, and which preferably include two disulfide bonds.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C. 20070173458 - Neo-tryptophan: The invention provides a novel amino acid, neo-tryptophan, as well as polypeptides containing this novel amino acid such as neurotensin analogs. In addition, the invention provides neo-tryptophan derivatives, serotonin-like neo-tryptophan derivatives, and polypeptides containing such derivatives. The invention also provides methods for making neo-tryptophan, neo-tryptophan derivatives, serotonin-like neo-tryptophan derivatives, and... Agent: Fish & Richardson P.C. 20070173459 - Mixtures and methods for the induction of resistance in plants: Mixtures are described comprising two or more compounds selected from at least two of the following groups: i) salicylic acid and/or its functional analogous products (ESA), ii) promoting compounds (PRO) and iii) modulating compounds (MOD), and their use for stimulating the natural defence systems of plants and for inducing resistance... Agent: James V. Costigan Hedman & Costigan 20070173460 - Compositions comprising lignin and methods of making and using the same: Lignins have a number of bioactivities including the inhibition of cellular proliferation and inhibition of thrombus formation which are applicable for their use in coating for medical devices and pharmaceuticals. As such, a composition comprising lignins and methods for making and using the same are provided herein.... Agent: Leydig Voit & Mayer, Ltd 20070173461 - Glycoside prodrug of 5- aminosalicylic acid: g 20070173462 - Treatment of diseases associated with the use of antibiotics: This invention relates to the treatment or prevention of diseases associated with the use of antibiotics or cancer chemotherapies or antiviral therapies, such as colitis, pseudomembranous colitis, antibiotic associated diarrhea and infections due to C difficile, C. perfringens, Staphylococcus species including methicillin-resistant Staphylococcus aureus (MRSA) or Enterococcus including vancomycin-resistant enterococci... Agent: Cohen, Pontani, Lieberman & Pavane 20070173463 - Method and composition for treating otitis media: A combination of agents for use at the time of placement of tubes in the eardrums is presented specifically to address both the issue of infection and the issue of tube obstruction from blood. Tube placement for chronic fluid behind the eardrum or recurrent ear infections is one of the... Agent: Burns & Levinson LLP 20070173464 - Oral ribavirin pharmaceutical compositions: The invention relates to oral pharmaceutical compositions for the prevention and/or the treatment of viral diseases. This invention also addresses methods of prevention and/or treatment of these viral diseases, using these oral compositions. One of the main problems considered in the present invention is to enhance the efficiency of anti-viral... Agent: Patton Boggs LLP 20070173477 - Beta secretase polypeptides: Disclosed are novel genes encoding beta secretase polypeptides. Also disclosed are methods of making and using the polypeptides.... Agent: Amgen Inc. 20070173474 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP 20070173475 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP 20070173465 - Expression of zeta negative and zeta positive nucleic acids using a dystrophin gene: Disclosed is expression of zeta negative and zeta positive nucleic acids or nucleic acid complexes using a dystrophin gene in a process for providing nucleic acid expression in a striated (skeletal or cardiac) muscle cell for the purpose of providing a change to the endogenous properties of the cell for... Agent: Mirus Corporation 20070173472 - Methods and reagents for the treatment of apoptosis-related disorders: The present invention relates to novel uses and reagents relating to apoptosis-related disorders. In particular, modulation of PI3K class IIα activity is shown to influence apoptosis, and PI3K class IIα is thought to be cellular survival factors. Based on these findings the present invention provides therapeutic methods and pharmaceutical compositions... Agent: Novartis Corporate Intellectual Property 20070173470 - Methods for delivering extracellular target into cells: The invention relates to a method for intracellular delivery of substances, comprising the steps of suspending the substance in aqueous solution and providing sufficient speed to enable the suspended substance to penetrate the cell surface and become incorporated into the cell. This method does not require the accompaniment or aid... Agent: Harness, Dickey & Pierce, P.L.C 20070173466 - Methods of treating inflammatory diseases associated with bone destruction: The present invention relates to methods for treating inflammatory diseases accompanied by bone destruction, comprising the step of administering a viral vector comprising a gene which inhibits signal transduction mediated by fibroblast growth factor-2 (FGF2)-FGF receptor 1-Ras-Raf-MAP kinase to a diseased region. Furthermore, the present invention relates to therapeutic compositions... Agent: Clark & Elbing LLP 20070173476 - Modified polynucleotides for use in rna interference: Methods and compositions for performing RNA interference comprising a wide variety of stabilized siRNAs suitable for use in serum-containing media and for in vivo applications, such as therapeutic applications, are provided. These siRNAs permit effective and efficient applications of RNA interference to applications such as diagnostics and therapeutics through the... Agent: Workman Nydegger (f/k/a Workman Nydegger & Seeley) 20070173469 - Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5' ends: The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides immunomers for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunomers of the invention comprise at least two oligonucleotides linked... Agent: Wayne A. Keown Keown & Associates 20070173471 - Morphogen compositions and methods of use thereof to treat heart disorders: Disclosed are compositions and methods for preventing, treating, or reducing symptoms associated with a myocardial or related disorder such as an infarction. In one embodiment, the method includes administering a therapeutically effective amount of a nucleic acid encoding at least one morphogen; or an effective fragment thereof. Preferred morphogens include... Agent: Edwards Angell Palmer & Dodge LLP 20070173468 - Novel endonuclease of immune cell, process for producing the same and immune adjuvant using the same: The present invention relates to a novel endonuclease enzyme which is secreted from immune cell and recognizes bacterial DNA as foreign agent and processes it to produce about 10 bp single-stranded oligonucleotide including CpG motif which is involved in immune response. Also, the present invention relates to a process for... Agent: Akerman Senterfitt 20070173467 - Rna interference mediated inhibition of cholesteryl ester transfer protein (cetp) gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating cholesteryl ester transfer protein (CETP) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways of CETP gene... Agent: Mcdonnell, Boehnen, Hulbert And Berghoff, LLP 20070173473 - Rna interference mediated inhibition of proprotein convertase subtilisin kexin 9 (pcsk9) gene expression using short interfering nucleic acid (sina): The present invention relates to compounds, compositions, and methods for the study, diagnosis, and treatment of traits, diseases and conditions that respond to the modulation of Proprotein Convertase Subtilisin Kexin 9 (PCSK9) gene expression and/or activity. The present invention is also directed to compounds, compositions, and methods relating to traits,... Agent: Mcdonnell, Boehnen, Hulbert And Berghoff, LLP 20070173478 - Compositions for the enhanced treatment of depression: For treatment of endogenous depression, there is taken in combination an antidepressant, particularly an SSRI or SNRA, and a precursor or inducer of a neurotransmitter, e.g. L-phenylalanine, tyramine or L-tryptophan. Optionally, the patient also takes vitamin B12.... Agent: Stites & Harbison PLLC 20070173480 - Formulations for mediating inflammatory bowel disorders: The invention provides formulations and methods for mediating inflammation, in particular an inflammatory bowel disorder such as necrotizing enterocolitis, and for. Further, the formulations are effective in lowering blood cholesterol and decreasing blood cholesterol absorption. The formulations comprise at least one ganglioside, which may be selected from the group consisting... Agent: Borden Ladner Gervais LLP 20070173479 - Methods using sulodexide for the treatment of bladder disease: The present invention concerns methods for the treatment of bladder related diseases and, in particular, inflammatory bladder diseases such as interstitial cystitis, by administration of sulodexide.... Agent: Jones Day 20070173481 - Compositions and methods for preventing infection: This invention relates to cholesterol-sequestering agents and methods of using cholesterol-sequestering agents to prevent infection. The compositions of the invention can be used to reduce or prevent maternal to fetal transmission of a microorganism and/or to reduce or eliminate a microorganism present in a blood sample or a blood product.... Agent: Lisa A. Haile, J.d., Ph.d. Dla Piper US LLP 20070173482 - Agents for preventing and treating disorders involving modulation of the ryr receptors: and salts, hydrates, solvates, complexes, and prodrugs thereof. The present invention further provides methods for synthesizing compounds of Formula I. The invention additionally provides pharmaceutical compositions comprising the compounds of Formula I and methods of using the pharmaceutical compositions of Formula I to treat and prevent disorders and diseases associated... Agent: Wilmerhale/columbia University 20070173483 - Pyrrolopyrimidines and related analogs as hsp90-inhibitors: Pyrrolopyrimidines and related analogs are described and demonstrated to have utility as Heat Shock Protein 90 (HSP90) inhibiting agents used in the treatment and prevention of various HSP90 mediated disorders, e.g., proliferative disorders. Methods of synthesis and use of such compounds are also described and claimed.... Agent: Wilson Sonsini Goodrich & Rosati 20070173485 - Platinum complexes with mononitrile-containing ligands: Disclosed herein are novel platinum-based complexes possessing one nitrile substituent group (mononitrile) covalently-bonded to the platinum, one or more nitrogen donor ligands capable of forming hydrogen bonds with the bases in DNA or RNA and leaving groups (i.e., L1 and L2 )which can be hydrolyzed iii vivo to active species,... Agent: Scott A.whitaker, Ph.d., J.d. Sr. Intellectual Property Counsel 20070173486 - Azetidinecarboxamide derivatives and their use in the treatment of cb1 receptor mediated disordrs: Compounds of formula (I) and their use in therapy, particularly for the treatment of a disorder mediated by CB1 receptors, such as obesity, wherein: R1 is aryl or heteroaryl; R2 is alkyl, aryl or heteroaryl; R3 is alkyl, aryl, heteroaryl, NR9R10, OR15, or NR16C(O)R17; Y is C═O, C═S, SO2, or... Agent: Banner & Witcoff, Ltd. 20070173487 - S1p receptor modulating compounds and use thereof: The present invention relates to compounds of the general formula (I) that have activity as S1P receptor modulating agents and the use of such compounds to treat diseases associated with inappropriate S1P receptor activity. The compounds may be used as immunomodulators, e.g., for treating or preventing diseases such as autoimmune... Agent: Goodwin Procter LLP Patent Administrator 20070173489 - Inhibitors of the gpib-vwf interaction, their preparation and use: in which R1, R2, A, B, D, E, n, m or o have the meanings indicated below. The compounds of the formula I are valuable pharmacologically active compounds. They are reversible inhibitors of the interaction between the plasma protein von Willebrand factor (vWF) and the blood platelet receptor glycoprotein Ib-IX-V... Agent: Clark & Elbing LLP 20070173488 - Pyrazolothiazole protein kinase modulators: The present invention provides pyrazolothiazole kinase modulators, methods of treating certain disease states, such as cancer, and pharmaceutical composition thereof.... Agent: Townsend And Townsend And Crew, LLP 20070173490 - Inhibitors of the gpib-vwf interaction, their preparation and use: The present invention relates to novel solid forms of (4R)-1-[4-(2-chloro-5-fluorobenzoyl)amino-3-methoxybenzoyl]-1,2,3,5-tetrahydro-spiro[4H-1-benzazepine-4,1′-[2]cyclopentene]-3′-carboxylic acid (formula (I)) useful for treating and/or preventing conditions such as diabetic nephropathy, renal disease, renal failure and congestive heart failure.... Agent: Philip S. Johnson Johnson & Johnson 20070173491 - Substituted lactams as inhibitors of abeta protein production: having drug and bio-affecting properties, their pharmaceutical compositions and methods of use. These novel compounds inhibit the processing of amyloid precursor protein and, more specifically, inhibit the production of Aβ-peptide, thereby acting to prevent the formation of neurological deposits of amyloid protein. More particularly, the present invention relates to the... Agent: Kelley Drye & Warren LLP 20070173492 - 1,2-diaza-dibenzo[e,h]azulenes for the treatment of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of 1,2-diaza-dibenzo[e,h]azulenes and of their pharmacologically acceptable salts and solvates for the use in the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the neurochemical equilibrium of biogenic... Agent: Darby & Darby P.C. 20070173493 - 1-oxadibenzo[e,h]azulenes for the treatment of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of 1-oxadibenzo[e,h]azulenes and of their pharmacologically acceptable salts and solvates in pharmaceutical formulation for the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the neurochemical equilibrium of biogenic... Agent: Darby & Darby P.C. 20070173495 - Heterocycles as nicotinic acid receptor agonists for the treatment of dyslipidemia: e 20070173494 - Diaza heterocyclic sulfonamide derivatives and their uses: 20070173496 - Novel polymorph e of olanzapine and preparation of anhydrous non-solvated crystalline polymorphic form i of 2-methyl-4(4-methyl-1-piperazinyl)-10h-thieno[2,3-b][1,5] benzodiazepine (olanzapine form i) from the polymorphic olanzapine form e: The invention provides an Olanzapine pseudopolymoph Form E. The invention provides methods of preparing polymorphic Olanzapine Form E employing rapid crystallization and seeding. The invention provides methods of preparing anhydrous Olanzapine Form I from the Olanzapine Form E by step-wise drying.... Agent: Novartis Corporate Intellectual Property 20070173497 - 11-hydroxy-5h-pyrrolo[2,1-c][1,4] benzodiazepin-5-one derivatives as key intermediates for the preparation of c2 substituted pyrrolobenzodiazepines: The present inventors have developed a key intermediate for the production of C2 substituted PBDs, which has a leaving group at the C2 position, a carbamate protecting group at the N10 position and a protected hydroxy group at the C11 position. In a first aspect, the present invention comprises a... Agent: Michael Best & Friedrich, LLP 20070173498 - Melanin concentrating hormone antagonist: R1 and R2 are independently hydrogen atom or a hydrocarbon group which may have substituents; R1 and R2, together with the adjacent nitrogen atom, may form a nitrogen-containing hetero ring which may have substituents; R2 may form a spiro ring together with Ar; or R2, together with the adjacent nitrogen... Agent: Edwards Angell Palmer & Dodge LLP 20070173500 - Substituted 3-(5-membered unsaturated heterocyclyl-1, 3-dihydro-indol-2-one's and derivatives thereof as kinase inhibitors: The present invention relates to organic molecules capable of modulating tyrosine kinase signal transduction in order to regulate, modulate and/or inhibit abnormal cell proliferation.... Agent: Allergan, Inc. 20070173499 - Use of benzonaphthoazulenes for the manufacture of pharmaceutical formulations for the treatment and prevention of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of benzonaphthoazulenes and of their pharmaceutically acceptable salts and solvates for the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the neurochemical equilibrium of biogenic amines or other... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475 20070173501 - Substituted 3-(5-membered unsaturated heterocyclyl-1, 3-dihydro-indol-2-one's and derivatives thereof as kinase inhibitors: The present invention relates to organic molecules capable of modulating tyrosine kinase signal transduction in order to regulate, modulate and/or inhibit abnormal cell proliferation.... Agent: Allergan, Inc. 20070173502 - Novel urea derivatives, method for preparing same, use thereof as medicines, pharmaceutical compositions and novel use: radical. In which the two nitrogen atoms are linear or form a cyclic radical, X represents carbonyl, alkylene or alkenylene, linear or branched, containing at most 6 carbon atoms optionally interrupted by oxygen or sulphur, R4, R5 and R6 represent hydrogen, a protective group of the nitrogen, alkyl, cycloalkyl, aryl... Agent: Amgen Inc. 20070173504 - Calcium channel antagonists: The present invention provides novel calcium channel antagonists, and methods of treating disease sates using the novel antagonists.... Agent: Townsend And Townsend And Crew, LLP 20070173503 - Novel 4-benzimidazol-2-ylpyridazin-3-one derivatives: e 20070173505 - A2a adenosine receptor antagonists: The invention is based on the discovery that compounds of formula (I) possess unexpectedly high affinity for the A2a adenosine receptor, and can be useful as antagonists thereof for preventing and/or treating numerous diseases, including Parkinson's disease. In one embodiment, the invention features a compound of formula (I).... Agent: Biogen Idec Inc Patent And Trademark Coordinator 20070173506 - Thiazole compounds and methods of use: e 20070173507 - Dairyl-substituted five-membered heterocycle derivative: wherein X5 represents sulfur atoms and the like, A1 represents carbon atoms and the like, A2 represents nitrogen atoms and the like and A ring represents phenyl group and the like, having mGluR1 inhibiting effect, and being usefull for preventing or treating convulsion, acute pain, inflammatory pain, chronic pain, brain... Agent: Merck And Co., Inc 20070173508 - Tricyclic inhibitors of 5-lipoxygenase: Described herein are compounds and pharmaceutical compositions containing such compounds, which inhibit the activity of 5-lipoxygenase (5-LO). Also described herein are methods of using such 5-LO inhibitors, alone and in combination with other compounds, for treating respiratory, cardiovascular, and other leukotriene-dependent or leukotriene mediated conditions, diseases, or disorders.... Agent: Wilson Sonsini Goodrich & Rosati 20070173509 - Imidazole compounds: Imidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor expression, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson 20070173510 - Imidazole compounds: Imidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor expression, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson 20070173512 - Imidazole compounds: Imidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor expression, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson 20070173513 - Imidazole compounds: Imidazole compounds, compositions, and methods of using them in leukocyte recruitment inhibition, in modulating H4 receptor expression, and in treating conditions such as inflammation, H4 receptor-mediated conditions, and related conditions.... Agent: Philip S. Johnson Johnson & Johnson 20070173511 - Cyclohexyl sulfonamide derivatives: i 20070173514 - Methods for suppressing an immune response or treating a proliferative disorder: 20070173515 - Delta opioid receptor agonist compounds: Compositions and methods for treatment of sexual dysfunctions by administering to a subject a pharmaceutical composition comprising a delta opioid receptor agonist in an amount effective to delay the onset of ejaculation in the subject during sexual stimulation.... Agent: Marianne Fuierer Moore & Van Allen PLLC 20070173516 - Pyrazine kinase inhibitors: The present invention relates to compounds useful as inhibitors of protein kinases. The invention also provides pharmaceutically acceptable compositions comprising those compounds and methods of using the compounds and compositions in the treatment of various disease, conditions, and disorders. The invention also provides processes for preparing compounds of the inventions.... Agent: Vertex Pharmaceuticals Inc. 20070173517 - Synthesis of 6,7-dihydro-5h-imidazo[1,2-a]imidazole-3-sulfonic acid amides: e 20070173518 - Cristalline and amorphous form of a triazolo (4,5-d) pyridimine compound: The invention provides new forms of a chemical compound of formula (I). The invention relates to forms of a chemical compound (I), in particular to crystalline and amorphous forms, more particularly four crystalline forms and an amorphous form. The invention further relates to processes for the preparation of such forms,... Agent: Nixon & Vanderhye, PC 20070173519 - Pyrazolopyrimidine derivatives or pharmaceutically acceptable salts thereof: A pyrazolopyrimidine derivative represented by formula (1) and pharmaceutically acceptable salt thereof exhibit excellent inhibitory activity against MAPKAP-K2. Accordingly, medicines containing this compound as an active ingredient are expected to be effective for treating diseases mediated by MAPKAP-K2 such as, for example, inflammatory disorder, autoimmune diseases, destructive osteopathy, cancer and/or... Agent: Sughrue Mion, PLLC 20070173521 - Beta-secretase modulators and methods of use: wherein R1, W, B, R3, R4, R5, i and j are defined herein. The invention also comprises pharmaceutical compositions including one or more compounds of Formula I, methods of use for these compounds, including treatment of AD and related diseases, by administering the compound(s) of Formula I, or compositions including... Agent: Amgen Inc. 20070173520 - Crystalline forms of a pyridinyl-sulfonamide and their use as endothelin receptor antagonists: Crystalline forms A and B of 5-methyl-pyridine-2-sulfonic acid [6-methoxy-5-(2-methoxy-phenoxy)-2-pyridin-4-yl-pyrimidin-4-yl]-amide of formula (I) are described, whereby form B is the most stable form. 5-methyl-pyridine-2-sulfonic acid [6-methoxy-5-(2-methoxy-phenoxy)-2-pyridin-4-yl-pyrimidin-4-yl]-amide also forms solvates with, for example, ethanol, acetone, tetrahydrofuran, methanol, isopropanol, 2-butanone and dichloromethane.... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070173522 - 4-(2-phenylsulfanyl-phenyl)-1,2,3,6- tetrahydropyridine derivatives as serotonin reuptake inhibitors: The invention provides compounds represented by the general formula (I) wherein the substituents are defined in the application. The compounds are useful in the treatment of an affective disorder, including depression, anxiety disorders including general anxiety disorder and panic disorder and obsessive compulsive disorder.... Agent: Darby & Darby P.C. 20070173523 - Process for the preparation of 17-n-substituted-carbamoyl-4-aza-androst-1-en-3-ones: The present invention relates to a process for producing 17-N-substituted-carbamoyl-4-aza-androst-1-en-3-ones of formula 1, including Finasteride and Dutasteride.... Agent: Ivor M. Hughes, Barrister & Solicitor, Patent & Trademark Agents 20070173524 - \"novel ido inhibitors and methods of use: Compounds, compositions and methods for the treatment of malignancy are disclosed.... Agent: Dann, Dorfman, Herrell & Skillman 20070173525 - Tyrosine kinase inhibitors: The present invention relates to compounds that are capable of inhibiting, modulating and/or regulating signal transduction of both receptor-type and non-receptor type tyrosine kinases. The compounds of the instant invention possess a core structure that comprises a benzazocine moiety. The present invention is also related to the pharmaceutically acceptable salts,... Agent: Merck And Co., Inc 20070173526 - Compounds and methods for treating dyslipidemia: The present invention discloses compounds of formula (I) wherein A, n, q, K, W, X, Y; Z, R1, R2, R3, R4, R5, and R6 are as defined herein and their pharmaceutical compositions and methods of use are disclosed as useful for treating dyslipidemia and its sequelae.... Agent: Eli Lilly & Company 20070173527 - Histone deacetylase inhibitors: e 20070173528 - Process for preparing solifenacin: Provided are new intermediates of solifenacin and methods for their preparation, as well as methods of preparing solifenacin and solifenacin succinate.... Agent: Kenyon & Kenyon LLP 20070173530 - 6-aminoisoquinoline compounds: 6-Amino isoquinoline compounds are provided that influence, inhibit or reduce the action of a kinase. Pharmaceutical compositions including therapeutically effective amounts of the 6-aminoisoquinoline compounds and pharmaceutically acceptable carriers are also provided. Various methods using the compounds and/or compositions to affect disease states or conditions such as cancer, obesity and... Agent: Michael Best & Friedrich, LLP 20070173529 - Sulfated bis-cyclic agents: Sulfated bis-cyclic compounds that are potent anticoagulants and methods for their manufacture are provided. The sulfated compounds are bis-cyclic moieties comprised of an isoquinoline ring joined to a phenyl ring with the general chemical structure formula (I) where R2 is hydrogen or a sulfate moiety, R3 is either hydrogen or... Agent: Whitham, Curtis & Christofferson & Cook, P.C. 20070173531 - Compound: l 20070173532 - New piperidine antibiotics: 20070173533 - Substituted 3-phenylpiperidine compounds, their preparation and use: 20070173534 - Pyridinic sulfonamide derivatives method of production and use thereof: New pyridinic sulfonamide derivatives represented by a general formula (I), wherein R1 represents a mono- or polyhalogenated C1-12-alkyl or a mono- or polyhalogenated C3-8-cycloalkyl group. The method of production of such derivatives and their use as active therapeutic substance in the treatment of diseases such as inflammation, arthrosis, cancer, angiogenesis... Agent: Jacobson Holman PLLC 20070173535 - Oxadiazoles having antiproliferative activity: Oxadiazole derivatives of general formula (1) in which X, Y, R and R2 have the meanings defined in the disclosure. The compounds have antiproliferative activity against a number of human tumors cell lines and can therefore be used for the preparation of antitumor medicaments.... Agent: Young & Thompson 20070173536 - Crystalline forms of zolmitriptan: The present invention is directed to a novel crystalline form of Zolmitriptan, herein designated as Form A, and several novel solvates of Zolmitriptan, herein designated as Form B, C, D, E, F, and G, processes for the preparation thereof and pharmaceutical compositions comprising these crystalline forms.... Agent: Ciba Specialty Chemicals Corporation Patent Department 20070173537 - Indazole compound and pharmaceutical use thereof: The present invention can provide a cancer treatment drug containing, as an active ingredient, a substance selected from the group consisting of an indazole compound of the following formula (I), a pharmaceutically acceptable salt, a hydrate, a water adduct and a solvate:... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C. 20070173538 - Pharmaceutical formulation for delivery of receptor tyrosine kinase inhibiting (rtki) compounds to the eye: The present invention relates to development of efficacious pharmaceutical compositions comprising a poorly water soluble active compound in a therapeutically effective amount and a co-solvent in a suitable amount to treat or prevent diseases due to ocular neovascularization and enhanced vascular permeability. In preferred aspects the composition is in the... Agent: Alcon 20070173539 - Use of malonomicin and analogs in fungicidal applications: The present invention is related to the use of malonomicin compounds and derivatives in fungicidal applications and to new derivatives of malonomicin.... Agent: Dow Agrosciences LLC 20070173540 - Dnt-benzenesulfonate and methods of preparation thereof: (S)—N,N-Dimethyl-3-(1-naphthalenyloxy)-3-(2-thienyl)propanamine benzenesulfonate (DNT-benzenesulfonate) and polymorphs of DNT-benzenesulfonate, compositions of DNT-benzenesulfonate and its polymorphs, processes for the preparation of DNT-benzenesulfonate and its polymorphs, and processes for the preparation of duloxetine hydrochloride from DNT-benzenesulfonate are provided.... Agent: Kenyon & Kenyon LLP 20070173541 - Dnt-succinate and methods of preparation thereof: (S)-N,N-Dimethyl-3-(1-naphthalenyloxy)-3-(2-thienyl)propanamine succinate (DNT-succinate) and polymorphs of DNT-succinate, compositions of DNT-succinate and its polymorphs, processes for the preparation of DNT-succinate and its polymorphs, and processes for the preparation of duloxetine hydrochloride from DNT-succinate are provided.... Agent: Kenyon & Kenyon LLP 20070173542 - Peptide deformylase inhibitors: Novel PDF inhibitors and novel methods for their use are provided.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20070173543 - Synthesis of polycyclic procyanidins: A method for preparing A-type procyanidins is provided by reacting flavylium salts with catechins and analogs thereof, under anhydrous conditions in alcohol.... Agent: Schwegman, Lundberg, Woessner & Kluth, P.A. 20070173545 - Activation of hypoxia-inducible gene expression: The present invention relates to the elucidation of specific molecular features of endogenous 2-oxoacid molecules and their derivatives for activating hypoxia-inducible gene expression by inactivating hypoxia-inducible factor hydroxylating enzymes. This invention identifies agents that can be used to induce tissue vascularization, treat anemias, induce tolearance to stroke and heart attacks,... Agent: Morgan Lewis & Bockius LLP 20070173544 - Compounds for the treatment of metabolic disorders: Agents useful for the treatment of various metabolic disorders, such as insulin resistance syndrome, diabetes, hyper-lipidemia, fatty liver disease, cachexia, obesity, atherosclerosis and arteriosclerosis are disclosed. Formula (I) wherein n is 1 or 2; m is 0 to 4; q is 0 or 1; t is 0 or 1; R2... Agent: Lewis J. Kreisler 20070173546 - Selective androgen receptor modulators and method of use thereof: This invention provides SARM compounds and uses thereof in treating a variety of diseases or conditions in a subject, including, inter-alia, a muscle wasting disease and/or disorder or a bone-related disease and/or disorder.... Agent: Pearl Cohen Zedek Latzer, LLP 20070173547 - Method for producing dry powders of one or several carotenoids: The invention relates to a method for producing dry powders of one or several carotenoids, said method being characterised in that a) one or several carotenoids are suspended in an aqueous molecularly dispersed or colloidally dispersed solution of a mixture consisting of trehalose and at least one protein-containing protective colloid... Agent: Connolly Bove Lodge & Hutz, LLP 20070173548 - Malonamic acids and derivatives thereof as thyroid receptor ligands: The present invention relates to novel thyroid receptor ligands and, more particularly, relates to malonamic acids and derivatives thereof of Formula I, which are useful in the treatment of obesity, overweight condition, hyperlipidemia, glaucoma, cardiac arrhythmias, skin disorders, thyroid disease, hypothyroidism, thyroid cancer and related disorders and diseases such as... Agent: Warner-lambert Company 07/19/2007 > patent applications in patent subcategories.20070167362 - Medicines containing nerve growth factor for assisting losing weight and methods for assisting losing weight using same: A medicine for assisting losing weight contains nerve growth factor. Further, a method for assisting losing weight includes administering an effective amount of this medicine for assisting losing weight to a subject in need thereof.... Agent: Sughrue Mion, PLLC 20070167399 - Therapeutic drug for traumatic neural disease (disorder) and/or motor function disorder: The object is to provide a therapeutic drug for traumatic neural disease (disorder) and/or motor function disorder, more particularly, a therapeutic drug for traumatic neural disease (disorder) and/or motor function disorder derived from spinal cord injury. A keratan sulfate oligosaccharide or a derivative thereof was found to have an effect... Agent: Tarolli, Sundheim, Covell & Tummino L.L.P. 20070167349 - Estrogen cancer therapy: Disclosed are methods for selecting a treatment for, and then treating various types of cancers in males and females, comprising delivery of an anti-cancer drug conjugated to a poly (amino acid) polymer, optionally in combination with estrogen therapy.... Agent: Lerner, David, Littenberg, Krumholz & Mentlik 20070167351 - Peptide/lipid complex formation by co-lyphilization: The invention relates to the formation of peptide/lipid vesicles and complexes through the co-lyophilization of peptides, preferably that are able to adopt an amphipathic alphahelical conformation, and one or more lipids. A single solution which solubilizes both the peptides and lipids or two separate solutions may be lyophilized.... Agent: Warner-lambert Company 20070167350 - Quinaldine based semisquaraines and squaraine dyes, process for preparation thereof and use thereof: The present invention provides quinaldine-based semisquaraines, symmetrical and unsymmetrical squaraine dyes represented by the general formulae 1, 2 and 3 and/or pharmaceutically acceptable derivatives thereof as sensitizers for photodynamic therapeutical and industrial applications. These symmetrical and unsymmetrical squaraine dyes posses absorption which extends well into the photodynamic window (650-800 nm)... Agent: Nixon & Vanderhye, PC 20070167352 - Methods and compositions for oxygen transport comprising a method for making a high oxygen affinity modified hemoglobin: The present invention relates to blood products, and more particularly to compositions comprising a modified oxygenated hemoglobin having a high affinity for oxygen and methods for making such compositions. Such compositions according to the present invention have better stability to autooxidation and superior oxygen carrying characteristics.... Agent: Gordon & Rees LLP 20070167353 - Prodrug composition: A prodrug composition is provided which includes a pharmaceutical species and an amino acid having a covalent bond to the pharmaceutical species. A particular pharmaceutical species is adenosine arabinoside, also known as Ara A and by the trade name vidarabine. Ara A prodrugs of the present invention have increased bioavailability... Agent: Gifford, Krass, Sprinkle,anderson & Citkowski, P.c 20070167355 - Dietary and pharmaceutical compositions for management and treatment of oxidative stress: Inhibition of TNF alpha prooxidant action is achieved after administration of biodegradable N-Acetyl-glucosamine-N-acetyl-muramyl-peptides released after specific endopeptidase and lysozyme digestion of the genus Lactobacillus and Bifidum. This invention also provides a medical food for dietary management of all conditions with elevated Gamma Glutamyl Transferase activity and concurrent alterations of NF-κB... Agent: Vladimir Slesarev 20070167356 - Glycosulfopeptide inhibitors of leukocyte rolling and methods of use thereof: Compounds, compositions and methods for treating conditions characterized by leukocyte rolling are described. The compounds contain glycosulfopeptide structures comprising sulfated tyrosines and sialyated, fucosylated N-acetyllactosamino glycans. The glycosulfopeptides may be conjugated or complexed to other compounds for enhancing serum half-life or for controlled release, for example. Examples of conditions treated... Agent: Dunlap, Codding & Rogers P.C. 20070167354 - Hydrogels for modulating cell migration and matrix deposition: A biodegradable matrix for inducing cell migration therein, wherein two peptides are covalently linked to the matrix, a first peptide being cleavable by natural proteases and the other comprising a cell-attracting peptide. The first peptide is cleavable by tissue metalloproteinases. The second peptide contains the cell-attracting peptide RGD. Also disclosed... Agent: Needle & Rosenberg, P.C. 20070167357 - Dab9 derivatives of lipopeptide antibiotics and methods of making and using the same: The present invention provides Dab9 derivatives of amphomycin-type lipopepetide antibiotics that display antimicrobial activity against Gram-positive bacteria, methods and intermediates for synthesizing the compounds and methods of using the compounds in a variety of contexts, including in the treatment and prevention of infections.... Agent: Darby & Darby P.C. 20070167358 - Prevention and treatment of ocular side effects with a cyclosporin: Therapeutic methods are disclosed herein.... Agent: Allergan, Inc. 20070167373 - Combined use of a glp-1 compound and a modulator of diabetic late complications: Methods and uses for treatment of diabetic late complications comprising administration of a GLP-1 compound and a modulator of diabetic complications.... Agent: Novo Nordisk, Inc. Patent Department 20070167364 - Compositions and methods for enhanced mucosal delivery of parathyroid hormone: Pharmaceutical compositions and methods are described comprising at least a parathyroid hormone peptide (PTH) preferably PTH1-34 and one or more mucosal delivery-enhancing agents for enhanced nasal mucosal delivery of PTH, for treating or preventing osteoporosis or osteopenia in a mammalian subject, preferably a human.... Agent: Nastech Pharmaceutical Company Inc 20070167365 - Compositions and methods for modulating blood-brain barrier transport: This invention provides conjugates of therapeutic or active agents with melanotransferrin or with other ligands of a melanotransferrin receptor, melanotransferrin receptor modulators, and related compositions and methods for modulating blood-brain barrier transport by, providing methods of screening and selecting such conjugates, ligands, and modulators in vitro and in vivo, and... Agent: Marshall, Gerstein & Borun LLP 20070167368 - Dried blood factor composition comprising trehalose: A method for preparing a stable dried composition of blood factor product containing a stabilizing amount of trehalose in the absence of a stabilizing amount of albumin is disclosed.... Agent: Morrison & Foerster LLP 20070167367 - Heterodimeric four helix bundle cytokines: Heterodimeric proteins comprising two helical bundle cytokines are disclosed. One of the polypeptides comprises zsig81 and a second polypeptide which comprises either p19 (aka IL-12A) or p35 (aka IL-12A). The proteins may be produced as fusion proteins or expressed as a single chain. The heterdimeric protein comprising zsig81 and p19... Agent: Zymogenetics, Inc. Intellectual Property Department 20070167360 - Methods for treating multiple sclerosis: This invention provides a method for treating a subject afflicted with multiple sclerosis comprising administering to the subject a therapeutically effective amount of soluble receptor for advanced glycation endproducts (sRAGE). This invention further provides a method for inhibiting CD4+ T-cell migration comprising contacting the CD4+ T-cell with soluble receptor for... Agent: Cooper & Dunham, LLP 20070167369 - Novel use of isolated polypeptide comprising four fas-1 domains, em1 domain and rgd motif: The present invention relates to the novel use of a polypeptide comprising an isolated polypeptide comprising EMI domain, four fas-1 domains and RGD motif of βig-h3. More particularly, the invention relates to a method for the inhibition of the adhesion, migration and/or proliferation of endothelial cells, and/or for the inhibition... Agent: Buchanan, Ingersoll & Rooney PC 20070167371 - Ocular tear growth factor-like protein: The present invention relates to a novel lacrimal gland protein (designated lacritin) and the nucleic acid sequences encoding that protein. Lacritin has activity as a growth factor on both human corneal epithelial cells and on the lacrimal acinar cells that produce it. Accordingly, one embodiment of the present invention is... Agent: University Of Virginia Patent Foundation 20070167372 - Ocular tear growth factor-like protein: The present invention relates to a novel lacrimal gland protein (designated lacritin) and the nucleic acid sequences encoding that protein. Lacritin has activity as a growth factor on both human corneal epithelial cells and on the lacrimal acinar cells that produce it. Accordingly, one embodiment of the present invention is... Agent: University Of Virginia Patent Foundation 20070167370 - Peptide analogues of gip for treatment of diapetes, insulin resistance and obesity: The present invention provides peptide analogues which are antagonists of gastric inhibitory peptide (GIP). The peptides, based on GIP 1-42 include substitutions and/or modifications which have enhanced resistance to degradation by the enzyme dipeptidyl peptidase IV (DPP IV). The invention also provides a process of N terminally modifying GIP and... Agent: Kirkpatrick & Lockhart Preston Gates Ellis LLP Formerly Kirkpatrick & Lockhart Nicholson Graham() 20070167366 - Peptide with putative role in cytoskeletal protection: The invention relates to a novel peptide conjugate useful for stabilizing the actin cytoskeleton of mammalian cells. More particularly, the invention relates to a conjugate of a peptide found within the sequence of a bacterium's major outer sheath protein and bovine serum albumin (BSA), and the use of this conjugate... Agent: Woodcock Washburn LLP 20070167359 - Pharmaceutical composition comprising proteins and/or polypeptides and colloidal particles: A pharmaceutical composition for parenteral administration comprising a therapeutically effective amount of a protein or polypeptide and colloidal particles. The particles comprise approximately 1-20 mole percent of an amphipathic lipid derivatized with a biocompatible hydrophilic polymer. The protein or polypeptide is selected from the group consisting of (a) proteins or... Agent: Nath & Associates 20070167363 - Specific antagonists for glucose-dependent insulinotropic polypeptide (gip): In one embodiment, this invention provides an antagonist of glucose-dependent insulinotropic polypeptide (GIP) consisting essentially of a 24 amino acid polypeptide corresponding to positions 7-30 of the sequence of GIP. In another embodiment, this invention provides a method of preventing and treating obesity and non-insulin dependent diabetes mellitus (Type II)... Agent: Edwards Angell Palmer & Dodge LLP 20070167361 - Use of factor xiii for stimulating the perfusion of ischemic tissue: Subject of the present invention is the use of a Factor XIII-preparation preferably in injectable form for the treatment of diseases which are associated with disturbed blood perfusion of the tissue following transient or permanent ischemia.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20070167374 - Specific antagonists for glucose-dependent insulinotropic polypeptide (gip): In one embodiment, this invention provides an antagonist of glucose-dependent insulinotropic polypeptide (GIP) consisting essentially of a 24 amino acid polypeptide corresponding to positions 7-30 of the sequence of GIP. In another embodiment, this invention provides a method of preventing and treating obesity and non-insulin dependent diabetes mellitus (Type II)... Agent: Edwards Angell Palmer & Dodge LLP 20070167375 - Peptide analogs capable of enhancing stimulation of a glioma-specific ctl response: The invention provides a peptide derived from the interleukin-13 receptor α2, which serves as a HLA-A2-restricted cytotoxic T lymphocyte (CTL) epitope. The invention can be used as a vaccine for glioma and can be formulated into compositions for medical or veterinary use. In addition, the invention provides the use of... Agent: Leydig Voit & Mayer, Ltd 20070167376 - Hexa-, hepta-, and octapeptides having antiangiogenic activity: Compounds of formula (SEQ ID NO:1), which are useful for treating conditions that arise from or are exacerbated by angiogenesis, are described. Also disclosed are pharmaceutical compositions comprising these compounds, methods of treatment using these compounds, and methods of inhibiting angiogenesis.... Agent: Robert Deberardine Abbott Laboratories 20070167377 - Inhibitors of glycinamide ribonucleotide transformylase: Potent human inhibitors of human glycinamide ribonucleotide transformylase and of aminoimidazole carboxamide ribonucleotide transformylase are designed, synthesized, and characterized.... Agent: The Scripps Research Institute 20070167378 - Compounds useful for the treatment of diseases associated with the formation of amyloid fibrils: R2 is a hydrogen atom, a C1-C6 alkyl group, a glycosyl; a C1-C6 polyhydroxyalkyl; —C(═O)—Rf group, where Rf is a C1-C6 alkyl group; or a —CH2—COO—Rg group, where Rg is a hydrogen atom or a C1-C6 alkyl group; and pharmaceutically acceptable salts thereof, which are useful in the treatment of... Agent: Intellectual Property / Technology Law 20070167379 - Use of spinosyns for wound healing: A spinosyn or a physiologically acceptable derivative or salt thereof for promoting or accelerating wound healing in humans.... Agent: Eli Lilly & Company 20070167382 - Crystalline and amorphous forms of telithromycin: Provided is telithromycin which melts at a range of 175° C. to 185° C. Also provided are solid states of telithromycin and processes for the preparation thereof.... Agent: Kenyon & Kenyon LLP 20070167381 - Macrolides with antiinflammatory activity: Macrolide compounds of formula (I) wherein X, R, R1, R2, R3 and R4, have the meanings as defined in the specification, pharmaceutically acceptable salts thereof, pharmaceutical compositions containing them as active ingredient and the use thereof in the treatment and prophylaxis of inflammatory diseases, are described.... Agent: Lucas & Mercanti, LLP 20070167380 - Taste masked compositions of erythromycin a and derivatives thereof: A pharmaceutical composition includes erythromycin A or a derivative thereof and alginic acid. The alginic acid provides taste masking of the erythromycin A or derivative. The erythromycin A derivative may be clarithromycin and the alginic acid may be one or both of alginic acid and its salt. The salt may... Agent: Ranbaxy Inc. 20070167383 - Nucleoside compounds for treating viral infections: Disclosed are compounds, compositions and methods for treating viral infections caused by a flaviviridae family virus, such as hepatitis C virus.... Agent: Foley & Lardner LLP 20070167385 - Antisense oligonucleotides (odn) against smad7 and uses in medical field thereof: The invention relates to antisense oligonucleotidic sequences (ODN) against Smad7 suitably modified, and their uses in medical field as therapeutic biological agents, in particular in the treatment of chronic inflammatory bowel disease, such as Crohn's disease and ulcerative colitis.... Agent: Young & Thompson 20070167389 - Compositions, devices and methods for treatment of huntington's disease through intracranial delivery of sirna: The present invention provides devices, small interfering RNAs, and methods for treating a neurodegenerative disorder comprising the steps of surgically implanting a catheter so that a discharge portion of the catheter lies adjacent to a predetermined infusion site in a brain, and discharging through the discharge portion of the catheter... Agent: Fox Rothschild LLP Princeton Pike Corporate Center 20070167390 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP 20070167391 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP 20070167392 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having a gapped motif and another strand having a gapped motif, a hemimer motif, a blockmer motif,... Agent: Woodcock Washburn LLP 20070167394 - Methods and compositions for diagnosing and suppressing metastasis thereof: Disclosed is a method for determining metastatic potential of tumors, a method and a composition for treating/suppressing metastasis of cancers, as well as a method for obtaining a metastasis suppressor. A particular aspect of the invention relates to a method and a composition of evaluating expression levels of connective tissue... Agent: Wpat, PC Intellectual Property Attorneys 20070167384 - Modified polynucleotides for use in rna interference: Methods and compositions for performing RNA interference comprising a wide variety of stabilized siRNAs suitable for use in serum-containing media and for in vivo applications, such as therapeutic applications, are provided. These siRNAs permit effective and efficient applications of RNA interference to applications such as diagnostics and therapeutics through the... Agent: Workman Nydegger (f/k/a Workman Nydegger & Seeley) 20070167387 - Novel artificial nucleic acids of n-o bond crosslinkage type: where Base is an aromatic heterocyclic group or the like optionally having a substituent; R1, R2 and R3 are each a hydrogen atom, a protective group for an amino group, a protective group for a hydroxyl group, a phosphate group, or —P(R4)R5 [where R4 and R5 are each a hydroxyl... Agent: Birch Stewart Kolasch & Birch 20070167388 - Nucleotide sequences promoting the trans-membrane transport of nucleic acids: The present invention relates to a novel system for the trans-membrane transport including the cellular uptake/delivery of nucleic acids, substances that contain a nucleic acid component, recombinant genetic material or substances that can be attached to a nucleic acid, in biological systems. In particular, the present invention relates to a... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP 20070167386 - Remedy for cardiac failure containing ask1 inhibitor as active ingredient and method for screening the same: The present invention provides a drug for at least one of prevention and treatment of cardiac failure capable of suppressing cardiac depression and the onset of cardiac failure in ventricular remodeling, and a method for screening the drug. The drug for at least one of prevention and treatment of cardiac... Agent: Hamre, Schumann, Mueller & Larson, P.C. 20070167393 - Rna interference mediated inhibition of gene expression using chemically modified short interfering nucleic acid (sina): The present invention concerns methods and reagents useful in modulating gene expression in a variety of applications, including use in therapeutic, diagnostic, target validation, and genomic discovery applications. Specifically, the invention relates to synthetic chemically modified small nucleic acid molecules, such as short interfering nucleic acid (siNA), short interfering RNA... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP 20070167395 - Compositions and methods for treating diabetes: Low molecular weight modified alginate and/or low molecular weight modified pectin, particularly modified citrus pectin (MCP), is useful in a composition for the treatment of diabetes, when administered to a diabetic individual. For instance, a composition comprising MCP is administered to an individual in an amount sufficient to reduce a... Agent: Steven B. Kelber, Esq. 20070167396 - Methods and compositions for cholesterol reduction in mammals: Provided herein are nutraceutical compositions and methods of formulating nutraceutical compositions for administration to regulate mammalian blood lipids. Also provided are methods of using purified exopolysaccharides for applications such as reducing cholesterol in mammals. Also provided are algal extracts containing nutraceutical small molecules including carotenoids and polyunsaturated fatty acids.... Agent: Solazyme, Inc. 20070167397 - Methods and compositions for joint lubrication: The invention provides novel polysaccharide molecules with high levels of viscosity. These compositions can be used for lubricating the joints of mammals to treat diseases of the joint such as osteoarthritis. Also provided are methods of using polysaccharides for applications such as lubricating joints. Also provided are methods of generating... Agent: Solazyme, Inc. 20070167398 - Methods and compositions for reducing inflammation and preventing oxidative damage: Provided herein are nutraceutical compositions with antioxidant properties. Also provided are methods of using polysaccharides for applications such as reducing inflammation, providing oxidation in mammalian tissue, and other uses. Also provided are algae capable of incorporating exogenously provided monosaccharides into polysaccharides synthesized in vivo to aid in antioxidant activity.... Agent: Solazyme, Inc. 20070167400 - Chitosan oligosaccharides and uses thereof: The present invention is directed towards compositions and methods for reducing or controlling inflammation and for treating inflammatory disease processes and other pathological conditions. The present invention relates to mixtures comprising at least one oligosaccharide of chitosan or a component thereof as novel pharmaceuticals, dietary supplements or cosmetic compositions containing... Agent: Ogilvy Renault LLP 20070167401 - Novel cyclodextrin derivatives, method for the preparation thereof and use thereof for the solubilization of pharmacologically active substances: The invention relates to a compound corresponding to general formula (I) wherein n is a whole number from 1-6, m is a whole number equal to 5, 6 or 7, R1 is an OH group, all R1s are identical, Z is an NHX group, X is a hydrogen atom, and... Agent: Young & Thompson 20070167402 - Product of coprecipitation of sparingly soluble substance and water-soluble polymer and process for producing the same: The present invention provides a coprecipitate of 2-(1-isopropoxycarbonyloxy-2-methylpropyl)-7,8-dimethoxy-4(5H), 10-dio xo-2H-1,2,3-triazolo[4,5-c][1]benzazepine and a water-soluble polymer, excellent in solubility and absorbability.... Agent: Heller Ehrman LLP 20070167403 - Remedy for spinal canal stenosis: A remedy for spinal canal stenosis which comprises a combination of a compound having EP2 agonism with a compound having EP3 agonism. A drug comprising a combination of a compound having EP2 agonism with a compound having EP3 agonism shows an efficacy in a rat gait disorder model induced by... Agent: Sughrue-265550 20070167404 - Surgical compositions for reducing the incidence of adhesions: A method of preventing or reducing the incidence of post-operative adhesions in or associated with a body cavity, which comprises introducing into the body cavity a composition containing an aqueous solution or suspension or gel formulation containing the polysaccharide dextrin.... Agent: Myers Bigel Sibley & Sajovec 20070167405 - Galectins -1 and -4 in tumor development: Methods of prognosis and of prophylactic and therapeutic treatment of tumors based on the involvement of galectin-1 and galectin-4 in tumor development are described.... Agent: Morrison & Foerster LLP 20070167406 - Dihydropyridine derivatives for use as human neutrophil elastase inhibitors: The invention relates to novel dihydropyridine derivatives, of Formula (I) processes for their preparation, and their use in medicaments, especially for the treatment of chronic obstructive pulmonary diseases, acute coronary syndrome, acute myocardial infarction and heart failure development.... Agent: Jeffrey M. Greenman 20070167407 - Quaternary ammonium borate compositions and substrate preservative solutions containing them: Termite repellant treated cellulosic substrates and methods or producing the same.... Agent: Edgar Spielman Albemarle Corporation 20070167409 - Compounds and methods for treating toll-like receptor 2-related diseases and conditions: The present invention relates to compounds and methods useful in the prevention or treatment of diseases or conditions associated with Toll-like receptor 2 activation.... Agent: Clark & Elbing LLP 20070167408 - Novel alkyl phospholipid derivatives with reduced cytotoxicity and uses thereof: The present invention provides novel alkyl phospholipid derivatives with reduced cytotoxicity that are useful for treating various diseases and/or pathophysiological conditions in mammals, preferably humans, that are caused by microorganisms, in particular bacteria, fungi, protozoa and/or viruses. Such alkyl phospholipids can be employed as single drugs or in the course... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C. 20070167410 - Immunosuppressant compounds and compositions: The present invention relates to immunosuppressants, processes for their production, their uses and pharmaceutical compositions containing them. The invention provides a novel class of compounds useful in the treatment or prevention of diseases or disorders mediated by lymphocyte interactions, particularly diseases associated with EDG receptor mediated signal transduction.... Agent: Genomics Institute Of The Novartis Research Foundation 20070167411 - Compositions for treating angina: A method of treating angina in a mammal includes administering pyridoxal-5′-phosphate, pyridoxal, pyridoxine, pyridoxamine, 3-acylated analogues of pyridoxal, 3-acylated analogues of pyridoxal-4,5-aminal, pyridoxine phosphonate analogues, or pharmaceutical compositions thereof.... Agent: Merchant & Gould PC 20070167412 - Halocombstatins and methods of synthesis thereof: The invention relates to novel compounds denominated halocombstatins. The halocombstatins are derivatives of combretastatin A-3, and include compounds that exhibit cancer growth cell inhibition against a panel of human cancer cell lines and the murine P388 leukemia, as well as activity as inhibitors of tubulin polymerization and inhibitors of the... Agent: Fennemore Craig 20070167413 - Novel heterocycles: The present invention relates to novel heterocyclic compounds of the general formula (I), their derivatives, analogs, tautomeric forms, stereoisomers, polymorphs, hydrates, solvates, pharmaceutically acceptable salts and compositions, metabolites and prodrugs thereof. The present invention more particularly provides novel hetereocycles of the general formula (I). Also included is a method of... Agent: Oliff & Berridge, PLC 20070167414 - Novel antibacterial agents: The present invention provides novel compounds of the general formula (I), their derivatives, their analogs, their tautomeric forms, their stereoisomers, their polymorphs, their hydrates, their solvates, their pharmaceutically acceptable salts and pharmaceutically acceptable compositions containing them. The present invention more particularly provides novel oxazolidinone derivatives of the general formula (I).... Agent: Oliff & Berridge, PLC 20070167415 - Tetracycline compounds for treatment of cryptosporidium parvum related disorders: Methods and compositions for treating Cryptosporidium parvum related disorders in a mammal are discussed. Several novel tetracycline compounds useful for treating Cryptosporidium parvum related disorders are also included.... Agent: Lahive & Cockfield, LLP 20070167416 - Formulations and uses of 2-hydroxy-5-phenylazobenzoic acid derivatives: A method of increasing the bioavailability of 5-aminosalicylate compound by administration of an oral dosage form with food is provided, as well as an article of manufacture comprising an oral dosage form of 5-aminosalicylate compound in a suitable container and associated with printed labeling which describes the increased bioavailability of... Agent: Edwards Angell Palmer & Dodge LLP 20070167417 - Process for the production of a sterol-rich composition: The invention relates to a process for the production of a sterol ester-rich composition. A sterol composition, a glyceride composition, a fatty acid alkyl ester and an esterification catalyst are combined to form a reaction mixture. Esterification of sterol(s) takes place in the mixture, providing sterol ester(s). The new process... Agent: Arent Fox PLLC 20070167418 - Progesterone/testosterone cream for erectile dysfunction: We have found a consistent pattern of hormonal abnormalities in patients with ERECTILE DYSFUNCTION. Our study group included men from age 21 to 88 years old. By helping to correct the hormonal imbalance of progesterone and testosterone towards normal values, most of the men in our study were able to... Agent: Steven W. Ferguson, Md, Cmd 20070167419 - Treatment for embolic stroke: Provided herein are methods and compositions for treating stroke that include contacting a subject suffering from a stroke with (1) an antioxidant; (2) an antioxidant and one or more of (i) a thrombolytic agent, (ii) an NMDA receptor antagonist and (iii) a spin trap agent; or (3) a thrombolytic agent... Agent: Buchanan, Ingersoll & Rooney LLP 20070167420 - Process for preparing a crystalline form of halobetasol propionate: The present invention provides a process for preparing a crystalline form of halobetasol propionate, comprising the step of crystallizing halobetasol propionate from absolute ethanol or a mixture of ethanol and water, wherein the crystalline form of halobetasol propionate is characterized by an x-ray powder diffraction pattern having peaks at 10.0,... Agent: Taro Pharmaceuticals U.s.a., Inc. C/o Venable LLP 20070167422 - Pharmaceutical compositions comprising 17-allylamino-17-demethoxygeldanamycin: A pharmaceutical formulation comprising (a) 17-allylamino-17-demethoxy-geldanamycin; (b) an ester of d-α-tocopheryl succinate and polyethylene glycol; and (c) a pharmaceutically acceptable, water-miscible organic solvent.... Agent: Kosan Biosciences, Inc 20070167421 - Pyrimidine derivatives and use thereof as agricultural and horticultural fungicides: p 20070167423 - Quinoline and quinazoline derivatives having affinity for 5ht1-type receptors: 20070167424 - Aztreonam l-lysine and methods for the preparation thereof: The present invention relates to the L-lysine salt of aztreonam and methods for making the L-lysine salt of aztreonam.... Agent: Cooley Godward Kronish LLP Attn: Patent Group 20070167425 - Compound capable of binding s1p receptor and pharmaceutical use thereof: wherein ring A is a cyclic group; ring B is a cyclic group which may have substituent(s); X is a spacer having 1 to 8 atoms in its main chain, etc.; Y is a spacer having 1 to 10 atoms in its main chain, etc.; n is 0 or 1,... Agent: Sughrue-265550 20070167426 - Compounds for the treatment of inflammatory disorders and microbial diseases: e 20070167427 - 1,2,4-triazolo[4,3-a]pyridines useful in the treatment of gastrointestinal disorders: 20070167428 - Thienopyrroles as antagonists of gnrh: The invention relates to a group of novel thieno-pyrrole compounds of Formula (I) wherein: R1, R2, R3, R4 and R5 are as defined in the specification, which are useful as gonadotrophin releasing hormone antagonists. The invention also relates to pharmaceutical formulations of said compounds, methods of treatment using said compounds... Agent: Astrazeneca R&d Boston 20070167429 - 4,4-difluoro-1,2,3,4-tetrahydro-5h-1-benzazepine derivative or salt thereof: A novel 4,4-difluoro-1,2,3,4-tetrahydro-5H-1-benzazepine derivative or a pharmaceutically acceptable salt thereof, which is useful as an agent for treating or preventing nocturia and/or diabetes insipidus, is provided.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20070167430 - Compounds useful in therapy: Compounds of formula (I), or a pharmaceutically acceptable derivative thereof, wherein: X represents NR or O; R represents hydrogen, C1-8 alkyl or SO2└C,1-8 alkyl┘; W represents N or CH; Y and Y′ independently represent hydrogen, halogen, OH, CF3, OCF3, CN, NH2 C1-8 alkyl, C1-8 alkyloxy or C3-8cycloalkyl; Ring A represents... Agent: Pfizer Inc 20070167431 - Method for the treatment of cognitive dysfunction: The present invention provides a method for the treatment of a cognitive disorder such as Alzheimer's disease in a patient in need thereof which comprises providing to said patient a therapeutically effective amount of a combination of an acetylcholinesterase inhibitor and a 5-hydroxytryptamine-6 antagonist.... Agent: Wyeth Patent Law Group 20070167432 - Tricyclic triazolobenzapine derivative produced as novel crystalline substance: The present invention provides a novel crystalline compound of the tricyclic triazolobenzazepine derivative, excellent in solubility and absorbability.... Agent: Heller Ehrman LLP 20070167433 - 3,4,5-substituted piperidines as therapeutic compounds: e 20070167434 - 6,7,8,9-substituted 1-phenyl-1,5-dihydro-pyrido[3,2-b]indol-2-ones useful as anti-infective pharmaceutical agents: 20070167436 - Cyclohexyl piperazinyl methanone derivatives: 20070167437 - Cis-imidazolines: 20070167435 - Phenoxypiperidines and analogs thereof useful as histamine h3 antagonists: R2 is optionally substituted alkyl, alkenyl, aryl, arylalkyl, heteroaryl, heteroarylalkyl, cycloalkyl or heterocycloalkyl; and the remaining variables are as defined in the specification; compositions and methods for treating an allergy-induced airway response, congestion, diabetes, obesity, an obesity-related disorder, metabolic syndrome and a cognition deficit disorder using said compounds, alone or... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990) 20070167438 - Treatment of substance abuse: 20070167439 - Methods of treating or preventing autoimmune diseases with 2,4-pyrimidinediamine compounds: The present invention provides methods of treating or preventing autoimmune diseases with 2,4-pyrimidinediamine compounds, as well as methods of treating, preventing or ameliorating symptoms associated with such diseases. Specific examples of autoimmune diseases that can be treated or prevented with the compounds include rheumatoid arthritis and/or its associated symptoms, systemic... Agent: Dechert LLP 20070167440 - Novel pyrrolidine compound and a process for preparing the same: The present invention relates to a novel pyrrolidine compound, which has a potent antagonistic activity against central cannabinoid (CB1) receptor, having the formula [I]: wherein each of R1 and R2 is (A) optionally substituted aryl (or heteroaryl) group, or (B) both of the groups combine to form a group of... Agent: Birch Stewart Kolasch & Birch 20070167442 - Chemical compounds: Compounds of formula (I): compositions comprising them, processes for preparing them and their use in medical therapy (for example modulating CCR5 receptor activity in a warm blooded animal).... Agent: Morgan Lewis & Bockius LLP 20070167443 - Substituted quinolones and methods of use: Substituted quinolone compounds and compositions are provided along with methods for the use of those compounds in the treatment of diseases and disorders such as cancer.... Agent: Townsend And Townsend And Crew, LLP 20070167441 - Xanthones, thioxanthones and acridinones as dna-pk inhibitors: Compound that inhibit DNA-dependent protein kinase, compositions comprising the compounds, methods of inhibiting the DNA-PK biological activity, methods of sensitizing cells the agents that cause DNA lesions, and methods of potentiating cancer treatment are disclosed.... Agent: Wolf Greenfield & Sacks, P.C. 20070167445 - Androgen receptor modulator compounds and methods: Compounds, pharmaceutical compositions, and methods for modulating processes mediated by steroid receptors. In particular, preparation and methods of use of non-steroidal compounds and compositions that are agonists, partial agonists, and antagonists for the androgen receptor (AR) are described. Further, described are the methods of making and use of critical intermediates... Agent: Fish & Richardson, PC 20070167444 - Benzamide derivative or salt thereof: There is provided a compound having a capsaicin receptor VR1 inhibitory activity and useful as a therapeutic agent for various pains including inflammatory pain and neurogenic pain, migraine, cluster headache, bladder diseases including overactive bladder, and the like. A benzamide derivative or a salt thereof wherein a benzene ring is... Agent: Sughrue-265550 20070167446 - Neuroprotective compounds and pharmaceutical compositions comprising them: e 20070167448 - Derivatives of sulphonamides, their preparation and use as medicaments: The present invention relates to new derivatives of sulphonamides, with the general formula (I), as well as to their physiologically acceptable salts, the processes for their preparation, their application as medicaments in human and/or veterinary therapy and the pharmaceutical compositions that contain them.... Agent: Katten Muchin Rosenman LLP 20070167447 - Indole acetamides as inhibitors of the hepatitis c virus ns5b polymerase: The present invention relates to indole and azaindole compounds of formula (I): wherein X1, X2, X3, X4, A1, Ar1, R1, R2 and n are as defined herein, and pharmaceutically acceptable salts thereof, useful in the prevention and treatment of hepatitis C infections.... Agent: Merck And Co., Inc 20070167450 - Agent for treating chronic pelvic pain syndrome: This invention relates to an agent for preventing or treating chronic pelvic pain syndromes (chronic abacterial prostatitis, chronic pelvic pain syndrome in a narrow sense and interstitial cystitis), which comprises various phosphodiesterase 4 (PDE 4) inhibitors such as cilomilast and roflumilast as an active ingredient.... Agent: Sughrue Mion, PLLC 20070167449 - Thiazole and pyrazole derivatives as flt-3 kinase inhibitors: The invention relates to thiazole and pyrazole derivatives of formula (I) wherein Q is S and X is C, or Q is CH and X is N; R1 is unsubstituted or substituted phenyl; and R2 is unsubstituted or substituted aryl or heteroaryl; or a salt of the said compounds, and... Agent: Novartis Corporate Intellectual Property 20070167451 - Barbituric acid derivatives as inhibitors of tnf-alpha converting enzyme (tace) and/or matrix metalloproteinases: e 20070167452 - Therapeutic amide derivatives: 20070167453 - Nitrogenous fused heteroaromatic ring derivative: 20070167454 - Methods for treating hypertension: The present invention relates to methods of treating subjects suffering from pre-hypertension or hypertension by administering to a subject in need of treatment thereof a therapeutically effective amount of at least one xanthine oxidoreductase inhibiting compound or salt thereof.... Agent: Wood, Phillips, Katz, Clark & Mortimer 20070167455 - Use of substituted 2-(diaza-bicyclo-alkyl)-pyrimidone derivatives for the treatment of neurodegenerative diseases: Wherein R1, R2, R3, R4 and n are as defined herein. Specifically, the compounds of formula (I) are used for preventive and/or therapeutic treatment of a neurodegenerative disease caused by abnormal activity of GSK3β, such as Alzheimer's disease. The invention relates also to intermediates for the preparation of compound of... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC 20070167456 - Mercaptoimidazoles as ccr2 receptor antagonists: a N-oxide, a pharmaceutically acceptable addition salt, a quaternary amine and a stereochemically isomeric form thereof, wherein R1 represents hydrogen, C1-6alkyl, C3-7cycloalkyl, C1-6alkyloxyC1-6alkyl, di(C1-6alkyl)aminoC1-6alkyl, aryl or heteroaryl; each R2 independently represents halo, C1-6alkyl, C1-6alkyloxy, C1-6alkylthio, polyhaloC1-6alkyl, polyhaloC1-6alkyloxy, cyano, aminocarbonyl, amino, mono- or di(C1-4alkyl)amino, nitro, aryl or aryloxy; R3 represents cyano,... Agent: Janssen Pharmaceutica N V 20070167457 - N-aroyl piperazine derivatives as orexin receptor antagonists: This invention relates to N-aroyl cyclic amino derivatives and their use as pharmaceuticals.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20070167458 - Tetrahydro-naphthalene and urea derivatives: This invention relates to a hydroxy-tetrahydro-naphthalene or an urea derivative formula (I) and salts thereof which are useful as active ingredients of pharmaceutical preparations, wherein A represents formula (II) or (III) wherein # represents the connection position to the molecule and Q1a, Q2a, Q3a and Q4a are defined, and E... Agent: Jeffrey M. Greenman 20070167459 - Nitrogen-containing heterocyclic compounds and medicinal use thereof: (wherein ring A represents a nitrogen-containing heterocyclic group which may have a substituent(s); ring B represents a homocyclic group which may have a substituent(s) or a heterocyclic group which may have a substituent(s); and Y represents a hydrocarbon group which may have a substituent(s), a heterocyclic group which may have... Agent: Sughrue-265550 20070167460 - Acetylenyl-pyrazolo-pyrimidine derivatives: h 20070167462 - Fungicidal mixtures: 20070167464 - Fungicidal mixtures: R is C1-C4-alkyl, in a synergistically effective amount, methods for controlling harmful fungi using mixtures of the compound I with the compound II and the use of the compound I with the compound II for preparing such mixtures, and also compositions comprising these mixtures.... Agent: Birch Stewart Kolasch & Birch 20070167465 - Fungicidal mixtures: i 20070167461 - Use of substituted 2-pyridinyl-6,7,8,9-tetrahydropyrimido[1,2-a] pyrimidin-4-one and 7-pyridinyl-2,3-dihydroimidazo[1,2-a] pyrimidin-5(1h)one derivatives as therapeutic agents: wherein m, n, p, X, Y, R1, R2, R3, R4 and R5 are as defined herein for treating a variety of disease states. More specifically, the invention relates to a medicament comprising the said derivative or a salt thereof as an active ingredient which is used for preventive and/or therapeutic... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC 20070167466 - \"pyrazolo [4,3-d]pyrimidines, processes for their preparation and methods of use\": The invention relates to 3-,7-disubstituted pyrazolo[4,3-d]pyrimidines represented by the general formula I (I), and pharmaceutically acceptable salts thereof, wherein R3 is selected from the group consisting of alkyl, cycloalkyl, cycloalkyl alkyl, cycloheteroalkyl alkyl, cycloheteroalkyl, aryl, heterocycle, heteroaryl, arylalkyl, heteroarylalkyl, and heteroalkyl, wherein each of the groups may optionally be substituted,... Agent: Michael Best & Friedrich, LLP 20070167467 - 1,5-disubstituted-3,4-dihydro-1h-pyrimido[4,5-d]pyrimidin-2-one compounds and their use in treating csbp/p38 kinase mediated diseases: Novel substituted pyrimido[4,5-d]pyrimidin-2-one compounds and compositions for use in therapy as CSBP/p38 kinase inhibitors.... Agent: Glaxosmithkline Corporate Intellectual Property - Uw2220 20070167468 - Substituted bicyclic 8-pyrr0lidinoxanthines, methods for their production, pharmaceutical formulations and their use: v 20070167469 - Pyrido-pyrimidine derivatives, preparation thereof, and therapeutic use thereof: 20070167470 - Spiro compounds and methods of use: The present invention relates to spiro compounds of formula I, processes for their preparation, pharmaceutical compositions containing them as active ingredient, methods for the treatment of disease states such as cancers associated with protein tyrosine kinases, especially epidermal growth factor (EGF) and vascular endothelial growth factor (VEGF), to their method... Agent: Advenchen Laboratories/g. Paul Chen 20070167471 - Substituted quinazoline compounds useful as p38 kinase inhibitors: e 20070167472 - Novel sulfamides: The invention relates to novel sulfamic acid amides of General Formula (I) and their use as active ingredients in the preparation of pharmaceutical compositions. The invention also concerns related aspects including processes for the preparation of the compounds, pharmaceutical compositions containing one or more of those compounds and especially their... Agent: Dickstein Shapiro LLP 20070167473 - Substituted pyridinyl and pyrimidinyl derivatives as modulators of metabolism and the treatment of disorders related thereto: e 20070167474 - Use of opioid receptor antagonist compounds for the prevention and/or treatment of diseases associated with the target calcineurin: Morphinane derivatives of the formula (I) their pharmaceutically acceptable salts are provided for use as medicaments for the treatment and/or prevention of disorders associated with the target calcineurin.... Agent: Cohen, Pontani, Lieberman & Pavane 20070167475 - Novel processes for the production of useful intermediates: The present application relates to a new process for the asymmetric production of 3-(pyridin-4-yl)-3-hydroxy-pentanoic acid derivatives, which are useful intermediates in the manufacture of compounds that are known to show antiproliferative activity.... Agent: Hunton & Williams LLP Intellectual Property Department 20070167476 - Piperazine, [1,4]diazepane, [1,4]diazocane, and [1,5]diazocane fused imidazo ring compounds: Piperazine, [1,4]diazepane, [1,4]diazocane, and [1,5]diazocane fused imidazo ring compounds (i.e., imidazoquinolines, tetrahydroimidazoquinolines, imidazonaphthyridines, tetrahydroimidazonaphthyridines, and imidazopyridines), pharmaceutical compositions containing the compounds, intermediates, methods of making, and methods of use of these compounds as immunomodulators, for inducing or inhibiting cytokine biosynthesis in animals and in the treatment of diseases including viral... Agent: 3m Innovative Properties Company 20070167477 - Processes to prepare finasteride polymorphs: Processes for preparing polymorphic crystalline Form I and Form III of finasteride.... Agent: Dr. Reddy's Laboratories, Inc. 20070167478 - Biomarkers for sensitivity of proliferative diseases to mtor inhibitors: Disclosed is a method for determining the sensitivity of a proliferate disease in a subject to treatment with an mTOR inhibitor, comprising determining the level of expression and/or phosphorylation state of S6 in a sample derived from the subject, as well as related methods of treatment and uses.... Agent: Novartis Corporate Intellectual Property 20070167479 - Immune response modifier formulations and methods: Pharmaceutical formulations including an immune response modifier (IRM) compound having a 2-aminopyridine moiety fused to a five-membered nitrogen-containing heterocyclic ring; a preservative system including a sorbic acid preservative selected from the group consisting of sorbic acid, esters thereof, salts thereof, and combinations thereof; an antioxidant; and an optional chelating agent.... Agent: 3m Innovative Properties Company 20070167480 - Pure and stable tiotropium bromide: This invention relates to solvates of tiotropium bromide having a purity of at least 99%, process for preparing such pure solvates, and their use in pharmaceutical formulations. This invention also provides tiotropium bromide solvates containing less than about 0.15% area by HPLC of 2,2-dithienyl glycolic acid.... Agent: Lerner, David, Littenberg, Krumholz & Mentlik 20070167481 - Imidazonaphthyridines: Imidazonaphthyridine and tetrahydroimidazonaphthyridine compounds induce the biosynthesis of cytokines such as interferon and tumor necrosis factor. The compounds exhibit antiviral and antitumor properties. Methods of preparing the compounds and intermediates useful in the preparation of the compounds are also disclosed.... Agent: 3m Innovative Properties Company 20070167482 - Novel guanidinyl-substituted hydroxy-6-phenylphenanthridines as effective phosphodiesterase (pde) 4 inhibitors: i 20070167484 - 6-alkoxy-pyrido-pyrimidines: 20070167483 - Phenylalanine enamide derivatives: or Rz is an atom or group as previously defined and Rx and Ry are joined together to form an optionally substituted spiro linked cycloaliphatic or heterocycloaliphatic group; and the salts, solvates, hydrates and N-oxides thereof. The compounds are able to inhibit the binding of integrins to their ligands and... Agent: Woodcock Washburn LLP 20070167485 - Pyrazolo[3,4-b]pyridine compounds, and their use as pde4 inhibitors: provided that: (a) R3b is methyl or ethyl; and/or (b) R3c and R3d are independently methyl or ethyl; and provided that: (c) when R3c is ethyl and/or when R3d is ethyl and/or when R3e is methyl, then: R3a is methyl and/or R3b is hydrogen or methyl. These compounds are PDE4... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20070167486 - Novel 2-oxo-heterocyclic compounds and the pharmaceutical compositions comprising the same: The present invention is related to new 2-oxo-cyclic compound the process for preparing them and a pharmaceutical composition comprising the same. The present invention provides a pharmaceutical composition for preventing and treating the inflammatory disease comprising the pain or inflammation caused by rheumatic disease, for example, rheumatoid arthritis, spondyloarthopathies, gout,... Agent: Kirk Hahn 20070167487 - Novel alkyl substituted piperidine derivatives and their use as monoamine neurotransmitter re-uptake inhibitors: This invention relates to novel alkyl substituted piperidine derivatives useful as monoamine neurotransmitter re-uptake inhibitors. In other aspects the invention relates to the use of these compounds in a method for therapy and to pharmaceutical compositions comprising the compounds of the invention.... Agent: Birch Stewart Kolasch & Birch 20070167488 - Novel therapeutic use: Certain oxindole compounds have been found to be effective in experimentally induced autoimmune encephalitis and are therefore suggested for the preparation of a medicament for the prevention, treatment or amelioration of multiple sclerosis, or to delay the onset of or reduce the relapse rate in multiple sclerosis.... Agent: Birch Stewart Kolasch & Birch 20070167489 - Combination comprising antimuscarinic agents and pde4 inhibitors: Combinations comprising (a) a PDE4 inhibitor and (b) an antagonist of M3 muscarinic receptors which is 3(R)-(2-hydroxy-2,2-dithien-2-ylacetoxy)-1-(3-phenoxypropyl)-1-azoniabicyclo[2.2.2]octane, in the form of a salt having an anion X, which is a pharmaceutically acceptable anion of a mono or polyvalent acid are useful, e.g., for the treatment of respiratory disease, e.g., asthma... Agent: Hoxie & Tso LLP 20070167490 - Imino ether derivative compounds and drugs containing the compounds as the active ingredient: (wherein R1 and R2 are cyclic group which may have a substituent(s) and so on; W is a spacer of which main chain has an atom number of 1-6.; X is —O— and so on; ring A is cyclic group which may have a substituent(s); Y is a spacer of... Agent: Sughrue-265550 20070167491 - 2-pyridinylethylcarboxamide derivatives and their use as fungicides: h 20070167492 - Molluscicidal agents: The invention relates to a molluscicidal agent of the formula: (I) wherein R1, A, X, Y, Z are as defined in claim 1, which is especially suited for controlling snails and/or slugs. Preferably the compound is thiacloprid. The invention further relates to methods of preventing mollusc-related damage to a plant... Agent: Morrison & Foerster LLP 20070167493 - Novel compounds for the management of aging-related and diabetic vascular complications, process for their preparation, therapeutic and cosmetic uses thereof: and its pharmaceutically or cosmetically acceptable salts, wherein R1, R2, R3, R4, R5, A, B, X and Y are as defined in the specification. The invention also discloses a process for preparation of these compound and their therapeutic and cosmetic applications particularly in the management of aging related and diabetic... Agent: Sughrue Mion, PLLC 20070167494 - Process for preparing a polymorph or rosiglitazone maleate: A crystallization process for preparing a polymorph of rosiglitazone maleate (Compound 1), and a process for preparing Compound 1 with a polymorphic purity that is suitable for use as a seed material in a crystallization process for preparing Compound 1.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20070167495 - Pleuromutilin derivatives, process for their preparation and uses thereof: c 20070167496 - Roflumilast and glycopyrronium combination: The invention relates to pharmaceutical formulations containing combinations of roflumilast and a pharmaceutically acceptable salt of glycopyrronium and the use of such pharmaceutical compositions in medicine, in particular in the prophylaxis and treatment of respiratory disease.... Agent: Nath & Associates PLLC 20070167497 - Therapeutic compounds: e 20070167498 - Carboxylic acid compounds: wherein R1 is H, alkyl; m is 2, 3; n is 0-2; R2 is phenyl, naphthyl, benzofuran, benzothiophene; Q is —CH2—O-Cyc1, —CH2-Cyc2, -L-Cyc3; R3a and R3b each independently is hydrogen, alkyl or taken together form tetrahydro-2H-pyran; a pharmaceutically acceptable salt thereof, a method for producing a process of the preparation... Agent: Sughrue-265550 20070167499 - Biaryl linked hydroxamates: preparation and pharmaceutical applications: The present invention relates to hydroxamate compounds which are inhibitors of histone deacetylase. More particularly, the present invention relates to biaryl containing compounds and methods for their preparation. These compounds may be useful as medicaments for the treatment of proliferative disorders as well as other diseases involving, relating to or... Agent: Connolly Bove Lodge & Hutz LLP 20070167501 - Bicyclo derivative: e 20070167500 - Remedy for urinary tract diseases: A preventive and/or a remedy for urinary tract diseases with symptoms such as urgency of urination, bladder pain, frequent urination or urine incontinence which comprises a combination of compound having antagonism to EP1 with another compound having antagonism to EP3 each selected from among prostaglandin E2 receptors. The combination of... Agent: Sughrue Mion, PLLC 20070167502 - Association between a heterocyclic compound and an antioxidant agent: A pharmaceutical composition for treatment of obesity associated with lipid and carbohydrate metabolism comprising (i) a substance which is useful in promoting lipid and carbohydrate metabolism, (ii) an antioxidant agent and, optionally, (iii) a pharmaceutically acceptable carrier or excipient, wherein the substance which promotes lipid and carbohydrate metabolism and the... Agent: The Firm Of Hueschen And Sage 20070167503 - Substituted benzoxazoles as estrogenic agents: p 20070167504 - Viral hepatitis treatment: The present disclosure relates to methods for treating viral hepatitis, compounds useful in the treatment of viral hepatitis, and pharmaceutical compositions comprising such compounds. In one embodiment, pharmaceutical compositions comprising nitazoxanide, tizoxanide, or derivatives and/or mixtures thereof are provided, as well as methods of treating hepatitis C using such compositions.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.c 20070167505 - Substituted benzimidazoles and their use for inducing apoptosis: wherein R represents aryl or heteroaryl, X is a bond, a carbonyl group, a derivative of a carbonyl group, an ethylene group or an ethylenecarbonyl group, R1 is optionally substituted amino or hydroxy, and the substituents R2 to R6 have the meanings given in the specification, to methods of synthesis... Agent: Gibbons P.C. 20070167506 - Substituted imidazoles: This invention relates to a range of alpha substituted 2-benzyl substituted imidazole compounds and pharmaceutically acceptable salts and solvates thereof, to compositions comprising such compounds, processes for their synthesis and their use as parasiticides.... Agent: Warner-lambert Company 20070167507 - 4-carbox pyrazole derivatives useful as anti-viral agents: i 20070167508 - Synergistic antifouling compositions comprising 4-bromo-2-(4-chlorophenyl)-5-(trifluoromethyl)-1h-pyrrole-3-carbonitrile: The present invention relates to antifouling compositions and particularly to compositions which are able to provide an improved protecting effect against fouling organisms. More particularly, the present invention relates to synergistic antifouling compositions comprising an amount of at least 3.5 wt %, based on the total weight of the dry... Agent: Philip S. Johnson Johnson & Johnson 20070167510 - Methods for inhibiting osteoclastogenesis: Methods for the treatment of osteolytic bone disease and for the inhibition of osteoclastogenesis are disclosed. The methods utilize COX-2 inhibitors and/or inhibitors of NF-κB activation, administered to patients in an amount effective to inhibit osteoclastogenesis. Also disclosed are methods to modulate the expression of MIP-1α in a subject.... Agent: Woodcock Washburn LLP 20070167509 - Use of phenserine and analogs to treat behavioral problems and improve trainability: A method of treating behavioral problems, including those related to aging, and improving trainability in dogs is disclosed. The method involves administering phenserine, a phenserine analog, derivative or a metabolite thereof to a pet or service dog in need of such treatment.... Agent: Dalina Law Group, P.C. 20070167511 - Medicinal composition for prevention or treatment of overactive bladder accompanying nervous disorder: m 20070167512 - Lipid metabolism improving agent: An object of the present invention is to provide a lipid metabolism improving agent, or to provide foods and drinks, food and drink additives, and feeds or feed additives for improving lipid metabolism. In order to achieve such an object, the present invention provides a lipid metabolism improving agent comprising... Agent: Fitzpatrick Cella Harper & Scinto 20070167513 - Crystalline forms of duloxetine free base: The present invention is concerned with duloxetine free base in crystalline form, and also novel polymorphic forms thereof... Agent: Conley Rose, P.C. 20070167514 - Cannabinoid derivatives, methods of making, and use thereof: 1′-substituted cannabinoid derivatives of delta-8-tetrahydrocannabinol, delta-9-tetrahydrocannabinol, and delta-6a-10a-tetrahydrocannabinol that have affinity for the cannabinoid receptor type-1 (CB-1) and/or cannabinoid receptor type-2 (CB-2). Compounds having activity as either agonists or antagonists of the CB-1 and/or CB-2 receptors can be used for treating CB-1 or CB-2 mediated conditions.... Agent: O'melveny & Myers LLP 20070167515 - Pyranone derivatives useful for treating cancer: The invention relates to pyranone derivatives of general formula (I), wherein X is chlorine, bromine or iodine and R1 and R2 is independently a hydrogen atom, an alkyl, cycloalkyl or alkylene, linear or branched group containing 1-20 carbon atoms, optionally substituted by a hydroxyl, amino, ether or halogen group, or... Agent: Foley And Lardner LLP Suite 500 20070167516 - Methods of using l-butylphthalide for the prevention and treatment of cerebral ischemia disease: The inventive subject matter relates to the use of L-butylphthalide in the manufacturing of medicaments for the prevention and treatment of cerebral ischemia-induced disease. Cerebral ischemia of the animals or human induces cerebral infarction, neurological deficit, memory disorder, cerebral edema, cerebral apoplexy, metabolic disorder of energy, changes of cerebral blood... Agent: Schwegman, Lundberg, Woessner & Kluth, P.A. 20070167517 - Stabilized derivatives of ascorbic aicd: Ascorbic acid derivatives of the general formula 1: wherein R<1> is a C2-C22 acyl group, an amino acid group, or a C1-C17 alkyl group; R<2> is ammonium or a metal cation; and each of R<3> or R<4>, independently, is hydrogen, a C2-C22 acyl group, an amino acid residue, or a... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw 20070167518 - Anti-tussive and bronchodilator actions of enaminone e121: The invention is the new and unique use of Enaminone E121 for its significant anti-tussive and anti-bronchoconstrictor actions. E121 has direct airway smooth muscle (ASM) relaxant effect. The combined antitussive/bronchodilatory effects of E121 make the compound a novel respiratory drug that may be effective in treatment of some types of... Agent: Jeffrey Furr 20070167519 - Novel angiogenesis inhibitors and pharmaceutical/cosmetic applications thereof: e 20070167520 - Process for the preparation of a composition comprising unsaturated compounds: The present invention relates to a process for the preparation of a composition comprising unsaturated compounds, in particular polyunsaturated compounds, which comprises concentrating and purifying the compounds by contact with silicon and/or aluminium derivatives. The process of the invention represents an advantageous substitute of the usual distillation processes, coupled or... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C. 20070167521 - Novel structural analogs of corosolic acid having anti-diabetic and anti-inflammatory properties: This invention relates to novel corosolic acid analogs of the formula I, wherein R1, R2, R3, R4 and R5 are as indicated below in each of said analogs: 1. R1=COCH3, R2=R3=R4=H, R5=COOH or R1, =R3=R4=H, R2=COCH3, R5=COOH 2. R1=R2=COCH3, R3=R4=H, R5=COOH 3. R1=COC5H4N, R2=R3=R4=H, R5=COOH 4. R1=COCH2NH2.HC1, R2=R3=R4=H, R5=COOH 5.... Agent: Rader Fishman & Grauer PLLC 20070167522 - Branched carboxylic acid compound and use thereof: wherein R1 represents optionally protected hydroxy or oxo, indicates α-configuration, β-configuration or a mixture of these in an arbitary proportion, n represents an integer of 1 to 3, and m represents 0 or an integer of 1 to 10; and wherein two or more R1's are not bound to... Agent: Sughrue-265550 20070167523 - Methods for producing nateglinide crystals: There is provided methods for producing nateglinide crystals, which comprises the steps of adding an acid(s) to a reaction mixture containing nateglinide to make it acidic, the reaction mixture being obtained by reacting trans-4-isopropylcyclohexylcarbonyl chloride with D-phenylalanine in a mixed solvent of ketone solvent and water in the presence of... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C. 20070167524 - Capsaicin derivates and the production and use thereof: The invention relates to new compounds, namely capsaicin derivates, a new method for their production, and their use as micro-organism-repellent agents in paints and coatings, in particular for marine installations and ships, but also for land-based structures.... Agent: Patterson & Sheridan, L.L.P. 20070167525 - Combinations of metformin and a meglitinide: Methods of treating glucose related disorders, for example by administering a meglitinide such as mitiglinide, repaglinide, or nateglinide, optionally in combination with a biguanide such as metformin, are described herein.... Agent: Fish & Richardson PC 20070167526 - Topical mecamylamine formulations for ocular administration and uses thereof: Provided are methods, pharmaceutical formulations and kits thereof for the treatment and/or prevention of conditions mediated by neovascularization, abnormal angiogenesis, vascular permeability, or combinations thereof, of posterior and/or anterior tissues and fluids of the eye, including conditions associated with proliferative retinopathies, for example, diabetic retinopathy, age-related maculopathy, retinopathy of prematurity,... Agent: Morrison & Foerster LLP 20070167527 - Memantine for the normalization of visual acuity deficits: A method for the treatment of disturbance of visual function which comprises administering a pharmaceutically effective amount of memantine to a patient in need of treatment of said disturbance.... Agent: Robert J. Baran (t2-7h) Allergan, Inc. 20070167528 - Methods of treating hepatocellular carcinoma with denspm: The disclosure provides methods for treating hepatocellular carcinoma. The methods include administering to a subject an effective amount of DENSPM to treat the hepatocellular carcinoma.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20070167529 - Antimicrobial compositions for treating fabrics and surfaces: Disclosed are antimicrobial compositions that can be applied to fabrics and/or surfaces for both immediate and residual antimicrobial action against bacteria and fungi in order to suppress the spread of infectious agents. Also disclosed are compositions that may be introduced during the process of laundering fabrics, typically during a later... Agent: Harness, Dickey & Pierce, P.L.C 20070167530 - Method for depletion of sulphur and/or compounds containing sulphur from a biochemically produced organic compound: Method of reducing the concentration of sulfur and/or a sulfur-containing compound in a biochemically prepared organic compound by bringing the respective organic compound into contact with an adsorbent. Ethanol which has a particular specification and can be prepared by the abovementioned method, and its use as solvent, disinfectant, as component... Agent: Connolly Bove Lodge & Hutz, LLP 07/12/2007 > patent applications in patent subcategories.20070161544 - Selective targeting agents for mitcochondria: The present invention relates to compositions and methods for providing mitochondria-selective targeting agents covalently linked to desired cargo such as radical scavenging agents. Compositions and methods are disclosed for treating an illness that is caused or associated with cellular damage or dysfunction which is caused by excessive mitochondrial production of... Agent: Eckert Seamans Cherin & Mellott 20070161573 - Selective targeting agents for mitochondria: Compositions and methods are disclosed for treating an illness that is caused or associated with cellular damage or dysfunction which is caused by excessive mitochondrial production of reaction oxygen species (ROS). Compositions which act as mitochondria-selective targeting agents using specific structural signaling features recognizable by cells as mitochondrial targeting sequences... Agent: Eckert Seamans Cherin & Mellott 20070161540 - Combinations of chromium or vanadium with antidiabetics for glucose metabolism disorders: Compositions and methods of using the same for the treatment of diabetes and other disorders of glucose metabolism are provided. Compositions may include an anti-diabetic agent and one or more of a bioavailable source of chromium and vanadium.... Agent: Foley Hoag, LLP Patent Group, World Trade Center West 20070161541 - Insult induced immune dissonance: The present invention is directed to the use of lactoferrin for alleviation of immune dissonance due to age-related and chronic conditions such as autoimmune disease, neurodegenerative and immune hypersensitivity conditions.... Agent: Kurt S. Myers 20070161543 - N-(phosphonoalkyl)-amino acids, derivatives thereof and compositions and methods of use: The present invention relates to an N-(phosphonoalkyl)-amino acid, a related compound or a derivative thereof, the N-(phosphonoalkyl)-amino acid, related compound or derivative thereof being in a form as a free acid, salt, partial salt, lactone, amide or ester, or in stereoisomeric or non-stereoisomeric form, other than N-(phosphonomethyl)-glycine or N,N-bis(phosphonomethyl)-glycine. Also... Agent: Akin Gump Strauss Hauer & Feld L.L.P. 20070161542 - Ptb1b photoprobes: Photoaffinity probes (photoprobes) of the PTP1B enzyme contain the trifluoromethylphenyl diazirene photophore attached to compounds which bind to the PTP1B enzyme. The photoprobes bind irreversibly to the PTP1B enzyme upon irradiation, and can be used to study the binding of compounds to the PTP1B enzyme. Compounds that bind to the... Agent: Merck And Co., Inc 20070161546 - Methods and compositions for treatment of cancer: A novel method of treating and preventing cancer diseases is provided. In particular, the present invention relates to compositions and methods for inhibition of cancer and the diseases associated with such cancers. More particularly, the present invention relates to the inhibitory compounds comprising naturally occurring and man-made compositions comprising a... Agent: Law Offices Of Khalilian Sira, LLC 20070161545 - Triple polypeptide complexes: The invention provides methods and materials related to treating and diagnosing autoimmune conditions. Specifically, the invention provides polypeptide compositions, nucleic acids, substantially pure polypeptides, host cells, and methods for identifying a mammal with an autoimmune condition, treating a mammal with an autoimmune condition, and enhancing tolerance in a mammal with... Agent: Fish & Richardson P.C. 20070161563 - A device for enhanced epithelial permeation of y2 receptor-binding peptides: A pharmaceutical device comprising a composition comprising an aqueous solution of PYY(3-36), a cyclodextrin, and a compound selected from phosphatidylcholine or diglyceride, wherein the cyclodextrin and the compound selected from phosphatidylcholine or diglyceride are present in an amount sufficient to enhance epithelial permeation, and wherein the composition is present in... Agent: Nastech Pharmaceutical Company Inc 20070161553 - Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation: A peptide molecule that interferes with an HLH domain of TAL-1 including at least 10 successive amino acids from the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1) or an equivalent sequence; and a pharmaceutical composition comprising at least one peptide molecule as an active ingredient, and... Agent: Ip Group Of Dla Piper US LLP 20070161556 - Antifungal therapeutic targets: The present invention provides therapeutic targets for antifungal treatment, especially CIK1.... Agent: Peter Eng, Esq. Wilson Sonsini Goodrich & Rosati 20070161550 - Antiviral compositions which inhibit paramyxovirus infection: The invention is directed to an antiviral for administration to a mammalian host (e.g., a human) susceptible to paramyxovirus infection, particularly respiratory syncytial virus (RSV) infection. In certain embodiments, an antiviral molecule of the invention is a polypeptide, a chemokine polypeptide, a chemokine polypeptide fragment, an organic small molecule or... Agent: Wyeth Patent Law Group 20070161557 - Casein derived peptides and uses thereof in therapy: Biologically active peptides that are derived from or are similar to sequences identical with the N-terminus of the oS1 fraction of milk casein. These peptides are capable of stimulating and enhancing immune response, protecting against viral infection, normalizing serum cholesterol levels, and stimulating hematopoiesis. The casein-derived peptides are non-toxic and... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.C. 20070161555 - Drug for inhibiting myometrial contraction: A composition for inhibiting spontaneous myometrial contraction or bradykinin-induced contraction, comprising adrenomedullin. The composition of the present invention may be used to selectively inhibit spontaneous myometrial contraction or bradykinin-induced contraction to prevent premature labor, prevent miscarriage, arrest parturition prior to cesarean section, or to treat dysmenorrhea.... Agent: Fay Sharpe LLP 20070161549 - Glycosylation-deficient hepatocyte growth factor: The invention provides a modified glycosylation-deficient HGF and a production method thereof. The glycosylation-deficient HGF is produced by introducing amino acid mutation(s) so that no glycosylation take place at at least one glycosylation site of hepatocyte growth factor.... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070161559 - Method for the treatment of gout or pseudogout: The present invention relates to a new method, and the process to manufacture a medicament, for treating gout or pseudogout, comprising administering an effective amount of inhibitors blocking IL-1 or its maturation by the NALP3 inflammasome.... Agent: Womble Carlyle Sandridge & Rice, PLLC 20070161567 - Method of reducing the risk of bone fracture: The invention relates to a method for increasing the toughness and/or stiffness of bone and/or reducing the likelihood and/or severity of bone fracture by administering a parathyroid hormone. The method can be employed to increase toughness or stiffness of bone at a site of a potential or actual trauma, such... Agent: Eli Lilly & Company 20070161566 - Method of treating multiple sclerosis: This invention provides a method of alleviating a symptom of a patient suffering from a relapsing form of multiple sclerosis which comprises periodically administering to the patient by subcutaneous injection a single dose of a pharmaceutical composition comprising 40 mg of glatiramer acetate so as to thereby alleviate the symptom... Agent: Cooper & Dunham, LLP 20070161551 - Methods and compositions for the treatment of lipodystrophy: The present invention is directed to methods and compositions for the treatment of lipodystrophy. The methods contemplate treatment of lipodystrophy in both HIV and non-HIV patients. More specifically, the methods are directed to a combination therapy that employs growth hormone and statins to effect treatment of lipodystrophy.... Agent: Marshall, Gerstein & Borun LLP 20070161564 - Methods for making apo-2 ligand using divalent metal ions: Methods of making Apo-2 ligand and formulations of Apo-2 ligand using divalent metal ions are provided. Such divalent metal ions include zinc and cobalt which improve Apo-2 ligand trimer formation and stability. The crystal structure of Apo-2 ligand is also provided, along with Apo-2 ligand variant polypeptides identified using oligonucleotide-directed... Agent: Genentech, Inc. 20070161561 - Modified vitamin k. dependent polypeptides: The invention provides vitamin K-dependent polypeptides with enhanced membrane binding affinity. These polypeptides can be used to modulate clot formation in mammals. Methods of modulating clot formation in mammals are also described.... Agent: Fish & Richardson P.C. 20070161547 - Modulation of survivin expression: Compounds and compositions are provided for modulating the expression of survivin. The compounds, exemplified by those acting through an RNAi antisense mechanism of action, include double-stranded and single-stranded constructs, as well as siRNAs, canonical siRNAs, blunt-ended siRNAs and single-stranded antisense RNA compounds. Methods of using these compounds for modulation of... Agent: Eli Lilly & Company 20070161558 - Production of vascular endothelial cell growth factor and dna encoding same: DNA isolates coding for a vascular endothelial cell growth factor may be used to produce the protein via recombinant expression systems. Such protein is useful therapeutically to treat conditions in which a selective action on the vascular endothelial cells, in the absence of excessive connective tissue proliferation, is desirable.... Agent: Genentech, Inc. 20070161565 - Signal transduction protein tab2: A novel signal transducer TAB2 which acts as an adapter molecule of TRAF6 and TAK1 and mediates the activation of TAK1 in the signal transduction of IL-1 was isolated. TAB2 induced the activation of NF-κB and JNK by IL-1. The signal transduction by IL-1 was inhibited by inhibiting the signal... Agent: Fish & Richardson PC 20070161562 - Targeting of long chain triacylglycerol hydrolase gene for tuberculosis treatment: Disclosed herein are novel methods for screening for compounds useful in treating or preventing tuberculosis. In exemplary embodiments, screening methods are based on the implementation or manipulation of triacylglycerol hydrolase like polypeptides or polynucleotides encoding the same. The methods are useful in identifying agents active against TB infection.... Agent: Beusse Wolter Sanks Mora & Maire 20070161554 - Treatment of neurodegenerative diseases by the use of laptm4b: The invention relates to the use of a LAPTM4B-interacting molecule for the preparation of a pharmaceutical composition for the treatment of a neurogenerative disease. Hereby the LAPTM4B-interacting molecule is preferably an inhibitor of LAPTM4B and particularly it has the capacity to modulate the activity of gamma-secretase and/or beta-secretase. Furthermore the... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C. 20070161548 - Use of adam 12 for diagnosis and therapy of preeclampsia: The present invention relates to the significant role of ADAM 12, ADAM 12-L, and ADAM 12-S in preeclampsia and related disorders. The invention further relates to the use of said genes and gene products, ligands binding to those, and modulators of activity of the gene products in diagnosis and treatment... Agent: Foley And Lardner LLP Suite 500 20070161568 - Use of glp-1 peptides: GLP-1(1-45) or a fragment or an analogue thereof can be used in the preparation of a medicament for peripheral administration in the suppression of appetite or induction of satiety.... Agent: Novo Nordisk, Inc. Patent Department 20070161552 - Use of low-dosage erythropoietin for stimulation of endothelial progenitor cells, for organ regeneration and for slowing the progression of end-organ damage: The present invention relates to the use of low-dosage erythropoietin for stimulation of physiological mobilization, proliferation and differentiation of endothelial progenitor cells, for stimulation of vasculogenesis, for therapy of diseases related to a dysfunction of endothelial progenitor cells, and for production of pharmaceutical compositions for treatment of such diseases as... Agent: Ostrolenk Faber Gerb & Soffen 20070161560 - Use of vanilloid 4 receptor and antagonists or agonists thereof for treating diseases associated with pain: The use of VR4 polypeptides and polynucleotides in the design of protocols for the treatment of diseases of cartilage, such as hyaline-, fibro- and elastic-cartilage, or diseases of tissues where such cartilage is found including diseases or disorders affecting the larynx, auditory canal, intervertebral discs, ligaments, tendons and joint capsules,... Agent: Glaxosmithkline Corporate Intellectual Property - Uw2220 20070161569 - Conformationally constrained parathyroid hormones with alpha-helix stabilizers: The present invention relates to conformationally constrained parathyroid hormone (PTH) analogs and derivatives of those analogs. The invention also provides methods of preparing and using the PTH analogs. Further, the invention encompasses compositions and methods for use in limiting undesired bone loss in a vertebrate at risk of such bone... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c. 20070161572 - Drug therapy for celiac sprue: Celiac Sprue and/or dermatitis herpetiformis are treated by interfering with HLA binding of immunogenic gluten peptides. The antigenicity of gluten oligopeptides and the ill effects caused by an immune response thereto are decreased by administration of an HLA-binding peptide inhibitor. Such inhibitors are analogs of immunogenic gluten peptides and (i)... Agent: Bozicevic, Field & Francis LLP 20070161571 - Injection solution of an lhrh antagonist: An aqueous injectable solution of an LHRH antagonist, such as Cetrorelix, in an organic, pharmaceutically acceptable acid, such as gluconic acid.... Agent: Goodwin Procter L.l.p 20070161570 - Methionine aminopeptidase-2 inhibitors and methods of use thereof: The present invention provides angiogenesis inhibitor compounds comprising a MetAP-2 inhibitory core coupled to a peptide, as well as pharmaceutical compositions comprising the angiogenesis inhibitor compounds and a pharmaceutically acceptable carrier. The present invention also provides methods of inducing an immunosupressed condition and/or treating chronic allograft vasculopathy in a subject... Agent: Lahive & Cockfield, LLP 20070161576 - Drugs for chronic pains: Nitro-oxyderivative compounds or salts thereof having the following general formula (I): A-(B)b0—(C)c0—NO2 wherein: c0 is an integer and is 0 or 1, b0 is an integer and is 0 or 1, A=R-T1-, wherein R is the radical of an analgesic drug for the chronic pain, in particular for the neuropathic... Agent: Arent Fox PLLC 20070161574 - Hcv ns-3 serine protease inhibitors: where the variables are as defined in the specification inhibit the NS3 protease of flavivirus such as hepatitis C virus (HCV). The compounds comprise a novel linkage between a heterocyclic P2 unit and those portions of the inhibitor more distal to the nominal cleavage site of the native substrate, which... Agent: Scully, Scott, Murphy & Presser, P.C. 20070161575 - Tri-peptide hepatitis c serine protease inhibitors: which inhibit serine protease activity, particularly the activity of hepatitis c virus (HCV) NS3-NS4A protease. Consequently, the compounds of the present invention interfere with the life cycle of the hepatitis c virus and are also useful as antiviral agents. The present invention further relates to pharmaceutical compositions comprising the aforementioned... Agent: Elmore Patent Law Group, PC 20070161577 - Tethered dimers and trimers of 1,4-diphenylazetidin-2-ones: Derivatives of 1,4-diphenylazetidin-2-ones useful for the treatment of hypercholesterolemia are disclosed. The compounds are of the general formula... Agent: Heslin Rothenberg Farley & Mesiti PC 20070161578 - Treatment of nonalcoholic fatty liver disease using cholesterol lowering agents and/or h3 receptor antagonist/inverse agonist: This invention provides for method for the treatment, prevention or ameliorating the symptoms of nonalcoholic fatty liver disease (NAFLD) in a mammal in need thereof comprising the step of administering an effective amount of a composition comprising a therapeutic combination of at least one cholesterol lowering agent and/or at least... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990) 20070161579 - Flavanone compound and uses thereof: i 20070161580 - Anti-tumor compounds with angeloyl groups: This invention provides a method for treating cancer by blocking the migration, metastasis of cancer cells, growth of cancers wherein the cancers comprise breast cancer, leukocyte cancer, liver cancer, ovarian cancer, bladder cancer, prostate cancer, skin cancer, bone cancer, brain cancer, leukemia cancer, lung cancer, colon cancer, CNS cancer, melanoma... Agent: Law Offices Of Albert Wai-kit Chan, LLC 20070161581 - Novel aminoglycoside antibiotics effective against methicillin resistant staphylococcus auerus (mrsas): Disclosed are compounds represented by general formula (I) or pharmacologically acceptable salts or solvates thereof having excellent antimicrobial activity against bacteria causative of severe infections such as pneumonia and septicemia, particularly against MRSA, and also antimicrobial agents comprising these compounds, and pharmaceutical compositions comprising these compounds as an active component.... Agent: Heller Ehrman LLP 20070161583 - Large dose ribavirin formulations: The present invention is related to pharmaceutical dosage forms of ribavirin which are designed to increase patient compliance to a ribavirin therapy. Examples of such dosage forms include 400 mg to 600 mg tablets. These dosage forms are bioequivalent to multiple doses of tablets containing small amounts of ribavirin.... Agent: Arent Fox PLLC 20070161582 - Pharmaceutical compositions and methods for metabolic modulation: Pharmaceutical compositions include compounds with cytokinin activity to modulate glucose and/or lipid metabolism in a mammal. Especially preferred compounds include those comprising a purine scaffold, and it is further preferred that contemplated compositions are employed to prevent and/or treat various diseases, including pre-diabetes, insulin resistance, type-2 diabetes, Syndrome X, and... Agent: Rutan & Tucker, LLP. Hani Z. Sayed 20070161589 - Antisense modulation of cd40 expression: Antisense compounds, compositions and methods are provided for modulating the expression of CD40. The compositions comprise antisense compounds, particularly antisense oligonucleotides, targeted to nucleic acids encoding CD40. Methods of using these compounds for modulation of CD40 expression and for treatment of diseases associated with CD40 are provided.... Agent: Knobbe, Martens, Olson & Bear, LLP 20070161587 - Cobalamin mediated delivery of nucleic acids, analogs and derivatives thereof: This invention is in the area of cobalamin-mediated delivery of nucleic acids and analogs and derivatives thereof to a host to affect gene expression.... Agent: Fish & Richardson P.C. 20070161593 - Compositions and their uses directed to il-4r alpha: Disclosed herein are compounds, compositions and methods for modulating the expression of IL-4R alpha in a cell, tissue or animal. Also provided are methods of target validation. Also provided are uses of disclosed compounds and compositions in the manufacture of a medicament for treatment of diseases and disorders related to... Agent: Knobbe, Martens, Olson & Bear, LLP 20070161594 - Compositions and their uses directed to il-4r alpha: Disclosed herein are compounds, compositions and methods for modulating the expression of IL-4R alpha in a cell, tissue or animal. Also provided are methods of target validation. Also provided are uses of disclosed compounds and compositions in the manufacture of a medicament for treatment of diseases and disorders related to... Agent: Knobbe, Martens, Olson & Bear, LLP 20070161586 - Drug for preventing and treating atherosclerosis: The present invention relates to a prophylactic/therapeutic agent for atherosclerosis comprising GM3 synthase inhibitor or inhibitor for expression of GM3 synthase gene, a diagnostic product for atherosclerosis comprising antibody to GM3 synthase, a method of diagnosis for atherosclerosis using antibody to GM3 synthase and others, an use of GM3 or... Agent: Foley And Lardner LLP Suite 500 20070161584 - Drug for preventing or treating heart diseases comprising cd9 gene: A drug for preventing or treating heart diseases which comprises an expression vector containing CD9 gene as the active ingredient. In the present invention, the term “heart diseases” means diseases causative of heart failure, ischemic heart diseases, cardiomyopathy, hypertensive heart diseases, valvular disease, congenital heart diseases, mayocarditis, arrhythmia and diseases... Agent: Fish & Richardson PC 20070161585 - Immunopotentiator and method for enhancing immunoactivity using the same: An immunopotentiator for enhancing an immunoactivity of mammals is characterized by comprising as an active ingredient a nucleic acid containing a special nucleic acid base, a derivative thereof or a plasmid having the nucleic acid containing the special nucleic acid base.... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070161592 - Method of treating fear: A method of treating conditions associated with fear memory in a mammal is provided. The method comprises inhibiting NR2B receptors in the ACC of the animal.... Agent: Gowling, Lafleur Henderson LLP 20070161595 - Method of treating neurodegenerative disease: Aspects featured in the invention relate to compositions and methods for inhibiting alpha-synuclein (SNCA) gene expression, such as for the treatment of neurodegenerative disorders. An anti-SNCA agent featured herein that targets the SNCA gene can have been modified to alter distribution in favor of neural cells.... Agent: Fish & Richardson PC 20070161591 - Methods and compositions for treating neurological disease: This invention relates to methods and compositions for treating neurological disease, and more particularly to methods of delivering iRNA agents to neural cells for the treatment of neurological diseases.... Agent: Lahive & Cockfield, LLP 20070161590 - Methods and sequences to preferentially suppress expression of mutated huntingtin: Disclosed herein are methods and sequences to preferentially suppress the expression of the mutated huntingtin (“htt”) protein over expression of the normal htt protein. Also disclosed are methods comprising screening an individual for the heterozygous presence of one or more single nucleotide polymorphisms within the individual's Huntington's genes; administering nucleic... Agent: Kirkpatrick & Lockhart Preston Gates Ellis LLP 20070161588 - Modulating cancer cell characteristics: The hedgehog pathway in cerebellar cancer cells was modulated with siRNA specifically targeted to the shh and gli-I genes. Silencing of the two genes in a medullablastoma cell line transfected with the siRNAs caused significant reduction of mRNA specific for the targeted shh and gli-I genes and a loss of... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association 20070161596 - Rna interference mediated treatment of alzheimer's disease using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating beta-secretase (BACE), amyloid precurson protein (APP), PIN-1, presenillin 1 (PS-1) and/or presenillin 2 (PS-2)gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of... Agent: Mcdonnell, Boehnen, Hulbert And Berghoff, LLP 20070161597 - Methods for decreasing or preventing pain using spicamycin derivatives: Methods of providing pain relief by administering a water-soluble derivative of spicamycin. Methods of using pain mediation agents are also provided.... Agent: Myers Bigel Sibley & Sajovec 20070161598 - Compositions and methods for treatment of disease with acetylated disaccharides: Compositions and methods for treatment of disease with acetylated disaccharides and analogs thereof are provided.... Agent: Procopio, Cory, Hargreaves & Savitch LLP 20070161599 - Composition for blocking hiv binding to dendritic cells and methods of use thereof: Compounds and compositions for inhibiting binding between dendritic cell-specific ICAM-3 grabbing non-integrin (DC-SIGN) and human immunodeficiency virus (HIV).... Agent: Marshall, Gerstein & Borun LLP 20070161600 - Methods and compositions for administration of iron: The present invention generally relates to treatment of iron-related conditions with iron carbohydrate complexes. One aspect of the invention is a method of treatment of iron-related conditions with a single unit dosage of at least about 0.6 grams of elemental iron via an iron carbohydrate complex. The method generally employs... Agent: Sonnenschein Nath & Rosenthal LLP 20070161601 - Propofol formulation containing reduced oil and surfactants: Sterile, stable pharmaceutical formulations of emulsions of neat propofol or propofol dissolved in a solvent and containing no preservative are provided that comprise optimal amounts of surfactants such as lecithin and solvent such as soybean oil, with a suitable pH range to prevent significant growth of microorganisms for at least... Agent: Leydig Voit & Mayer, Ltd 20070161602 - Phosphonate compounds: The present invention relates to phosphonate compounds, compositions containing them, processes for obtaining them, and their use for treating a variety of medical disorders, e.g., osteoporosis and other disorders of bone metabolism, cancer, viral infections, and the like.... Agent: Lisa A. Haile, J.d., Ph. D. Dla Piper US LLP 20070161603 - Method of administering bisphosphonates: Bisphosphonates, in particular more potent N-bisphosphonates such as zoledronic acid and derivatives, can be used with satisfactory results for treatment of RA by intermittent administration, wherein the periods between bisphosphonate administrations are from about 2 months up to about 4 months, e.g. once every 3 months.... Agent: Novartis Corporate Intellectual Property 20070161605 - Compounds and methods to increase anti-p-glycoprotein activity of baicalein by alkylation on the a ring: The present invention is directed to analogs of baicalein according to formula (I): where R5 is H, (C1-C12)alkyl, (C2-C13)acyl, or an optionally substituted phenyl or benzyl group, an acyl group, a C1-C20 alkyl or ether group, a phosphate, diphosphate, triphosphate or phosphodiester group; R6 and R7 are each independently H,... Agent: Coleman Sudol Sapone, P.C. 20070161604 - Highly active lysophosphatidic acid and method of screening therewith: [wherein the meaning of characters are described in the description] is used. The compounds obtained by the screening method or the screening kit of the present invention, their salts, their solvates and prodrugs thereof would modulate the binding of highly active LPA with LPA receptor in human and other mammals,... Agent: Sughrue Mion, PLLC 20070161606 - Solid and crystalline ibandronic acid: Provided are novel crystalline and amorphous forms of ibandronic acid, methods for their preparation, and pharmaceutical compositions containing them. Also provided are methods for purifying and assaying ibandronic acid in any crystalline form (or amorphous).... Agent: Kenyon & Kenyon LLP 20070161607 - Potassium channel modulators: This invention relates to novel compounds useful as potassium channel modulators. More specifically the invention provides chemical compounds useful as modulators of SKCa and/or IKCa channels.... Agent: Birch Stewart Kolasch & Birch 20070161608 - Selective androgen receptor modulators for treating muscle wasting: This invention provides SARM compounds and uses thereof in treating a variety of diseases or conditions in a subject, including, inter-alia, a muscle wasting disease and/or disorder or a bone-related disease and/or disorder.... Agent: Pearl Cohen Zedek Latzer, LLP 20070161609 - Use of mitochondrially targeted antioxidant in treatment and prevention of drug-induced liver disease: The present invention relates to the method of treatment or prophylaxis of patients with drug-induced liver diseases which comprises administering to the patient in need thereof a therapeutically effective amount of a mitochondrially targeted antioxidant compound e.g. derivatives of vitamin E, coenzyme Q10 or a glutathione peroxidase mimetic. The present... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070161610 - Bipolar trans carotenoid salts and their uses: The invention relates to trans carotenoid salt compounds, methods for making them, methods for solubilizing them and uses thereof. These compounds are useful in improving diffusivity of oxygen between red blood cells and body tissues in mammals including humans.... Agent: Nixon & Vanderhye, PC 20070161612 - Nitrate esters of corticoid compounds and pharmaceutical applications thereof: e 20070161611 - Polycyclic phenolic compounds and use in treating viral infections: The present invention provides antiviral polycyclic phenolic compounds (PPCs) for use in treating or preventing viral infections and associated conditions, such as infections by Flaviviridae, Hepadnaviridae, Herpesviridae, Papillomaviridae, Retroviridae, Adenoviridae, or respiratory viruses (such as Adenoviridae, Orthomyxoviridae, Paramyxoviridae and Coronaviridae).... Agent: Darby & Darby P.C. 20070161613 - Platinum complexes and methods for inhibiting tumor cell proliferation: The subject invention concerns platinum complexes that exhibit antitumor cell and/or antiparasitic activity. The subject invention also concerns the use of platinum complexes of the invention to treat oncological and inflammatory disorders. The platinum complexes of the invention can also be used to treat or prevent infection by a virus... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association 20070161614 - Pyridylether derivatives, their preparation and use: The present invention relates to novel pyridylether derivatives which are cholinergic ligands at nicotinic Ach receptors. The compounds of the invention are useful for the treatment of conditions, disorders, or diseases involving the cholinergic system of the central nervous system, pain, inflammatory diseases, diseases caused by smooth muscle contractions and... Agent: Birch Stewart Kolasch & Birch 20070161617 - Certain chemical entities, compositions and methods: Certain substituted urea derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, and are useful in the treatment of systolic heart failure including congestive heart failure.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20070161615 - Chemical compounds: Compounds of the formula (I), wherein variable groups are as defined within and a pharmaceutically acceptable salts and in vivo hydrolysable esters are described. Also described are processes for their preparation and their use as medicaments, particularly medicaments for producing a cell cycle inhibitory (anti cell proliferation) effect in a... Agent: Morgan Lewis & Bockius LLP 20070161616 - Method for treating glaucoma iib: m 20070161620 - Isoquinoline compound and pharmaceutical use thereof: 20070161618 - Isothiourea derivatives: The present invention relates to isothiourea derivatives, processes for their production, their uses, in particular in transplantation, autoimmune or infectious diseases, and pharmaceutical compositions containing them.... Agent: Novartis Corporate Intellectual Property 20070161619 - Pyrroloquinoline and piperidoquinoline derivatives, preparation thereof, compositions containing them and uses thereof: e 20070161621 - Spiroazacyclic compounds as monoamine receptor modulators: The present invention relates to spiroazacyclic compounds as monoamine receptor modulators; compositions comprising the same; methods of inhibiting an activity of a monoamine receptor with said compounds; methods of treating a disease condition associated with a monoamine receptor using said compounds; and methods for identifying a subject suitable for treatment... Agent: Knobbe Martens Olson & Bear LLP 20070161622 - Diamino alcohols and their use as renin inhibitor: The application relates to novel amino alcohols of the general formula (I) where R, R1, R2, R3, R4, R5 and R6 each have the definitions illustrated in detail in the description, to a process for their preparation, and to the use of these compounds as medicines, in particular as renin... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070161623 - Urea derivatives: Novel compounds of the formula (I), in which X—Y-D-E, R1, R2 and R3 have the meanings indicated in Patent claim 1, are inhibitors of coagulation factor Xa and can be employed for the prophylaxis and/or therapy of thromboembolic diseases and for the treatment of tumours... Agent: Millen, White, Zelano & Branigan, P.C. 20070161624 - Optically active quaternary ammonium salt having axial asymmetry and process for producing alpha-amino acid and derivative thereof with the same: The present invention provides a compound of the following formula (I) below. This compound (I) can be produced by reacting a 2,2′-dimethylene bromide-1,1′-binaphthyl derivative, which can be produced by a relatively small number of processes, with an easily available secondary amine. This compound (I) is useful as a chiral phase-transfer... Agent: Amin, Turocy & Calvin, LLP 20070161625 - Wound healing: A phenothiazinium compound, compositions and medicaments for use in promoting wound healing and a method for promoting wound healing or cosmetic use by applying or administering a phenothiazinium compound to a wound site or the skin, and optionally exposing the wound site or skin to light.... Agent: Morgan Lewis & Bockius LLP 20070161626 - Substituted indazoles, compositions containing the same, and the preparation and use thereof: Disclosed are novel substituted indazole compounds, pharmaceutical compositions comprising such compounds, and methods of treatment comprising such compounds.... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC 20070161627 - Antibacterial agents: Naphthalene, quinoline, quinoxaline and naphthyridine derivatives useful in the treatment of bacterial infections in mammals, particularly humans, are disclosed herein.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20070161628 - Phosphodiesterase inhibitors: The invention relates especially to novel stereospecific derivatives of 2,3-benzodiazepine type as inhibitors of phosphodiesterases, especially 2 and 4, and uses thereof in the therapeutic field, most particularly for preventing and treating pathologies involving a central and/or peripheral disorder. The compounds of the invention more particularly correspond to the general... Agent: Oliff & Berridge, PLC 20070161629 - A1 adenosine receptor antagonists: e 20070161630 - Tricyclic tetrahydroquinoline antibacterial agents: The invention includes tetrahydroquinoline and related compounds of formula I, and pharmaceutical compositions thereof, that exhibit useful antibacterial activity against a wide range of human and veterinary pathogens.... Agent: Warner-lambert Company 20070161631 - Substituted phenoxyacetic acids: Disclosed are substituted phenoxyacetic acids useful in the treatment of chronic complications arising from diabetes mellitus. Also disclosed are pharmaceutical compositions containing the compounds, alone or in combination with other therapeutic agents, and methods of treatment employing the compounds and pharmaceutical compositions, as well as methods for their synthesis.... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP 20070161632 - 4-amino-6-phenyl-pyrrolo[2,3-d]pyrimidine derivatives: wherein the symbols and substituents are as defined in the description, to processes for the preparation thereof, to pharmaceutical compositions comprising such derivatives and to the use of such derivatives—alone or in combination with one or more other pharmaceutically active compounds—for the preparation of pharmaceutical compositions for the treatment especially... Agent: Novartis Corporate Intellectual Property 20070161633 - 4-bromo-5-(2-chloro-benzoylamino)-1h-pyrazole-3-carboxylic acid (1-aminocarbonyl)eth-1-yl) amide derivatives and related compounds as bradykinin b1 receptor antagonists for the treatment of inflammatory diseases: Disclosed are compounds of formulae (I) and (II) that are bradykinin B1 receptor antagonists and are useful for treating diseases, or relieving adverse symptoms associated with disease conditions, in mammals mediated by bradykinin B1 receptor. Certain of the compounds exhibit increased potency and are also expected to exhibit increased duration... Agent: Foley & Lardner LLP 20070161634 - Compounds as ccr5 antagonists: The present invention discloses the compounds of formula I or their pharmaceutically acceptable salts, which are useful as CCR5 antagonists. The preparation and use of the compounds of formula I, pharmaceutical composition containing the same are also disclosed. Furthermore, the present invention discloses an intermediate for the preparation of the... Agent: Dorsey & Whitney LLP Intellectual Property Department 20070161635 - Kinase inhibitors: e 20070161636 - Method of analyzing physiological function of target substance: (in the formula, Q is a group for binding this compound with the target substance) to form a composite comprising the target substance and the photoactive compound; and (b) irradiating the obtained composite with light to inactivate the function of the target substance to which the photoactive compound has been... Agent: Morgan Lewis & Bockius LLP 20070161637 - Substituted pyridin-2-ylamine analogues: Substituted pyridin-2-ylamine analogues are provided, of the formula: wherein variables are as described herein. Such compounds are ligands that may be used to modulate specific receptor activity in vivo or in vitro, and are particularly useful in the treatment of conditions associated with pathological receptor activation in humans, domesticated companion... Agent: Edwards Angell Palmer & Dodge LLP 20070161638 - Compounds which potentiate glutamate receptor and uses thereof in medicine: wherein R1 is C1-6alkyl, haloC1-6alkyl, C2-6alkenyl, amino, monoC1-4alkylamino or diC1-4alkylamino; R2 and R3, which may be the same or different, are hydrogen, halogen, C1-6alkyl, haloC1-6alkyl, C1-4alkoxy, haloC1-4alkoxy, cyano, amino, monoC1-4alkylamino or diC1-4alkylamino; each R4, which may be the same or different, is C1-6alkyl, halogen, C1-6alkyl, haloC1-6alkyl, C1-4alkoxy, haloC1-4alkoxy, cyano, nitro,... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20070161640 - Cyclic dipeptides and azetidinone compounds and their use in treating cns injury and neurodegenerative disorders: The present invention provides 4-substituted-2-azetidinone compounds, bicyclic 2-5-diketopiperazine compounds, and pharmaceutical compositions thereof that are potent, safe and effective neuroprotective agents. Due to their strong central nervous system (CNS) activity, the compounds can be used to enhance memory and to treat a variety of neurological disorders. The compounds are particularly... Agent: Mark J. Cohen, Esq. Scully, Scott, Murphy & Presser, P.C. 20070161639 - Hiv integrase inhibitors: Pyridopyrazine- and pyrimidopyrazine-dione compounds are inhibitors of HIV integrase and inhibitors of HIV replication. In one embodiment, the dihydroxypyridine carboxamides are of Formula (I); wherein G, Q, bond a, R5, R6 and R7 are defined herein. The compounds are useful in the prevention and treatment of infection by HIV and... Agent: Merck And Co., Inc 20070161641 - Novel heterocyclic substituted carbonyl derivatives and their use as dopamine d3 receptor ligands: The invention relates to heterocyclic substituted carbonyl derivatives that display selective binding to dopamine D3 receptors. In another aspect, the invention relates is to a method for treating central nervous system disorders associated with the dopamine D3 receptor activity in a patient in need of such treatment comprising administering to... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC 20070161642 - Drug for inhibiting vascular intimal hyperplasia: [wherein each of R1, R2 and R3 is independently a hydrogen atom or a C1-6 alkyl group, X is a halogen atom, cyano or a hydrogen atom, Y is a halogen atom, trifluoromethyl or a hydrogen atom, and A is a C1-8 alkylene which may be substituted with a hydroxyl... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C. 20070161643 - Pyridin-2-one compounds useful as inhibitors of thrombin: wherein the dashed line, R1, R2, R3a, R3b, A, D, E, G and L have meanings given in the description, which compounds are useful as, or are useful as prodrugs of, competitive inhibitors of trypsin-like proteases, such as thrombin, and thus, in particular, in the treatment of conditions where inhibition... Agent: Pepper Hamilton LLP 20070161644 - Erastin analogs and uses thereof: The present invention relates to erastin analogs, particularly compounds of formulae VI, VIa, VII, and VIIa, as well as compounds 19, 20, and 20. The invention also relates to pharmaceutical compositions containing such analogs and to methods of treating a condition in a mammal with such analogs and compositions.... Agent: Kevin C. Hooper, Esq. Bryan Cave LLP 20070161645 - Thiazole inhibitors targeting resistant kinase mutations: wherein A is an aryl or heteroaryl group, Y is a hydrophbic linking moiety, and L is a substitutent. The compound (A) can be used for treatment of various angiogenic-associated or hematologic disorders, such as myeloproliferative disorders in patients who do not respond to kinase-inhibition therapy that comprises administering currently... Agent: Dla Piper US LLP 20070161646 - Piperidine derivatives and their use as modulators of chemokine receptor activity (especially ccr5): e 20070161647 - Quinoline-4-carboxamide derivatives as nk-3 and nk-2 receptor antagonists: A compound of formula (I) as detailed in the specification or a pharmaceutically acceptable salt or solvate thereof, a process for preparing such compounds, a pharmaceutical composition comprising such compounds and the use of such compounds in medicine.... Agent: Glaxosmithkline Corporate Intellectual Property-uw2220 20070161648 - Substituted dihydro-isoindolones useful in treating kinase disorders: c 20070161649 - Indole-type derivatives as inhibitors of p38 kinase: 20070161650 - Novel thiophene derivatives which are hm74a agonists: 20070161654 - Aryl-isoxazol-4-yl-imidazole derivatives: R1 to R6 are as defmed in the specification and pharmaceutically acceptable acid addition salts thereof. This class of compounds has high affinity and selectivity for GABA A α5 receptor binding sites and might be useful as cognitive enhancer or for the treatment of cognitive disorders like Alzheimer's disease.... Agent: Hoffmann-la Roche Inc. Patent Law Department 20070161652 - Fungicidal mixtures: 20070161653 - Pyrazolo-pyridine derivatives as antiherpes agents: 20070161651 - Tie-2 modulators and methods of use: The present invention provides compounds for modulating protein kinase enzymatic activity for modulating cellular activities such as proliferation, differentiation, programmed cell death, migration and chemoinvasion. Compounds of the invention inhibit, regulate and/or modulate kinases, particularly Tie-2. Methods of using the compounds and pharmaceutical compositions thereof to treat kinase-dependent diseases and... Agent: Mcdonnell Boehnen Hulbert @ Berghoff LLP 20070161655 - Fungicidal mixtures: e 20070161657 - Crystalline n-(4-(4-aminothieno[2,3-d]pyrimidin-5-yl)phenyl)-n'-(2-fluoro-5-(trifluoromethyl)phenyl)urea hydrobromide: A crystalline N-(4-(4-aminothieno[2,3-d]pyrimidin-5-yl)phenyl)-N′-[2-fluoro-5-(trifluoromethyl)phenyl)urea hydrobromide, ways to make it, compositions comprising it, and methods of treatment using it are disclosed.... Agent: Robert Deberardine Abbott Laboratories 20070161658 - Crystalline n-(4-(4-ammoniumthieno[2,3-d]pyrimidin-5-yl)phenyl)-n'-(2-fluoro-5-(trifluoromethyl) phenyl)urea camphorsulfonate: A crystalline N-(4-(4-ammoniumthieno[2,3-d]pyrimidin-5-yl)phenyl)-N′-(2-fluoro-5-(trifluoromethyl)phenyl)urea camphorsulfonate, ways to make it, compositions comprising it, and methods of treatment using it are disclosed.... Agent: Robert Deberardine Abbott Laboratories 20070161659 - Crystalline n-(4-(4-ammoniumthieno[2,3-d]pyrimidin-5-yl)phenyl)-n'-(2-fluoro-5-(trifluoromethyl)phenyl)urea benzenesulfonate: A crystalline N-(4-(4-ammoniumthieno[2,3-d]pyrimidin-5-yl)phenyl)-N′-(2-fluoro-5-(trifluoromethyl)phenyl)urea benzenesulfonate, ways to make it, compositions comprising it, and methods of treatment using it are disclosed.... Agent: Robert Deberardine Abbott Laboratories 20070161661 - Crystalline n-(4-(4-ammoniumthieno[2,3-d]pyrimidin-5-yl)phenyl)-n'-(2-fluoro-5-(trifluoromethyl)phenyl)urea ethanesulfonate: A crystalline N-(4-(4-ammoniumthieno[2,3-d]pyrimidin-5-yl)phenyl)-N′-(2-fluoro-5-(trifluoromethyl)phenyl)urea ethanesulfonate, ways to make it, compositions comprising it, and methods of treatment using it are disclosed.... Agent: Robert Deberardine Abbott Laboratories 20070161660 - Crystalline n-(4-(4-ammoniumthieno[2,3-d]pyrimidin-5-yl)phenyl)-n'-(2-fluoro-5-(trifluoromethyl)phenyl)urea maleate: A crystalline N-(4-(4-ammoniumthieno[2,3-d]pyrimidin-5-yl)phenyl)-N′-(2-fluoro-5-(trifluoromethyl)phenyl)urea maleate, ways to make it, compositions comprising it, and methods of treatment using it are disclosed.... Agent: Robert Deberardine Abbott Laboratories 20070161656 - N-(4-(4-aminothieno[2,3-d]pyrimidin-5-yl)phenyl)-n'-(2-fluoro-5-(trifluoromethyl)phenyl)urea crystalline form 2: N-(4-(4-Aminothieno[2,3-d]pyrimidin-5-yl)phenyl)-N′-[2-fluoro-5-(trifluoromethyl) phenyl)urea Crystal Form 2, ways to make it, compositions comprising it, and methods of treatment using it are disclosed.... Agent: Robert Deberardine Abbott Laboratories 20070161662 - 6-arylmethyl-substituted pyrazolopyrimidines: The invention relates to novel 6-arylmethyl-substituted pyrazolopyrimidines, process for their preparation and their use for producing medicaments for improving perception, concentration, learning and/or memory.... Agent: Jeffrey M. Greenman 20070161663 - Agents for treating migraine: e 20070161664 - Therapeutic compounds: 20070161665 - Cancer treatment method: The present invention relates to a method of treating cancer in a mammal and to pharmaceutical combinations useful in such treatment. In particular, the method relates to a cancer treatment method that includes administering an erb family inhibitor and a PI3K and/or Akt inhibitor to a mammal suffering from cancer.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475 20070161667 - Process for preparing inhibitors of nucleoside metabolism: e 20070161666 - Pyrrolo[2,3-d]pyrimidine compounds: 20070161668 - Di-ester prodrugs of camptothecin, process for their preparation and their therapeutical applications: The present invention is related to 10,20-di-O ester derivatives of camptothecin and pharmaceutical formulations thereof. The compounds and pharmaceutical formulations of the present invention possess increased biological life span and bioavailability and reduced toxicity, while maintaining anti-cancer activity.... Agent: Leydig Voit & Mayer, Ltd 20070161669 - Benz-indole and benzo-quinoline derivatives as prodrugs for tumor treatment: Compounds of the general formula (I) or (IA) in which X is H, Y is a leaving group, R1 preferably being an aromatic DNA binding subunit are prodrug analogues of duocarmycin. The compounds are expected to be hydroxylated at the carbon atom to which C is joined, by cytochrome P450,... Agent: Dickstein Shapiro LLP 20070161670 - Process for the preparation of substituted heterocycles: The present disclosure generally relates to a process for the preparation of hydroxy-substituted heterocycles such as isoquinolines, naphthyridines, pyridopyridazines, and pyridopyrimidines.... Agent: Louis J. Wille Bristol-myers Squibb Company 20070161671 - 7-azaindoles and the use thereof as therapeutic agents: The invention relates to substituted 7-azaindoles, process for their preparation, pharmaceutical preparations which comprise these compounds, and the pharmaceutical use of these compounds, which are inhibitors of phosphodiesterase 4, as active ingredients for the treatment of disorders which can be influenced by inhibition of phosphodiesterase 4 activity in particular in... Agent: Fulbright & Jaworski, LLP 20070161672 - Compounds: Thienopyridine compounds which are potassium channel inhibitors are described. Pharmaceutical compositions comprising the compounds and their use in the treatment or prevention of cancer, arrhythmias, autoimmune diseases and inflammatory diseases, including gastric cancer, atrial fibrillation, type-2 diabetes mellitus, rheumatoid arthritis, type-1 diabetes, inflammatory bowel disorder and demyelinating disorders such as... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c. 20070161673 - P38 kinase inhibitors: i 20070161674 - Certain chemical entities, compositions, and methods: Compounds useful for treating cellular proliferative diseases are disclosed.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20070161675 - Processes for hydrazine addition to acrylic macromonomers and products therefrom: Processes for forming adducts of hydrazines with acrylic macromonomers are provided. Also provided are processes for using ring-closing reactions of the adducts to form aminolactams. The adducts are useful, for example, for making adhesives, surfactants, viscosity modifiers, processing aids, and other products.... Agent: E I Du Pont De Nemours And Company Legal Patent Records Center 20070161676 - Indole derivatives as histamine 3 receptor inhibitors for the treatment of cognitive and sleep disorders, obesity and other cns disorders: This invention relates to compounds having pharmacological activity, to compositions containing these compounds, and to a method of treatment employing the compounds and compositions. More particularly, this invention concerns certain indole derivatives and their salts and solvates. These compounds have H3 histamine receptor antagonist activity. This invention also relates to... Agent: Wood, Phillips, Katz, Clark & Mortimer 20070161677 - Bisarylurea derivatives: The present invention relates to bisarylurea derivatives of formula (I), the use of the compounds of formula (I) as inhibitors of raf-kinase, the use of the compounds of formula (I) for the manufacture of a pharmaceutical composition and a method of treatment, comprising administering said pharmaceutical composition to a patient.... Agent: Baker & Daniels LLP 20070161678 - Methods for the synthesis of pyridoxamine: e 20070161682 - Compounds useful for the synthesis of s- and r-omeprazole and a process for their preparation: The present invention relates to an improved method for the synthesis of the (S)- or (R)-enantiomer of omeprazole, characterized in that 2-[[(4-X-3,5-dimethylpyridin-2-yl)methyl]thio]-5-methoxy-1H-benzimidazole or 2-[[(4-X-3,5-dimethyl-1-oxidopyridin-2-yl)methyl]thio]-5-methoxy-1H-benzimidazole, wherein X is a leaving group, is oxidized into the corresponding sulphoxide which is obtained as a crystalline compound. Recrystallisation of the thus obtained sulphoxide results... Agent: White & Case LLP Patent Department 20070161681 - Ether derivatives useful as inhibitors of pde4 isozymes: e 20070161679 - Method and compositions for the intravenous administration of compounds related to proton pump inhibitors: Disclosed herein are liquid compositions comprising a therapeutically effective concentration of a prodrug of a sulfonyl-containing proton pump inhibitor, wherein said compositions have a pH of from 3 to 7.3. Solid compositions related thereto are also disclosed. Methods of delivering a proton pump related thereto are also disclosed. Compositions comprising... Agent: Allergan, Inc. 20070161680 - Substituted benzimidazoles and methods of their use: New substituted benzimidazole compounds, compositions, and methods of inhibition of kinase activity associated with tumorigenesis in a human or animal subject are provided. In certain embodiments, the compounds and compositions are effective to inhibit the activity of at least one serine/threonine kinase or receptor tyrosine kinase. The new compounds and... Agent: Novartis Vaccines And Diagnostics Inc. 20070161683 - Certain chemical entities, compositions, and methods: Compounds useful for treating cellular proliferative diseases are disclosed.... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20070161684 - 3-aminocarbonyl, 6-phenyl substituted pyridine-1-oxides as p38 kinase inhibitors: m 20070161685 - Heterocyclic cetp inhibitors: 20070161687 - 1,2,4-oxadiazole benzoic acid compositions and their use for nonsense suppression and the treatment of disease: Novel 1,2,4-oxadiazole benzoic acid compounds, methods of using and pharmaceutical compositions comprising an 1,2,4-oxadiazole benzoic acid derivative are disclosed. The methods include methods of treating or preventing a disease ameliorated by modulation of premature translation termination or nonsense-mediated mRNA decay, or ameliorating one or more symptoms associated therewith.... Agent: Jones Day 20070161686 - Aryl-isoxazolo-4-yl-oxadiazole derivatives: R3, are as defined in the specification and pharmaceutically acceptable acid addition salts thereof. This class of compounds has high affinity and selectivity for GABA A α5 receptor binding sites and might be useful as cognitive enhancer or for the treatment of cognitive disorders like Alzheimer's disease.... Agent: Hoffmann-la Roche Inc. Patent Law Department 20070161688 - Fungicidal combinations of active substances: , 20070161689 - Indoles having anti-diabetic activity: Indoles having aryloxyalkanoic acid substituents or arylalkanoic acid substituents are agonists or partial agonists of PPAR gamma and are useful in the treatment and control of hyperglycemia that is symptomatic of type II diabetes, as well as dyslipidemia, hyperlipidemia, hypercholesterolemia, hypertriglyceridemia, and obesity that are often associated with type 2... Agent: Merck And Co., Inc 20070161690 - Compounds and methods for inhibiting the interaction of bcl proteins with binding partners: One aspect of the present invention relates to heterocyclic compounds that bind to bcl proteins and inhibit Bcl function. Another aspect of the present invention relates to compositions comprising a heterocyclic compound of the invention. The present invention provides methods for treating and modulating disorders associated with hyperproliferation, such as... Agent: Foley Hoag, LLP Patent Group, World Trade Center West 20070161691 - Modified-protein formation inhibitor: (wherein R1 and R2 represent monovalent organic groups identical with or different from each other). This inhibitor of protein modification products formation is useful in the prevention and treatment of diseases associated with AGEs and ALEs, for example, used as a renal tissue protectant alone or in mixture in a... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070161692 - Conformationally restricted polyamine analogs as disease therapies: Novel conformationally restricted polyamine analogs are provided, as well as compositions comprising these novel polyamine analogs. Methods of using the novel polyamine analogs in treatment of diseases such as cancer are also provided. Also provided is a method of delivering these analogs specifically to tumor cells by covalently attaching polyamine... Agent: Morrison & Foerster LLP 20070161693 - Analogs of salinosporamide a: Like Salinosporamide A, the compounds of the present invention will inhibit the proteasome, an intracellular enzyme complex that destroys proteins the cell no longer needs. Without the proteasome, proteins would build up and clog cellular machinery. Fast-growing cancer cells make especially heavy use of the proteasome, so thwarting its action... Agent: Banner & Witcoff, Ltd. 20070161694 - Use of indirubin as a dietary supplement: A method is disclosed for administering naturally occurring chemical Indirubin or its derivatives such as, for example, Indirubin-3′-monoxime, as a method of increasing skeletal muscle mass, decreasing skeletal muscle breakdown and/or decreasing fat mass.... Agent: Miller, Canfield, Paddock And Stone P.L.C C/o Robert Kelley Roth 20070161695 - Hydroisoindoline tachykinin receptor antagonists: The present invention is directed to certain hydroisoindoline compounds which are useful as neurokinin-1 (NK-1) receptor antagonists, and inhibitors of tachykinin and in particular substance P. The invention is also concerned with pharmaceutical formulations comprising these compounds as active ingredients and the use of the compounds and their formulations in... Agent: Merck And Co., Inc 20070161696 - Methods of using and compositions comprising selective cytokine inhibitory drugs for treatment, modification and management of pain: Methods of treating, preventing, modifying and managing various types of pain are disclosed. Specific methods comprise the administration of a selective cytokine inhibitory drug, or a pharmaceutically acceptable salt, solvate, hydrate, stereoisomer, clathrate, or prodrug thereof, alone or in combination with a second active agent and/or surgery, psychological or physical... Agent: Jones Day 20070161697 - Hydrazide type compounds and the use thereof in pharmaceutical compositions for the treatment of cardiovascular diseases: The invention relates to compounds of general formula (I), where R1 and R2 are independently selected from a hydrogen atom, a branched or straight chain alkyl with 1 to 6 carbon atoms, a fluoroalkyl group with 1 to 6 carbon atoms and 3 to 7 fluorine atoms, A is an... Agent: Young & Thompson 20070161698 - Modulators of crth2 activity: Modulators of the CRTH2 receptor and their use in the treatment of various disorders, including asthma are described.... Agent: Fish & Richardson PC 20070161700 - Inhibitor for the formation of y-secretase complex: It is intended to provide an inhibitor for the formation of a γ-secretase complex which comprises a cholesterol synthesis inhibitor or a protein geranylgeranylation regulator as the active ingredient; and use of a cholesterol synthesis inhibitor or a protein geranylgeranylation regulator for producing the same. It is also intended to... Agent: Westerman, Hattori, Daniels & Adrian, LLP 20070161699 - Method of preventing or treating glaucoma: The present invention relates, in general, to glaucoma and, in particular, to a method of preventing or treating glaucoma using statins.... Agent: Michael Best & Friedrich, LLP 20070161701 - 4-oxo-4,5-dihydro-furan-2-carboxylic acid derivatives and methods of treatment of metabolic-related disorders thereof: System for selecting a colour shade comprising a very small number of colour display cards with mixed shades of two or more colours. The system comprises means for selecting one shade among mixed shades, means for presenting the selected mixed shade as well as means for specifying the selected mixed... Agent: Fish & Richardson P.C. 20070161702 - Abca1 stabilizer: To provide a pharmaceutically effective prophylactic/preventive agent for low-HDL cholesterolemia, focusing on an HDL-generating mechanism. The ABCA1 stabilizer of the present invention contains a bisphenol-type compound selected form probucol spiroquinone, probucol diphenoquinone, and probucol bisphenol as an effective ingredient. The ABCA1 stabilizer can continuously and stably express ABCA1 by a... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070161703 - Neuroactive substance and uses of one such substance: The invention relates to a neuroactive substance which is characterised in that it has formula (O), wherein R1, R2, R3 and R4 are identical or different and are methyl or ethyl radicals. Preferably, the neuroactive substance comprises 6S-acetyl-4R,5R-dimethyl-1R(10S)-epoxy-2R-hy-droxy-7R-acetoxydecahydro naphthalene which can be isolated from Rhytisma fulvum cnidaria. The inventive neuroactive... Agent: Westman Champlin & Kelly, P.A. 20070161704 - Pharmaceutical composition useful for treating chronic myeloid leukemia: This invention relates to a pharmaceutical composition useful for treating chronic myeloid leukemia where Bcr-Abl kinase is constitutively expressed in animals and humans, and a treatment of chronic myeloid leukemia (CML) by a composition comprising an effective amount of analogs and/or salts of chlorogenic acid. The analogs are preferably sodium... Agent: Fitzpatrick Cella Harper & Scinto 20070161705 - Use of highly concentrated compositions of selected n-3 fatty acids for the treatment of central nervous system disturbances: The use is described of a composition comprising either a) alpha-linolenic acid (ALA, C18:3 n-3) or b) docosahexaenoic acid (DHA, C22:6 n-3) or c) DHA in admixture with eicosapentaenoic acid (EPA, C20:5 n-3), in a ratio of 1:0.5 to 1:1.7, respectively, and/or the pharmaceutically acceptable derivatives and/or precursors thereof; either... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C. 20070161706 - Pharmaceutical uses for alpha2delta ligands: e 20070161707 - Pharmaceutical uses for alpha2delta ligands: 20070161708 - Polymorphs of sodium 4-[(4-chloro-2-hydroxybenzoyl) amino] butanoate: The present invention relates to amorphous and polymorphic forms of sodium 4-[(4-chloro-2-hydroxybenzoyl)amino]butanoate and their use for facilitating the delivery of active agents, such as insulin, to a target.... Agent: Emisphere Technologies, Inc. C/o Darby & Darby P.C. 20070161709 - Amorphous tamsulosin hydrochloride: In the present invention, amorphous tamsulosin hydrochloride, the process for preparation thereof by lyophilization or spray-drying and the properties thereof are disclosed.... Agent: Novartis Corporate Intellectual Property 20070161710 - Bone targeting compounds for delivering agents to bone for interaction therewith: 20070161711 - Process for producing pellets for pharmaceutical compositions: Water is used to control particle size in a process comprising mixing water with a composition comprising a rheology modifying agent and possibly sugar and cellulose to produce a paste. The paste is extruded to form particles which are then spheronised and dried. One advantage of using water to control... Agent: Bacon & Thomas, PLLC 20070161712 - Genes encoding epsilon lycopene cyclase and method for producing bicyclic epsilon carotene: The present invention relates to the DNA sequence for eukaryotic genes encoding ε cyclase isolated from romaine lettuce as well as vectors containing the same and hosts transformed with said vectors. The present invention provides methods for controlling the ratio of various carotenoids in a host and to the production... Agent: Fish & Richardson P.C. 07/05/2007 > patent applications in patent subcategories.20070155652 - Composition for regenerative treatment of cartilage disease: A composition for regenerative treatment of cartilage disease, which comprises a PDE4 inhibitor as an active ingredient, specifically a composition comprising a PDE4 inhibitor and a biocompatible and biodegradable polymer is provided, which composition, when formulated into a form suited to administer locally to affected cartilage region, such as microsphere... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20070155651 - Methods of use of fibroblast growth factor, vascular endothelial growth factor and related proteins in the treatment of acute and chronic heart disease: Disclosed herein is a rational, multi-tier approach to the administration of growth factor proteins in the treatment of heart disease. Also disclosed is a method to evaluate the effectiveness of the administration of growth factor proteins comprising the clinical assay of CPK-MB levels in a patient undergoing treatment with growth... Agent: Ernest D. Buff Ernest D. Buff & Associates, LLC 20070155650 - Use of cathepsin z inhibitors for the treatment of rhuematoid arthritis and other autoimmune diseases: Methods for identifying compounds for treating autoimmune diseases including rheumatoid arthritis. Compounds for treating autoimmune diseases including rheumatoid arthritis. Methods of treatment for autoimmune diseases including rheumatoid arthritis. These methods and compounds are directed to inhibiting the activity of Cathepsin Z.... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC 20070155654 - Novel formulations: Stable, soluble insulin formulations having both a fast and a long action.... Agent: Novo Nordisk, Inc. Patent Department 20070155653 - Zinc-free and low-zinc insulin preparations having improved stability: The invention relates to a formulation comprising a polypeptide selected from at least one of insulin, an insulin metabolite, an insulin analog, and an insulin derivative; at least one surfactant; optionally at least one preservative; and optionally at least one of an isotonicizing agent, a buffer or an excipient, wherein... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20070155655 - Hypoglycemic agent: A zinc(II) complex which is lowly toxic, has high insulin-like activity, and is effectively usable as a hypoglycemic agent for the prevention or treatment of diabetes; a hypoglycemic agent containing the complex; a medicinal preparation which contains the complex and is useful as a preventive/remedy for diabetes; and a food... Agent: Edwards Angell Palmer & Dodge LLP 20070155656 - Hypoglycemic agent: A zinc(II) complex which is lowly toxic, has high insulin-like activity, and is effectively usable as a hypoglycemic agent for the prevention or treatment of diabetes; a hypoglycemic agent containing the complex; a medicinal preparation which contains the complex and is useful as a preventive/remedy for diabetes; and a food... Agent: Edwards Angell Palmer & Dodge LLP 20070155657 - Hypoglycemic agent: A zinc(II) complex which is lowly toxic, has high insulin-like activity, and is effectively usable as a hypoglycemic agent for the prevention or treatment of diabetes; a hypoglycemic agent containing the complex; a medicinal preparation which contains the complex and is useful as a preventive/remedy for diabetes; and a food... Agent: Edwards Angell Palmer & Dodge LLP 20070155658 - Nanoparticles for delivery of nucleic acids and stable double-stranded rna: Nanoparticles of double-stranded nucleic acid complexed about a complexing agent such as the melamine derivatives of formulae I and II, preferably forming a trimeric nucleic acid complex. In alternative embodiments, polyarginine or a polymer of Gln and Asn further complexed with the double-stranded nucleic acid complex. In a preferred embodiment,... Agent: Nastech Pharmaceutical Company Inc 20070155660 - Inhibition of voluntary ethanol consumption with selective melanocortin 4-receptor agonists: The present invention relates to methods of inhibiting or reducing voluntary alcohol consumption in a subject comprising administering a selective melanocortin 4 receptor agonist to said subject. The present invention further relates to methods of treating or preventing alcoholism, alcohol abuse, and alcohol related disorders in a subject comprising administering... Agent: Merck And Co., Inc 20070155659 - Use of somatostatin or one of its analogues for preparing a medicament intended to regulate the ovarian follicular reserve in non-menopausal women: The invention primarily relates to the use of somatostatin or one of the agonistic analogs thereof for producing a medicament serving to regulate the ovarian follicular reserve and, in particular, to reduce the depletion of the ovarian follicular reserve over time in non-menopausal women or to the use of an... Agent: Hunton & Williams LLP Intellectual Property Department 20070155666 - Canine and equine collagen joint health supplement: A food supplement for administration to mammals, and particularly for dogs and horses, has been shown to have a beneficial effect against degenerative joint conditions. The food supplement includes collagen kolla2®.... Agent: Law Office Of Terry L. Miller 20070155662 - Diagnostics and therapeutics for diseases associated with phosphodiesterase 1a (pde1a): The invention provides a human PDE1A which is associated with the cardiovascular disorders, endocrine system and hormone disorders, cancer disorders, gastrointestinal and liver diseases, hematological disorders, respiratory diseases, neurological disorders and urological disorders. The invention also provides assays for the identification of compounds useful in the treatment or prevention of... Agent: Banner & Witcoff, Ltd. 20070155661 - Methods and compositions for modulating the development of stem cells: The application provides, among other things, methods for increasing production of insulin in cells by contacting the cells with a BMP family member and/or an activator of a BMP pathway. The application also provides methods for increasing the production of beta cell precursor cells by contacting suitable cells with an... Agent: Fish & NeaveIPGroup Ropes & Gray LLP 20070155665 - Neuregulins for prevention and treatment of damage from acute assault on vascular and neuronal tissue and as regulators of neuronal stem cell migration: Neuregulin, a known neuroprotein, has been found to ameliorate or prevent damage caused by mechanical or chemical assault to blood vessels and, when administered into the cerebral spinal fluid, can ameliorate damage to neuronal tissue caused by stroke or inflammation. Additionally, neuregulin has been found to be useful for enhancement... Agent: Glenna Hendricks Esq. 20070155664 - Parathyroid hormone (pth) containing pharmaceutical compositions for oral use: A pharmaceutical composition for oral administration comprising PTH, wherein the in vitro release of PTH-when tested in a dissolution test of pharmacopoeia standard-is delayed with at least 2 hours and once the release starts, at least 90% w/w such as, e.g., at least 95% or at least 99% of all... Agent: Edwards Angell Palmer & Dodge LLP 20070155663 - Use of chemokine receptor agonists for stem cell transplantation: A medicament comprising at least one agonist of receptors selected from the group consisting of the CCR3, CCR6 or CCR8 receptor or combinations thereof and a pharmaceutically acceptable carrier.... Agent: Jacobson Holman PLLC 20070155667 - Acute respiratory syndromes: Substance P or its analogs are useful for treating and protecting against acute respiratory syndromes including ARDS and SARS. The active agents can be administered via inhalation therapy, intravenously, intramuscularly, sublingually, or by other methods. Disease indicia are reduced by substance P treatment.... Agent: Banner & Witcoff, Ltd. 20070155668 - Peptides modulating the activity of the engrailed transcription factor: The invention relates to peptides which can become fixed to the engrailed transcription factor and which can modulate the activity thereof.... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C. 20070155669 - Treatment of cancer by a combination of non-ionizing radiation and androgen deprivation: A combined androgen deprivation and thermotherapy cancer treatment. For example, the combination can be used to treat prostate cancer. Chemical compounds, including a non-steroidal anti-androgen and/or an LH-RH agonist, such as androgen deprivation therapy (“ADT”), can be used in combination with application of non-ionizing radiation to treat cancer. The chemical... Agent: King & Spalding LLP 20070155671 - Diaminopropionic acid derivatives: c 20070155670 - Pyrrolidine melanocortin-specific compounds: and stereoisomer and pharmaceutically acceptable salts thereof, where R1, R2, and R3 are as described in the specification, preferably where R3 is a D-amino acid with at least one substituted or unsubstituted phenyl or naphthyl aromatic ring, and where R3 optionally further includes an amine capping group or from one... Agent: Palatin Technologies, Inc. 20070155677 - Separation method: The invention relates to a process of recovering galactose from a solution derived from plant-based biomass. In the process of the invention, the starting solution is subjected to one or more chromatographic fractionation steps, which may carried out with a strongly basic anion exchange resin and optionally with a strongly... Agent: Scully Scott Murphy & Presser, PC 20070155672 - Sterilized peritoneal dialysis solutions containing heparin: Sterilized dialysis solutions containing glycosaminoglycan, for example Heparin, and methods of making and using same are provided. In an embodiment, the present invention provides different peritoneal dialysis solutions containing Heparin that are stable under sterilization conditions. For example, the solutions are designed to provide all-in-one, ready-to-use sterilized solutions for peritoneal... Agent: Baxter Healthcare Corporation 20070155674 - Substituted azetidinone compounds, processes for preparing the same, formulations and uses thereof: The present invention provides substituted azetidinone compounds, formulations and processes for preparing the same which can be useful for treating vascular conditions such as atherosclerosis or hypercholesterolemia, diabetes, obesity, stroke, demyelination and lowering plasma levels of sterols and/or stanols in a subject.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990) 20070155676 - Substituted azetidinone compounds, processes for preparing the same, formulations and uses thereof: The present invention provides substituted azetidinone compounds, formulations and processes for preparing the same which can be useful for treating vascular conditions such as atherosclerosis or hypercholesterolemia, diabetes, obesity, stroke, demyelination and lowering plasma levels of sterols and/or stanols in a subject.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990) 20070155675 - Substituted azetidinone compunds, processes for preparing the same, formulations and uses thereof: The present invention provides substituted azetidinone compounds, formulations and processes for preparing the same which can be useful for treating vascular conditions such as atherosclerosis or hypercholesterolemia, diabetes, obesity, stroke, demyelination and lowering plasma levels of sterols and/or stanols in a subject.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990) 20070155673 - Use of bvdu for inhibiting the growth of hyperproliferative cells: This invention provides methods for selectively killing a hyperproliferative cell by contacting the cell with the compound BVdU, its derivatives and pharmaceutically acceptable salts. Further provided by this invention is a method for treating a pathology in a subject characterized by pathological, hyperproliferative cells by administering to the subject an... Agent: Foley & Lardner LLP 20070155678 - Use of rhamnolipids in wound healing, treating burn shock, atherosclerosis, organ transplants, depression, schizophrenia and cosmetics: Various methods are provided, including wound healing with reduced fibrosis, treatment of burn shock, treatment and prevention of atherosclerosis, prevention and treatment of organ transplant rejection, treatment of depression and schizophrenia and treatment of the signs of aging, such as wrinkles, each of which uses administration of a composition containing... Agent: Defillo & Associates, Inc. 20070155679 - Use of bradycardiac substances in the treatment of myocardial diseases associated with hypertrophy and novel medicament combinations: The present invention relates to the new use of bradycardiac substances such as a Ca++ channel blocker, beta-receptor blocker or if channel blocker, the if channel blockers being preferred, optionally in combination with a cardioactive substance for inducing the regression of myocardial diseases accompanied by hypertrophy, particularly for the treatment... Agent: Michael P. Morris Boehringer Ingelheim Corporation 20070155680 - Active substance combination based on trifluorobutinyl compounds and exhibiting nematicidal and insecticidal properties: The invention relates to novel active substance combinations consisting of heterocyclic trifluorobutenylen of formula (I), wherein X is halogen and N is 0, 1 or 2, and of known insecticide substances. Said novel active substance combinations are suitable for fighting harmful pests like insects and nematodes.... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c. 20070155681 - Methods and compositions for treatment of viral infections: A novel method of treating and preventing viral diseases is provided. In particular, the present invention relates to compositions and methods for inhibition of viral infections and the diseases associated with such viral infections. More particularly, the present invention relates to the inhibitory compounds comprising naturally occurring and man-made compositions... Agent: Law Offices Of Khalilian Sira, LLC 20070155691 - Antisense modulation of acyl coa cholesterol acyltransferase-2 expression: Antisense compounds, compositions and methods are provided for modulating the expression of acyl CoA cholesterol acyltransferase-2. The compositions comprise antisense compounds, particularly antisense oligonucleotides, targeted to nucleic acids encoding acyl CoA cholesterol acyltransferase-2. Methods of using these compounds for modulation of acyl CoA cholesterol acyltransferase-2 expression and for treatment of... Agent: Knobbe, Martens, Olson & Bear, LLP 20070155683 - Artificial cpg single-stranded oligodeoxynucleotide and antiviral use thereof: The present invention provides a series of artificial CpG-containing single-stranded oligodeoxynucleotides (ODNs), each of which is consisted of single-stranded oligodeoxynucleotide DNA molecule containing one or more CpG(s), wherein said ODNs can stimulate human peripheral blood mononuclear cell (PBMC) to produce antiviral substances. These ODNs can protect the cells against the... Agent: Knobbe Martens Olson & Bear LLP 20070155684 - Compositions and methods for generating short double-stranded rna using mutated rnase iii: Compositions and methods are provided for preparing an hsiRNA mixture and for silencing of gene expression in vivo. The composition relates to a mutant RnaseIII. The methods are directed to reacting a preparation of dsRNA with an effective amount of a mutant RNAse III to produce the hsiRNA mixture.... Agent: Harriet M. Strimpel New England Biolabs, Inc. 20070155688 - Gene therapy for renal failure: The present invention relates to recombinant vectors expressing the BMP-7 polypeptide in host cells and to pharmaceutical compositions comprising such recombinant vectors. The invention also encompasses methods for prevention and/or treatment of both acute and chronic renal failure in mammals, advantageously in dogs and cats, by administration of the recombinant... Agent: Judy Jarecki-black, Ph.d, J.d Merial Ltd. 20070155687 - Methods and compositions for altering cell function: The present invention relates to compositions and methods for altering cell function. In particular, the present invention provides compositions comprising selenium (e.g., SEL-PLEX) and methods of using the same (e.g., as a therapeutic and/or prophylactic treatment for neurodegenerative disease). Additionally, the present invention demonstrates that specific forms of selenium (e.g.,... Agent: Medlen & Carroll, LLP 20070155689 - Methods of regulating growth and death of cancer cells: This invention demonstrates that the PEG10 protein suppresses apoptosis and promotes cancer cell growth. Furthermore, PEG10 protein was found to be degraded through interaction with SIAH1 protein. This invention provides methods of regulating cell growth and cell death using the PEG10 protein. Furthermore, the present invention provides methods of screening... Agent: Townsend And Townsend And Crew, LLP 20070155685 - Pharmaceutical composition: The present invention is related to pharmaceutical compositions for the inhibition of metastases and treatment of cancer such as bladder carcinoma, colon cancer, endometrial cancer, hepatocellular carcinoma, leukemia, lymphoma, melanoma, non-small cell lung cancer (NSCLC), ovarian cancer, pancreatic cancer, prostate cancer, soft tissue cancer, renal cancer, osteosarcoma, mesothelioma, myeloma multiple,... Agent: Akerman Senterfitt 20070155686 - Rnai modulation of hif-1 and therapeutic uses thereof: The features of the present invention relate to compounds, compositions and methods useful for modulating the expression of HIF-1α, such as by the mechanism of RNA interference (RNAi). The compounds and compositions include iRNA agents that can be unmodified or chemically-modified.... Agent: Fish & Richardson PC 20070155690 - Rnai-mediated inhibition of hif1a for treatment of ocular angiogenesis: RNA interference, is provided for inhibition of HIF1A mRNA expression for treating patients with ocular angiogenesis, particularly for treating retinal edema, diabetic retinopathy, sequela associated with retinal ischemia, posterior segment neovascularization (PSNV), and neovascular glaucoma, and for treating patients at risk of developing such conditions.... Agent: Gloria L. Norberg Winstead Sechrest & Minick P.C. 20070155682 - Translational control by small, non-translatable rnas: The present invention provides isolated antisense molecules targeted to BC200 RNA. The subject antisense molecules are useful in treating various neurological disorders and carcinomas in a subject Also provided are methods of treating a neurological disorder or cancer in a subject by administering a therapeutically effective amount of a subject... Agent: Dilworth & Barrese, LLP 20070155692 - Cobalamine derivatives useful for diagnosis and treatment of abnormal cellular proliferation: The invention relates to cobalamin derivatives (a) having no binding affinity or low binding affinity to the transport protein transcobalamin II TCII) and (b) retaining activity as a vitamin B12 substitute, optionally carrying a therapeutic and/or diagnostic agent, such as a radioactive metal. These compounds have a much reduced accumulation... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070155693 - Inhibitor of cancer bone metastasis: The subject of the present invention is to provide means to fully achieve the inhibition of cancer bone metastasis, which was accomplished through the repeated selection of agents with aiming at obtaining more beneficial effects on the inhibition of cancer bone metastasis. The invention is achieved by combining an inhibition... Agent: Jhk Law 20070155694 - Low molecular weight polysaccharides having antithrombotic activity: Novel depolymerized-LMWepiK5-N,O-sulfates obtainable starting from a LMW-epiK5-N-sulfate prepared by nitrous depolymerization of an epiK5-N-sulfate or by C5-epimerization of a LMW-K5-N-sulfate obtained by nitrous depolymerization of a K5-N-sulfate. A process consists of submitting the starting depolymerized-LMW-epiK5-N-sulfate to four steps: a O-oversulfation, a partila O-desulfation, a 6-O-sulfation and a N-sulfation. The new... Agent: Nixon & Vanderhye, PC 20070155697 - Antimicrobial preservatives to achieve multi-dose formulation using beta-cyclodextrins for liquid dosage forms: The present invention is directed to pharmaceutical compositions containing a therapeutically effective amount of an Active Pharmaceutical Ingredient (“API”), a pharmaceutically acceptable cyclodextrin and a pharmaceutically acceptable preservative. The invention is also directed to pharmaceutical compositions of the compounds of Formula (I) wherein R2 is selected from the group consisting... Agent: Pharmacia & Upjohn 20070155695 - Flavonoid complexes with cyclodextrins: The invention relates to complexes of certain flavonoid derivatives, of the formula I compositions which comprise such derivatives, corresponding processes for the preparation of the flavonoid derivatives or of compositions comprising same, and the use thereof, in particular for the care, preservation or improvement of the general state of the... Agent: Millen, White, Zelano & Branigan, P.C. 20070155696 - Method for stabilizing macrolide compounds: The present invention provides a method for stabilizing a macrolide compound, and an efficient method for producing the compound. Specifically, it provides a method for stabilizing a macrolide compound, in which a 12-membered ring macrolide compound, such as a compound expressed by the formula (1) and a cyclodextrin are both... Agent: Birch Stewart Kolasch & Birch 20070155699 - Boron-containing small molecules: This invention relates to compounds useful for treating fungal infections, more specifically topical treatment of onychomycosis and/or cutaneous fungal infections. This invention is directed to compounds that are active against fungi and have properties that allow the compound, when placed in contact with a patient, to reach the particular part... Agent: Morgan, Lewis & Bockius LLP (sf) 20070155698 - Oxazaborolidines as bacteria effectors: The invention relates to a composition for modulation of at least one bacteria-related parameter comprising oxazaborolidine derivative compounds. The invention additionally relates to new oxazaborolidine derivative compounds. The invention further relates to a composition for decreasing bacterial growth, a composition for increasing the susceptibility of bacteria to the cytotoxic effects... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw 20070155700 - Use of lipid conjugates in the treatment of conjunctivitis: In one embodiment, the invention provides a method of suppressing, inhibiting, preventing, or treating conjunctivitis in a subject, comprising the step of administering an effective amount of a lipid or phospholipid moiety bound via an ester or amide bond to a physiologically acceptable monomer, dimer, oligomer, or polymer, and/or a... Agent: Pearl Cohen Zedek Latzer, LLP 20070155701 - Keto cannabinoids with therapeutic indications: Novel tricyclic cannabinoid compounds are presented. Some of these compounds exhibit fluorescence properties. The fluorescent cannabinoid compounds are typically endogenously fluorescent. Some of these compounds, when administered in a therapeutically effective amount to an individual or animal, result in a sufficiently high level of that compound in the individual or... Agent: Alix Yale & Ristas LLP 20070155702 - Crystalline forms of 1-benzoyl-4-[2-[4-methoxy-7-(3-methyl-1h-1,2,4-triazol-1-yl)-1-[(phosphonooxy)methyl]-1h-pyrrolo[2,3-c]pyridin-3-yl]-1,2-dioxoethyl]-piperazine: The instant disclosure provides crystalline forms of 1-benzoyl-4-[2-[4-methoxy-7-(3-methyl-1H-1,2,4-triazol-1-yl)-1-[(phosphonooxy)methyl]-1H-pyrrolo[2,3-c]pyridin-3-yl]-1,2-dioxoethyl]-piperazine, salts and solvates thereof. The present disclosure also generally relates to pharmaceutical compositions comprising the crystalline form(s), as well of methods of using the crystalline form(s) in the treatment of HIV and/or AIDS, and methods for obtaining such crystalline form(s).... Agent: Louis J. Wille Bristol-myers Squibb Company 20070155703 - Pharmaceutically active compounds and methods of use thereof: The invention includes pharmaceutically active compounds and methods of treatment and pharmaceutical compositions that utilize or comprise one or more such compounds. Compounds of the invention are particularly useful for treatment or prophylaxis of undesired thrombosis.... Agent: Foley Hoag, LLP Patent Group, World Trade Center West 20070155704 - Ketone compounds and compositions for cholesterol management and related uses: The present invention relates to novel ketone compounds, compositions comprising ketone compounds, and methods useful for treating and preventing cardiovascular diseases, dyslipidemias, dysproteinemias, and glucose metabolism disorders comprising administering a composition comprising a ketone compound. The compounds, compositions, and methods of the invention are also useful for treating and preventing... Agent: Warner-lambert Company 20070155705 - Compounds and methods for inhibiting the interaction of bcl proteins with binding partners: The present invention relates to heterocyclic compounds that bind to Bcl proteins and inhibit Bcl function, compositions comprising such compounds, and methods for treating and modulating disorders associated with hyperproliferation, such as cancer.... Agent: Foley Hoag, LLP Patent Group, World Trade Center West 20070155707 - Ionizable inhibitors of fatty acid amide hydrolase: Pharmacological inhibition of fatty acid amide hydrolase (FAAH) activity leads to increased levels of fatty acid amides. Esters of alkylcarbamic acids are disclosed that are inhibitors of FAAH activity. Compounds disclosed herein inhibit FAAH activity. Described herein are processes for the preparation of esters of alkylcarbamic acid compounds, compositions that... Agent: Wilson Sonsini Goodrich & Rosati 20070155706 - Active substance combinations that have nemticidal, insecticidal, and fungicidal properties and are based on trifluorobutenyl compounds: Disclosed are novel active substance combinations comprising specific heterocyclic trifluorobutenyls and previously known fungicidal agents. Said active substance combinations have a very good synergistic fungicidal, nematicidal, insecticidal, and/or acaricidal effect.... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c. 20070155708 - 7-phenyl-substituted tetracycline compounds: 7-phenyl-substituted tetracycline compounds, methods of treating tetracycline responsive states, and pharmaceutical compositions containing the 7-phenyl-substituted tetracycline compounds are described.... Agent: Lahive & Cockfield, LLP 20070155709 - New chemical entities with multiple modes of anti-inflammatory action: The invention relates to new chemical compounds that inhibit the various enzymes in the arachidonic acid pathway implicated in inflammatory disease conditions.... Agent: Sabinsa Corporation 20070155710 - Androgen treatment in females: A method of improving cumulative embryo score may comprise administering an androgen to a human female, for example, DHEA, for at least about four consecutive months followed by harvesting and fertilizing oocytes and forming embryos. Between about 50 mg and about 100 mg of DHEA may be administered to a... Agent: Beem Patent Law Firm 20070155711 - Prodrugs for use as ophthalmic agents: The subject invention provides a mechanism by which steroidal quinol compounds confer beneficial ophthalmic effects. The subject compounds possess a lipophilic-hydrophilic balance for transcomeal penetration and are readily reduced into parent phenolic A-ring steroid compounds to provide protection or treatment against various ocular symptoms and disorders. The compounds according to... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association 20070155712 - Compounds for the inhibition of angiogenesis and use thereof: This invention is directed to compounds of structure (I). Particularly this invention is directed to compounds of structure (VIII) wherein the variables are defined as in the description. These compounds are integrin inhibitors and are useful in the treatment of diseases in which an inhibition of angiogenesis is desired.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C. 20070155713 - Nitrogen-containing heterocyclic compounds and use thereof: (wherein all of the symbols have the same meanings as defined in specification.), salts thereof, solvates thereof, or prodrugs thereof. The compounds represented by formula (I) are used for prevention and/or treatment of various inflammatory diseases (asthma, nephritis, nephropathy, hepatitis, arthritis, chronic rheumatoid arthritis, rhinitis, conjunctivitis, ulcerative colitis and the... Agent: Sughrue Mion, PLLC 20070155716 - Hcv inhibiting bi-cyclic pyrimidines: The present invention relates to the use of bi-cyclic pyrimidines as inhibitors of HCV replication as well as their use in pharmaceutical compositions aimed to treat or combat HCV infections. In addition, the present invention relates to processes for preparation of such pharmaceutical compositions. The present invention also concerns combinations... Agent: Philip S. Johnson Johnson & Johnson 20070155715 - Rifamycin analogs and uses thereof: The present invention features rifamycin analogs and methods of using these compounds to treat a variety of microbial infections.... Agent: Clark & Elbing LLP 20070155714 - Use of oxazolidinone-quinoline hybrid antibiotics for the treatment of anthrax and other infections: The present invention relates to the use of compounds, in which the pharmacophores of quinolone and oxazolidinone are chemically linked together through a linker that is stable under physiological conditions, for the treatment of anthrax and other infections.... Agent: Edwards Angell Palmer & Dodge LLP 20070155717 - Amidines and derivatives thereof and pharmaceutical compositions containing them: The process for their preparation and pharmaceutical compositions thereof are also described. The amidines of the invention are useful in the inhibition of chemotaxis of neutrophils induced by IL-8. The compounds of the invention are used in the treatment of psoriasis, ulcerative colitis, melanoma, chronic obstructive pulmonary disease (COPD), bullous... Agent: Birch Stewart Kolasch & Birch 20070155718 - Caspase inhibitor prodrugs: e 20070155719 - Platelet adp receptor inhibitors: Novel compounds of formula (I) to (VI), which more particularly include sulfonylurea derivatives, sulfonylthiourea derivatives, sulfonylguanidine derivatives, sulfonylcyanoguanidine derivatives, thioacylsulfonamide derivatives, and acylsulfonamide derivatives which are effective platelet ADP receptor inhibitors. These derivatives may be used in various pharmaceutical compositions, and are particularly effective for the prevention and/or treatment of... Agent: Townsend And Townsend And Crew, LLP 20070155720 - Co-administration of dopamine-receptor binding compounds: Methods for treating a patient having neurological, psychotic, and psychiatric disorders are described comprising the steps of administering to the patient an effective amount of a partial and/or full dopamine D1 receptor agonist, and administering to the patient an effective amount of a dopamine D2 receptor antagonist. Pharmaceutical compositions comprising... Agent: Barnes & Thornburg LLP 20070155721 - Chemokine receptor antagonists: A compound of formula (I) or a pharmaceutically acceptable salt or prodrug ester thereof, wherein the variants R, R9, Z, X, Q and Y are defined in the specification.... Agent: Novartis Corporate Intellectual Property 20070155722 - Fused pyrazole derivatives as tgf-beta signal transduction inhibitors for the treatment of fibrosis and neoplasms: The disclosed invention is directed to compounds of the formula: Formula (I) and methods of using these compounds.... Agent: Eli Lilly & Company 20070155723 - Tetrahydro-pyranopyrazole cannabinoid modulators: e 20070155724 - Methods of treating cytokine mediated diseases: Disclosed are methods of treating acute and chronic inflammation in the lung caused by inhalation of smoke, endometriosis, Behcet's disease, uveitis, ankylosing spondylitis, pancreatitis, cancer, Lyme disease, sepsis, chronic obstructive pulmonary disease, traumatic arthritis, congestive heart failure and restenosis following percutaneous transluminal coronary angioplasty, known to be cytokine mediated, using... Agent: Michael P. Morris Boehringer Ingelheim Corporation 20070155725 - 2-phenoxy- and 2-phenylsulfomamide derivatives with ccr3 antagonistic activity for the treatment of asthma and other inflammatory or immunological disorders: The present invention relates to a benzenesulfonamide derivative of formula (I), which is useful as an active ingredient of pharmaceutical preparations. The benzenesulfonamide derivatives of the present invention have CCR3 (CC type chemokine receptor) antagonistic activity, and can be used for the prophylaxis and treatment of diseases associated with CCR3... Agent: Jones Day 20070155727 - Amide inhibitors of leukotriene a4 hydrolase: where r, q, R, R2, R3, R4a, R4b, R4c, R5a, R5b, R5c, R6a, R6b, R6c, R7, R8, R9 and R10 are described herein, or pharmaceutically acceptable salts, solvates, polymorphs, ammonium ions, N-oxides or prodrugs thereof; which are leukotriene A4 hydrolase inhibitors and which are therefore useful in treating inflammatory disorders.... Agent: Millen, White, Zelano And Branigan, P.C. C/o Berlex Biosciences 20070155726 - Diamine derivatives as inhibitors of leukotriene a4 hydrolase: where r, q, R, R2, R3, R4, R5a, R5b, R5c, R6a, R6b, R6c, R7, R8, and R9 are described herein, as single stereoisomers or as mixtures of stereoisomers, or pharmaceutically acceptable salts, solvates, clathrates, polymorphs, ammonium ions, N-oxides or prodrugs thereof; which are leukotriene A4 hydrolase inhibitors and therefore useful... Agent: Millen, White, Zelano And Branigan, P.C. C/o Berlex Biosciences 20070155728 - Substituted heterocyclic compounds: e 20070155729 - Therapeutic amine-arylsulfonamide conjugate compounds: wherein R′ is [D-W-], hydroxyl, or alkoxyl; R″ is independently [D-W′-], hydrogen, alkoxy, alkyl, cycloalkyl, alkenyl, alkynyl or aryl, or R″ and R″ together with the nitrogen atom to which they are attached form a 4-, 5-, 6-, 7- or 8-membered ring optionally containing one or two further heteroatoms independently... Agent: Hutchison Law Group PLLC 20070155730 - Benzodiazepine and benzopiperazine analog inhibitors of histone deacetylase: e 20070155731 - Aminocyclopentyl pyridopyrazinone modulators of chemokine receptor activity: Compounds of Formula I and Formula II (wherein A, E, j, k, m, n, R1, R2, R3, R4, R5, R6, R7, R8, R9, R10, R15, R16, R17, R18, R19, R24, R25, R26, R27, R28, R29, R30, R31, R32, R33, R34, X, Y and Z are as defined herein) which are... Agent: Merck And Co., Inc 20070155733 - Antineoplastic compounds: m 20070155732 - Aryl or heteroaryl fused imidazole compounds as anti-inflammatory and analgesic agents: or the pharmaceutically acceptable salts thereof, wherein Y1, Y2, Y3 and Y4 are independently selected from N, CH, etc.; R1 is H, C1-8 alkyl, etc.; Q1 is a 5-12 membered monocyclic or bicyclic aromatic ring optionally containing up to 4 heteroatoms selected from O, N and S, etc.; A is... Agent: Warner-lambert Company 20070155734 - Oxime and/or hydrazone containing nitrosated and/or nitrosylated cyclooxygenase-2 selective inhibitors, compositions and methods of use: The invention provides novel cyclooxygenase 2 (COX-2) selective inhibitors having at least one oxime group or hydrazone group and novel compositions and kits comprising at least one COX-2 selective inhibitor having at least one oxime group or hydrazone group, optionally nitrosated and/or nitrosylated, and, optionally, at least one nitric oxide... Agent: Wilmerhale/nitromed 20070155735 - Novel aminoindazole derivatives as medicaments and pharmaceutical compositions including them: R5, R6 and R7 are, independently of one another, chosen from the following radicals: halogen, CN, NO2, NH2, OH, OR8, COOH, C(O)OR8, —O—C(O)R8, NR8R9, NHC(O)R8, C(O)NR8R9, NHC(S)R8, C(S)NR8R9, SR8, S(O)R8, SO2R8, NHSO2R8, SO2NR8R9, —O—SO2R8, —SO2—O—R8, trifluoromethyl, trifluoromethoxy, (1-6C)alkyl, (1-6C)alkoxy, aryl, aryl(1-6C)alkyl, heteroaryl, heteroaryl(1-6C)alkyl, heterocycle, cycloalkyl, alkenyl, alkynyl, adamantyl or polycycloalkyl,... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC 20070155736 - Fluorinated phno and analogues thereof: This application describes fluorinated (+)PHNO and analogs thereof, including radiolabeled analogs, compositions comprising these compounds and methods of using these compounds, for example, for identifying dopamine supersensitivity.... Agent: Bereskin And Parr 20070155737 - Heterobicyclic metalloprotease inhibitors: The present invention relates generally to amide group containing pharmaceutical agents, and in particular, to amide containing heterobicyclic metalloprotease inhibitor compounds. More particularly, the present invention provides a new class of heterobicyclic ADAMTS-4 inhibiting compounds.... Agent: Hoffmann & Baron, LLP 20070155738 - Heterobicyclic metalloprotease inhibitors: The present invention relates generally to amide group containing pharmaceutical agents, and in particular, to amide containing heterobicyclic metalloprotease inhibitor compounds. More particularly, the present invention provides a new class of heterobicyclic MMP-13 inhibiting and MMP-3 inhibiting compounds, that exhibit an increased potency in relation to currently known MMP-13 and... Agent: Hoffmann & Baron, LLP 20070155741 - Medicaments for the treatment of chronic obstructive pulmonary disease: R3 is hydrogen, C1-C4-alkyl, OH, halogen, —O—C1-C4-alkyl, —O—C1-C4-alkylene-COOH, or —O—C1-C4-alkylene-CO—O—C1-C4-alkyl, or an acid addition salt thereof with a pharmacologically acceptable acid, or a solvate or hydrate thereof; and a pharmaceutically acceptable excipient or carrier, and methods for using the pharmaceutical formulation in the treatment of chronic obstructive pulmonary disease (COPD).... Agent: Michael P. Morris Boehringer Ingelheim Corporation 20070155739 - Substituted bis-amide metalloprotease inhibitors: This invention relates to substituted bis-amide pyrimidine compounds of Formula (I), which are useful for the treatment of metalloprotease mediated diseases, in particular MMP-13 related diseases.... Agent: Hoffmann & Baron, LLP 20070155740 - Substituted pyrazinones, pyridines and pyrimidines as corticotropin releasing factor ligands: i 20070155742 - Tricyclic-bis-enone derivatives and methods of use thereof: Novel tricyclic-bis-enone derivatives (TBEs) as well as the process for the preparation of such TBEs are provided. Also provided are methods for prevention and/or treatment of cancer, Alzheimer's disease, Parkinson's disease, multiple sclerosis, amyotropic lateral sclerosis, rheumatoid arthritis, inflammatory bowel disease, and all other diseases whose pathogenesis is believed to... Agent: Priya D. Subramony Fulbright & Jaworski L.L.P. 20070155743 - Amino alcohol derivatives and their activity as renin inhibitors: The application relates to novel amino alcohols of general formula (I) where R, R1, R2, R3, R4, R5,X1 and X2 each have the definitions illustrated in detail in the description, to a process for their preparation and to the use of these compounds as medicines, in particular as renin inhibitors.... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070155744 - N-benzyl-3,4-dihyroxypyridine-2-carboxamide and n-benzyl-2,3-dihydroxypyridine-4- carboxamide compounds useful as hiv integrase inhibitors: N-Benzyl-dihydroxypyridine carboxamide compounds are inhibitors of HIV integrase and inhibitors of HIV replication. In one embodiment, the dihydroxypyridine carboxamides are of Formula (I) wherein Q is Formula (II) or Formula (III); T is Formula (IV); and R1, R2, X1,X2,X3, and Y1 are defined herein. The compounds are useful in the... Agent: Merck And Co., Inc 20070155745 - Pyrrolidine derivatives as factor xa inhibitors: B 20070155747 - Inhibitors of fatty acid amide hydrolase: Pharmacological inhibition of fatty acid amide hydrolase (FAAH) activity leads to increased levels of fatty acid amides. Esters of alkylcarbamic acids are disclosed that are inhibitors of FAAH activity. Compounds disclosed herein inhibit FAAH activity. Described herein are processes for the preparation of esters of alkylcarbamic acid compounds, compositions that... Agent: Wilson Sonsini Goodrich & Rosati 20070155746 - Novel substituted pyridinyloxy and pyrimidinyloxy amides useful as inhibitors of protein kinases: The present invention relates to compounds and methods useful as inhibitors of protein kinases, including B-Raf and several receptor tyrosine and cytoplasmic tyrosine kinases. The present invention is directed to new substituted pyrimidinyloxy urea compounds of Formulas II, III and IV and compositions and their application as pharmaceuticals for the... Agent: International Patent Group Attn: Ms Lavern Hall 20070155748 - N-sulfonyl-alpha-amino-acid derivatives: The invention relates to N-sulfonyl-α-amino-acetic acid derivatives of the general formula (I): including the optical isomers thereof and mixtures of such isomers, wherein Ar1 and Ar2 independently of each other stand for an optionally substituted aryl or heteroaryl group, R1 and R2 stand independently of each other for hydrogen, optionally... Agent: Syngenta Crop Protection , Inc. Patent And Trademark Department 20070155749 - Derivatives of 1,4-diazabicyclo[3.2.1]octanecarboxamide, preparation method thereof and use of same in therapeutics: e 20070155750 - Integrin-binding small molecules: The present invention relates to compositions containing integrin-binding small molecules. Also disclosed are methods of binding integrins to these small molecules and methods of identifying small molecules binding to integrins.... Agent: Hogan & Hartson L.L.P. 20070155751 - Novel imidazopyrazines as cyclin dependent kinase inhibitors: In its many embodiments, the present invention provides a novel class of imidazo[1,2-a]pyrazine compounds as inhibitors of cyclin dependent kinases, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment, prevention, inhibition,... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990) 20070155752 - 2-amino-o4-substituted pteridines and their use as inactivators of o6-alkylguanine-dna alkyltransferase: Disclosed are pteridine derivatives of formula (I): (I), wherein, for example, R1 and R2 are hydrogen, C1-C6 alkyl, carboxyl, formyl, C1-C6 hydroxyalkyl, C1-C6 carboxyalkyl, C1-C6 formyl alkyl, C1-C6 alkoxy, acyloxy, acyloxyalkyl wherein the alkyl is C1-C6, halogen, or hydroxy, or a group of formula II: (II); and R3 is (a)... Agent: Leydig, Voit & Mayer, Ltd. 20070155753 - 5-(arylsulfonyl)-pyrazolopiperidines: wherein A, B, R1, R1a, R2, R2a, R3 and R3a are as described in the specification. Compounds of Formula I are useful in treating or preventing cognitive disorders, such as Alzheimer's disease. The invention also encompasses pharmaceutical compositions comprising compounds of Formula I, methods of preparing compounds of formula I,... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP 20070155754 - Histamine h3 receptor antagonists, preparation and therapeutic uses: The present invention discloses novel compounds of Formula I or pharmaceutically acceptable salts thereof which have histamine-H3 receptor antagonist activity as well as methods for preparing such compounds. In another embodiment, the invention discloses pharmaceutical compositions comprising compounds of Formula I as well as methods of using them to treat... Agent: Eli Lilly & Company 20070155755 - N-arylshydroxyalkylidene-carboxamide compositions and methods: N-(Substituted-aryl-hydroxyalkylidene)-cycloalkyl carboxamide compositions are disclosed that target molecular elements on sensory nerves. These compounds, preferably administered topically, inhibit the perception of itch and pain and have prolonged duration of action.... Agent: Edward T. Wei 20070155756 - Treatment of chemokine mediated diseases: ( 20070155757 - Use of pyrimidine compounds in the preparation of parasiticides: The invention relates to the use of compounds of the general formula (I), wherein R1, R2, R3, R4, R5, R6, R7, R8, R9, R10, R11, R12, R13, X1 and X2 have the significances given in claim 1, and optionally the enantiomers and geometrical isomers thereof, for controlling parasites on warm-blooded... Agent: Novartis Corporate Intellectual Property 20070155758 - Crystalline n-(4-(4-aminothieno[2,3-d]pyrimidin-5-yl)phenyl)-n'-(2-fluoro-5-(trifluoromethyl)phenyl)urea ethanolate: A crystalline N-(4-(4-aminothieno[2,3-d]pyrimidin-5-yl)phenyl)-N′-[2-fluoro-5-(trifluoromethyl)phenyl)urea ethanolate, ways to make it, compositions comprising it, and methods of treatment using it are disclosed.... Agent: Robert Deberardine Abbott Laboratories 20070155759 - Pharmaceutical uses: wherein X and Y are each independently of the other N and/or CH and the ring A is unsubstituted or mono- or poly-substituted by substituents selected from the group consisting of lower alkyl, lower alkoxy, halogen, nitro and trifluoromethyl; and pharmaceutically acceptable salts thereof for treatment of chronic fatigue syndrome... Agent: Novartis Corporate Intellectual Property 20070155760 - Arylindenopyridines and arylindenopyrimidines and related therapeutic and prophylactic methods: e 20070155761 - Indol-3-yl-carbonyl-spiro-piperidine derivatives: wherein the spiropiperidine-head group A and the residues R1, R2 and R3 are as defined herein. The invention further relates to pharmaceutical compositions containing such compounds, their use in the treatment of dysmenorrhea, hypertension, chronic heart failure, inappropriate secretion of vasopressin, liver cirrhosis, nephrotic syndrome, obsessive compulsive disorder, anxiety and... Agent: Hoffmann-la Roche Inc. Patent Law Department 20070155762 - 5,6-trimethylenepyrimidin-4-one compounds: e 20070155764 - Novel substituted pyrimidinyloxy ureas useful as inhibitors of protein kinases: The present invention relates to compounds and methods useful as inhibitors of protein kinases, including B-Raf and several receptor tyrosine and cytoplasmic tyrosine kinases. The present invention is directed to new substituted pyrimidinyloxy urea compounds of Formulas II, III and IV and compositions and their application as pharmaceuticals for the... Agent: International Patent Group Attn: Ms Lavern Hall 20070155763 - Trisubstituted aryl and heteroaryl derivatives as modulators of metabolism and the phophylaxis and treatment of disorders related thereto: e 20070155766 - Gtpase inhibitors and methods of use and crystal structure of rac-1 gtpase: The preferred embodiments generally relate to methods and compositions that affect the GTP-binding activity of members of the Rho family GTPases, preferably Rac (Rac1, Rac2 and/or Rac3), such compositions include compounds that modulate the GTP/GDP exchange activity, along with uses for the compounds including screening for compounds which recognize Rac... Agent: Knobbe Martens Olson & Bear LLP 20070155765 - Method of preparation of the hemi-calcium salt of (e)-7-[4-(4fluorophenyl)-6-isopropyl-2-[methyl(methylsulfonvl)aminolpyrimidin-5-yl](3r,5s)-3,5-, dihvdroxy-6-heptenoic acid: A method of preparation of the hemi-calcium salt of rosuvastatin of formula (I) consists in extracting an aqueous solution of the sodium or potassium salt of (E)-7-[4-(4-fluorophenyl)-6isopropyl-2-[methyl(methylsulfonyl)amino]pyrimidin-5-yl](3R,5S)-3,5-dihydroxy-6-heptenoic acid, with optional admixture of sodium or potassium hydroxide or other sodium or potassium salts having inorganic anions, with an organic solvent, incompletely... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C. 20070155767 - Sulfone substituted imidazo ring ethers: Imidazo ring compounds (e.g., imidazoquinolines, 6,7,8,9-tetrahydroimidazoquinolines, imidazonaphthyridines, and 6,7,8,9-tetrahydroimidazonaphthyridines) with a sulfide-, sulfinyl-, or sulfonyl-containing ether substituent at the 1-position, pharmaceutical compositions containing the compounds, intermediates, methods of making the compounds, and methods of use of these compounds as immunomodulators, for inducing cytokine biosynthesis in animals and in the treatment... Agent: 3m Innovative Properties Company 20070155768 - Pharmaceutical composition of vinflunine which is intended for parenteral administration preparation method thereof and use of same: The invention relates to a pharmaceutical composition of vinflunine in the form of a stable sterile aqueous solution of a water-soluble salt of vinflunine with a pH of between 3 and 4. The invention also relates to the method of preparing said composition and to the use thereof as a... Agent: Birch Stewart Kolasch & Birch 20070155769 - Use of 14,15-dihydro-20,21-dinoreburnamenin-14-ol for the treatment and/or prevention of serious depression and sleep/waking cycle disorders: The invention relates to a novel therapeutic use of 14,15-dihydro-20,21-dinoreburnamenin-14-ol for the treatment of serious depression in humans, particularly for the treatment of a patients resistant to conventional anti-depressant treatments and for treatment of sleep/waking cycle disorders.... Agent: Foley And Lardner LLP Suite 500 20070155770 - Treatment of anoragasmia or delayed orgasm: Described herein are compositions and methods for use in the treatment of anorgasmia and/or delayed orgasm. In various embodiments, the compositions include a dopamine receptor agonist and/or an antiprolactin. Cabergoline is a dopamine receptor agonist suitable for use in connection with particular embodiments of the invention. Its analogs, salts, equivalents,... Agent: Davis Wright Tremaine LLP 20070155771 - Methods and means for treating protein conformational disorders: This invention relates to the recognition that autophagy plays a key role in the clearance of the intracellular protein aggregates which characterise Protein Conformational Disorders, such as Huntington's disease and Parkinson's disease. Methods and uses of autophagy inducing agents, such as rapamycin macrolides, in the treatment of Protein Conformational Disorders,... Agent: Nixon & Vanderhye, PC 20070155772 - Use of genetic polymorphisms that associate with efficacy of treatment of inflammatory disease: The MHC III region of chromosome 6p21.3 harbors a DNA sequence, most likely within the TNF or LTA gene, which influences response to pimecrolimus for the treatment of atopic dermatitis. Accordingly, genetic polymorphisms in the TNF and LTA genes are useful as biomarkers of the efficacy of pimecrolimus treatment of... Agent: Novartis Corporate Intellectual Property 20070155773 - Use of tiotropium salts in the treatment of moderate persistent asthma: The instant invention relates to the use of tiotropium salts for the manufacture of a medicament for the treatment of patients suffering from moderate persistent asthma.... Agent: Michael P. Morris Boehringer Ingelheim Corporation 20070155774 - Oral formulations of desoxypeganine and thereof uses: Orally administrable film-shaped medicaments which contain the active substance deoxypeganine or/and a deoxypeganine derivative. The medicaments can be used for transmucosal administration of active substances.... Agent: Sean F Mellino D Peter Hochberg 20070155775 - Quinoline inhibitors of cgmp phosphodiesterase: a 20070155777 - Antiinflammation agents: Compounds, compositions and methods that are useful in the treatment of inflammatory, immunoregulatory, metabolic, infectious and cell proliferative diseases or conditions are provided herein. In particular, the invention provides compounds which modulate the expression and/or function of proteins involved in inflammation, metabolism, infection and cell proliferation. The subject compounds contain... Agent: Jones Day 20070155776 - Thienopyridine and furopyridine kinase inhibitors: m 20070155778 - 4-trifluoromethoxyphenoxybenzol-4-sulfonic acids, method for the production and use thereof in medicaments: 20070155779 - Bicyclic heteroaryl compounds as pde10 inhibitors: The invention pertains to bicyclic heteroaryl compounds that serve as effective phosphodiesterase (PDE) inhibitors The invention also relates to compounds which are selective inhibitors of PDE-10. The invention further relates to intermediates for preparation of such compounds; pharmaceutical compositions comprising such compounds; and the use of such compounds in methods... Agent: Pfizer Inc 20070155781 - Nitrosated and nitrosylated compounds and compositions and their use for treating respiratory disorders: Disclosed are (i) compounds of a steroid, a β-agonist, an anticholinergic, a mast cell stabilizer and a phosphodiesterase (PDE) inhibitor directly or indirectly linked to a NO or NO2 group or a group which stimulates endogenous production of NO or EDRF in vivo; (ii) compositions of steroids, β-agonists, anticholinergics, mast... Agent: Wilmer Cutler Pickering Hale And Dorr LLP 20070155780 - Stabilized composition containing 4-amino-5-chloro-n-[(1r, 3r, 5s)-8-methyl-8-azabicyclo[3.2.1]oct-3-y1]-2-[1-methylbut-2-ynyloxy]benzamide: The present invention provides stable pharmaceutical compositions containing 4-amino-5-chloro-N-[(1R,3r,5S)-8-methyl-8-azabicyclo[3.2.1]oct-3-yl]-2-[1-methylbut-2-ynyloxy]benzamide. Specifically, it provides pharmaceutical compositions containing 1) 4-amino-5-chloro-N-[(1R,3r,5S)-8-methyl-8-azabicyclo[3.2.1]oct-3-yl]-2-[1-methylbut-2-ynyloxy]benzamide, a pharmacologically acceptable salt thereof or a hydrate of them; and 2) a basic additive.... Agent: Birch Stewart Kolasch & Birch 20070155782 - Nk-1 receptor antagonists anesthesia recovery: The present invention is directed to the administration of a compound of the Formula (I) and (Ia), wherein R2 is selected from the group consisting of methyl, ethyl, isopropyl, sec-butyl and tert-butyl, to an animal to improve anesthesia recovery... Agent: Pharmacia & Upjohn 20070155785 - Hydroxamic acid compounds and methods of use thereof: The present invention relates to a novel class of hydroxamic acid derivatives having at least two aryl containing groups, at least one of which is a quinolinyl, isoquinolinyl or benzyl moiety, linked to the hydroxamic acid group through a methylene chain. The hydroxamic acid compounds can be used to treat... Agent: Mintz Levin Cohn Ferris Glovsky & Popeo 20070155784 - Novel nitrogen-containing heteroaryl compounds and methods of use thereof: The present invention relates to compounds suitable for use in mediating hypoxia inducible factor and for treating erythropoietin-associated conditions by increasing endogenous erythropoietin in vitro and in vivo.... Agent: Foley & Lardner LLP 20070155783 - Substituted cyclohexyl and piperidinyl derivates as melanocortin-4 receptor modulators: The present invention relates to novel substituted cyclohexyl and piperidinyl derivatives as melanocortin-4. receptor (MC-4R) modulators. MC-4R agonists of the invention can be used for the treatment of disorders and diseases such as obesity, diabetes and sexual dysfunction, whereas the MC-4R antagonists are useful for the treatment of disorders and... Agent: Michael Best & Friedrich, LLP 20070155786 - Methods for treating oral aphthous stomatitis and oral mucositis: The invention provides a composition comprising certain quinoline derivatives for ameliorating, treating, and preventing aphthous stomatitis and oral mucositis. The composition, optionally containing also an antiseptic, efficiently alleviates various oral conditions, such as aphthae, even at low concentrations of the active substance.... Agent: Kevin D Mccarthy Roach Brown Mccarthy & Gruber 20070155787 - Amine salt of carbostyril derivative: The invention provides an amine salt of a carbostyril derivative formed from a carbostyril derivative represented by the formula (1) [wherein R is a halogen atom; the substituted position of the side chain is 3- or 4-position in the carbostyril skeleton; and the bonding between 3- and 4-positions of the... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP 20070155788 - Quinoline inhibitors of cgmp phosphodiesterase: e 20070155790 - Meta-benzamidine derivatives as serine protease inhibitors: 20070155789 - N-[phenyl(piperidin-2-yl)methyl]benzamide derivatives, preparation thereof, and use thereof in therapy: in which R1 represents either a hydrogen atom, or an optionally substituted alkyl group, or a cycloalkylalkyl group, or an optionally substituted phenylalkyl group, or an alkenyl group, X represents a hydrogen atom or one or more substituents chosen from halogen atoms and trifluoromethyl, alkyl and alkoxy groups, R2 represents... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC 20070155791 - Methods for treating cutaneous lupus using aminoisoindoline compounds: Methods of treating cutaneous lupus in a human are disclosed. Specific methods encompass the administration of (+)-2-[1-(3-ethoxy-4-methoxyphenyl)-2-methylsulfonylethyl]-4-acetylaminoisoindoline-1,3-dione, 4-(amino)-2-(2,6-dioxo(3-piperidyl))-isoindoline-1,3-dione (ACTIMID™), 3-(4-amino-1-oxo-1,3-dihydro-isoindol-2-yl)-piperidine-2,6-dione (REVLIMID®), or cyclopropyl 2-[(1S)-1-(3-ethoxy-4-methoxyphenyl)-2-(methylsulfonyl)ethyl]-3-oxoisoindolin-4-yl}carboxamide, alone or alternatively, in combination with a second active agent.... Agent: Jones Day 20070155792 - Peptide deformylase inhibitors: PDF inhibitors and novel methods for their use are provided.... Agent: Glaxosmithkline Corporate Intellectual Property - Uw2220 20070155793 - 4-(5-aminomethyl)-indole-1-ylmethyl)-benzamide derivatives and related compounds as opioid receptor antagonists for the treatment of obesity: The present invention relates to compounds of formulae (I) and (II) useful as opioid receptor antagonists for the treatment of obesity, wherein p is 0, 1, or 2; y is 0, 1, or 2; and z is 0, 1, or 2; X1 is CH2, CH, or N; to form a... Agent: Eli Lilly & Company 20070155795 - Muscarinic agonists: Compounds and methods are provided for the treatment of disease conditions in which modification of cholinergic, especially muscarinic m1, m4, or both m1 and m4, receptor activity has a beneficial effect. In the method, an effective amount of a compound is administered to a patient in need of such treatment.... Agent: Knobbe Martens Olson & Bear LLP 20070155794 - Pyridones useful as inhibitors of kinases: The present invention relates to compounds useful as inhibitors of protein kinase. The invention also provides pharmaceutically acceptable compositions comprising said compounds and methods of using the compositions in the treatment of various disease, conditions, or disorders. The invention also provides processes for preparing compounds of the inventions.... Agent: Vertex Pharmaceuticals Inc. 20070155796 - Crystals of benzimidazole compounds: Crystals of (S)-2[[[3-methyl-4-(2,2,2-trifluoroethoxy)-2-pyridinyl]methyl]sulfinyl]-1H-benzimidazole or salts thereof, useful as excellent antiulcer drugs.... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070155798 - Novel oxazolidinone derivatives: The present invention relates to novel derivatives of oxazolidinone, a method thereof and pharmaceutical compositions comprising the derivatives for use in an antibiotic. The oxazolidinone derivatives of the present invention show inhibitory activity against a broad spectrum of bacteria and lower toxicity. The prodrugs, prepared by reacting the compound having... Agent: Sughrue Mion, PLLC 20070155797 - Synergistic insecticidal mixtures: The invention relates to insecticide mixtures comprising thiodicarb and at least one other known active ingredient from the category of chloronicotinyls, as well as the use of these mixtures to control animal pests.... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c. 20070155799 - Carbonates of fenicol antibiotics: Novel fenicol compounds having useful properties as antibiotic prodrugs, are provided, together with methods of making and using these new compounds.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990) 20070155800 - Application methods to rapidly alter disease and injury states using molecular transport of b6: The present invention discloses methods of application employing B5/B6 vitamins in molecular transport creams or gels to deliver B6 in a high dose to bring about therapeutic ways in human or mammal tissues to reverse a disease process or injury to bring about normal function of the affected tissues. Examples... Agent: Alfred A Nickel, Ms, Dds 20070155801 - Advanced glycation end-product intermediaries and post-amadori inhibition: The instant invention provides compositions and methods for modeling post-Amadori AGE formation and the identification and characterization of effective inhibitors of post-Amadori AGE formation, and such identified inhibitor compositions.... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP 20070155802 - Fungicide composition comprising an arylamidine derivative and known fungicide compounds: The present invention relates to a fungicide composition based on N2-phenylamidine derivatives and another fungicide compound, preferably fluoxastrobin or prothioconazole, and a method for protecting plants against fungal diseases using such a composition.... Agent: Ostrolenk Faber Gerb & Soffen 20070155803 - Protease inhibitors: A monoacyl semicarbazide of the general formula (I): (I), or a pharmaceutically acceptable salt or ester thereof, is capable of selectively inhibiting dipeptidyl-peptidase I (DPP-I), also known as cathepsin C. A compound of the invention is useful as an active substance for the treatment of inflammation, type 2 diabetes, asthma,... Agent: Birch Stewart Kolasch & Birch 20070155804 - Mitotic kinesin inhibitor: [wherein R1 represents a hydrogen atom and the like, R2 represents a hydrogen atom, —C(═W)R6 (wherein W represents an oxygen atom or a sulfur atom, and R6 represents substituted or unsubstituted lower alkyl and the like) and the like, R3 represents —C(═Z)R19 (wherein Z represents an oxygen atom or a... Agent: Greenblum & Bernstein, P.L.C 20070155805 - Benzofuran and bezothiophene derivatives useful for the treatment of cardiovascular disease: A compound of formula (I) and pharmaceutically acceptable salts and solvates and hydrolysable esters thereof.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475 20070155806 - Novel luciferin derivatives: [wherein X1 and X2 represent hydrogen atom, or a group represented as —N(R3)(R4) (R3 and R4 represent hydrogen atom, a C1-6 alkyl group, a C1-6 alkylcarbonyl group, or a C1-6 alkyloxycarbonyl group); and n represents an integer of 1 to 6], provided that R1 and R2 do not simultaneously represent... Agent: Greenblum & Bernstein, P.L.C 20070155807 - Thiazolidinone amides, thiazolidine carboxylic acid amides, and serine amides, including polyamine conjugates thereof, as selective anti-cancer agents: h 20070155808 - Phenylpropanoic acid derivatives: wherein each symbol is as defined in the specification, a salt thereof and a prodrug thereof have unexpectedly superior GPR40 receptor agonist activity and also show superior properties as a pharmaceutical product, such as stability and the like. Thus, they can be safe and useful drugs for the prophylaxis or... Agent: Wenderoth, Lind & Ponack, L.L.P. 20070155809 - Triazole compounds that modulate hsp90 activity: The present invention relates to substituted triazole compounds and compositions comprising substituted triazole compounds. The invention further relates to methods of inhibiting the activity of Hsp90 in a subject in need thereof and methods for preventing or treating hyperproliferative disorders, such as cancer, in a subject in need thereof comprising... Agent: Hamilton, Brook, Smith & Reynolds, P.C. 20070155810 - Peptide deformylase inhibitors: Novel PDF inhibitors and novel methods for their use are provided.... Agent: Glaxosmithkline Corporate Intellectual Property - Uw2220 20070155811 - Method for synthesing 5-chloro-1-aryl-4-(4,5-dicyano-1h-imidazol-2-yl)-3-alkyl-1h-pyrazole derivatives: Method for synthesising 1-aryl-4-(imidazol-2-yl)-3-alkyl-1H-pyrazole derivatives from 1-aryl-3-alkyl-1H-pyrazo-line-5-one derivatives.... Agent: Lowe Hauptman Berner, LLP 20070155812 - Thio-substituted phenbutazone compounds as anti-inflammatory, anti-viral and immunomodulatory agents: wherein R1 is O or S, R2 is hydrogen or a C1-C10 organic group attached by a carbon atom, X is H, O, OO, S or SS R3 is absent where X=H, is hydrogen or is a hydroxyl or thiol protecting group, R4 is a hetero- or homo-cyclic aryl group,... Agent: Bacon & Thomas, PLLC 20070155813 - Hsp90 family protein inhibitors: e 20070155814 - Immunomodulatory compositions: are disclosed. In these compounds R is selected from hydrogen, straight or branched, unsubstituted or substituted, saturated or unsaturated acyl, alkyl (e.g. cycloalkyl), alkenyl, alkynyl and aryl groups. The compounds are useful in therapy and prophylaxis, including increasing the Th1:Th2 response ratio, hemorestoration, alleviation of immunosuppression, cytokine stimulation, treatment of... Agent: Heslin Rothenberg Farley & Mesiti PC 20070155815 - Salinosporamides and methods for use thereof: The present invention is based on the discovery that certain fermentation products of the marine actinomycete strains CNB392 and CNB476 are effective inhibitors of hyperproliferative mammalian cells. The CNB392 and CNB476 strains lie within the family Micromonosporaceae, and the generic epithet Salinospora has been proposed for this obligate marine group.... Agent: Lisa A. Haile J.d., Ph.d. Dla Piper US LLP 20070155816 - Indirubin derivatives having anticancer property against human cancer cell line: The present invention relates to an indirubin derivative having anticancer property by inhibiting cell proliferation as to human cancer cell line. More particularly, this invention provides the synthesis of indirubin derivative known as CDK(Cyclin-dependent kinase) inhibitor. Further, inhibition activity of proliferation as to human cancer cell line and apoptosis against... Agent: Kenyon & Kenyon LLP 20070155817 - Indolylmaleimide derivatives: Indolylmaleimide derivatives comprising either a substituted phenyl, naphthyl, tetrahydronaphthyl, quinazolinyl, quinolyl, isoquinolyl or pyrimidinyl residue have interesting pharmaceutical properties, e.g. in the treatment and/or prevention of T-cell mediated acute or chronic inflammatory diseases or disorders, autoimmune diseases, graft rejection or cancer.... Agent: Novartis Corporate Intellectual Property 20070155818 - Ppar active compounds: Compounds are described that are active on PPARs, including pan-active compounds. Also described are methods for developing or identifying compounds having a desired selectivity profile.... Agent: Foley & Lardner LLP 20070155819 - Calcilytic compounds: Novel calcilytic compounds and methods of using them are provided.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220 20070155820 - Substituted aryloxypropylamines with serotoninergic and/or norepinephrinergic activity: Chemical syntheses and medical uses of novel inhibitors of the uptake of monoamine neurotransmitters and pharmaceutically acceptable salts and prodrugs thereof, for the treatment and/or management of psychotropic disorders, anxiety disorder, generalized anxiety disorder, depression, post-traumatic stress disorder, obsessive-compulsive disorder, panic disorder, hot flashes, senile dementia, migraine, hepatopulmonary syndrome, chronic... Agent: Jones Day 20070155823 - Use of benzo-fused heterocycle sulfamide derivatives as neuroprotective agents: The present invention is a methods for neuroprotection, for treating an acute neurodegenerative disorder, for treating a chronic neurodegenerative disorder and/or for preventing neuron death or damage following brain, head and/or spinal cord trauma or injury comprising administering to a subject in need thereof a therapeutically effective amount of one... Agent: Philip S. Johnson Johnson & Johnson 20070155824 - Use of benzo-fused heterocycle sulfamide derivatives for disease modification / epileptogenesis: The present invention is a method for treating, preventing, reversing, arresting or inhibiting the occurrence, development and maturation of seizures or seizure-related disorders. More specifically, the present invention is directed to methods for the use of benzo-fused heterocycle sulfamide derivatives of formula (I) and formula (II) as described herein to... Agent: Philip S. Johnson Johnson & Johnson 20070155821 - Use of benzo-fused heterocycle sulfamide derivatives for lowering lipids and lowering blood glucose levels: The present invention is a method for the glucose related disorders and lipid related disorders comprising administering to a subject in need thereof a therapeutically effective amount of one or more novel benzo-fused heterocycle sulfamide derivatives of formula (I) or formula (II) as herein defined. The present invention is further... Agent: Philip S. Johnson Johnson & Johnson 20070155827 - Use of benzo-fused heterocycle sulfamide derivatives for the treatment of depression: The present invention is a method for the treatment of depression comprising administering to a subject in need thereof a therapeutically effective amount of one or more novel benzo-fused heterocycle sulfamide derivatives of formula (I) and formula (II) as herein defined. The present invention is directed to a method for... Agent: Philip S. Johnson Johnson & Johnson 20070155822 - Use of benzo-fused heterocycle sulfamide derivatives for the treatment of pain: The present invention is a method for the treatment of pain comprising administering to a subject in need thereof a therapeutically effective amount of one or more novel benzo-fused heterocycle sulfamide derivatives of formula (I) and formula (II) as described herein. The present invention is further directed to methods for... Agent: Philip S. Johnson Johnson & Johnson 20070155825 - Use of benzo-fused heterocycle sulfamide derivatives for the treatment of substance abuse and addiction: The present invention is a method for the treatment of alcohol abuse and/or addiction comprising administering to a subject in need thereof a therapeutically effective amount of one or more novel benzo-fused heterocycle sulfamide derivatives of formula (I) and/or formula (II) as herein defined.... Agent: Philip S. Johnson Johnson & Johnson 20070155826 - Use of benzo-fused heterocyle sulfamide derivatives for the treatment of mania and bipolar disorder: The present invention is a method for the treatment of mania and/or bipolar disorder comprising administering to a subject in need thereof a therapeutically effective amount of one or more novel benzo-fused heterocycle sulfamide derivatives of formula (I) and formula (II) as herein defined.... Agent: Philip S. Johnson Johnson & Johnson 20070155828 - Coumarin analog compounds for safer anticoagulant treatment: The present invention relates to the albumin-guided development of coumarin analogs and the analogs developed thereby. The coumarin analogs of the present invention are identified and isolated by the fact that they have binding sites to albumin which are different than the binding sites of conventional coumarin analogs such as... Agent: Stites & Harbison PLLC 20070155829 - Agent for controlling bcl-2 expression comprising ginsenoside f1 as an active component: The present invention relates to an agent for controlling Bcl-2 expression comprising ginsenoside F1 (20-O-β-D-glucopyranosyl-20(S)-protopanaxatriol) represented by the following formula 1 as an active component. [Formula 1]... Agent: Sughrue Mion, PLLC 20070155830 - Concentricolide and its derivatives, process for preparing them, pharmaceutical composition comprising the same and its use: The present invention relates to concentricolide and its derivatives, a method for the preparation of the compound and its derivatives, a pharmaceutical composition containing concentricolide and its derivatives, and use of the compound and its derivatives for the treatment and prevention of infection caused by human immunodeficiency virus (HIV).... Agent: Seed Intellectual Property Law Group PLLC 20070155831 - Process for the preparation of n-alkyl-2(hydroxy-4 benzoyl)-3 benzofurans and its intermediates thereof: in which R represents a linear or branched alkyl radical including from 1 to 5 carbon atoms and R1 represents a linear or branched alkyl radical including from 1 to 3 carbon atoms, a linear or branched alkoxy radical including from 1 to 3 carbon atoms, a halogen atom or... Agent: Clariant Corporation Intellectual Property Department 20070155832 - Use of sulfonamide compounds for the treatment of diabetes and/or obesity: The use of a compound of Formula (1): wherein for example: X and Y are independently selected from: oxygen, sulphur and (—CRaRb—)n; wherein: n is an integer of from 1 to 4 and Ra and Rb are each independently selected from hydrogen, C1-6altkyl, C1-6alkoxy, halo, hydroxy, C1-6alkanoyloxy, C3-12cycloalkyl and optionally... Agent: Morgan Lewis & Bockius LLP 20070155833 - Oxaliplatin formulations: The present invention provides a pharmaceutical liquid formulation of oxaliplatin for parenteral administration, said formulation comprising (i) oxaliplatin, (ii) water; and (iii) an additive selected from the group consisting of tartaric acid, a salt of tartaric acid, a pharmaceutically acceptable derivative of tartaric acid and mixtures thereof.... Agent: Winston & Strawn LLP Patent Department 20070155834 - Acetylenic aryl sulfonate hydroxamic acid tace and matrix metalloproteinase inhibitors: e 20070155835 - Use of ortho-phenylphenol and/or derivatives thereof for inhibiting the asexual reproduction of fungi: The use of ortho-phenylphenol and/or derivatives thereof to inhibit the asexual reproduction of fungi, and to filter media, construction materials, construction adjuvants, textiles, furs, paper, hide, or leather. Also, washing agents, cleaning agents, rinsing agents, hand washing agents, hand dishwashing agents, automatic dishwashing agents, and agents for finishing construction materials,... Agent: Henkel Corporation 20070155836 - Steroids having a mixed androgenic and progestagenic profile: This invention provides 19-nor-D-homos-teroids, having a mixed androgenic/progestagenic profile, which are orally active, prevent trabecular bone mineral density (BMD) loss, and which lack liver toxicity, having a structure according to the formula (I) wherein, R1 is O, or NOR, with R being hydrogen, (C1-6)alkyl or (C1-6)acyl, R2 is methyl or... Agent: Akzo Nobel Inc. 20070155837 - Enhancement of urogenital function: An exemplary method of treating a urologic symptom includes administering a daily dose of creatine monophosphate (a phosphorylated creatine) to an individual wherein the daily dose of creatine monophosphate lies in a range from about 0.4 mg to about 4.0 mg per kilogram body weight. Such an exemplary method may... Agent: Lee & Hayes, PLLC 20070155838 - New method for treating urinary disorders: The present invention relates to a method, preferable an oral method, for treating urinary disorders, such as unstable or overactive bladder, while minimizing the occurrences of dry mouth, dyspeptia and reduced stream of tears. The methods of the present invention comprise orally administering to a mammal, preferably a human, a... Agent: Pfizer Inc. 20070155839 - Cycloalkylidene compounds as modulators of estrogen receptor: The present invention relates to novel compounds with a variety of therapeutic uses, more particularly novel substituted cyclic alkylidene compounds that are particularly useful for selective estrogen receptor modulation.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475 20070155840 - Use of quaternary ammonium compounds in the prevention of mold, mildew, and funguses in new and/or existing construction: The present invention relates to the use of quaternary ammonium compounds in the prevention of microbial growth such as mold, fungus, and mildew in new and/or existing construction.... Agent: Edgar Spielman Albemarle Corporation 20070155841 - Preventive agent for carcinogenesis of liver cancer containing quinone-based compound as active ingredient: The present invention provides a safe and effective drug to prevent carcinogenesis of liver cancer derived, above all, from hepatitis C virus cirrhosis. The present invention provides a preventive agent for carcinogenesis of liver cancer containing menatetrenone as an active ingredient, and is effective in preventing the carcinogenesis of liver... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c. 20070155842 - Method of treating skin requiring intense pulse light (ipl) procedure: A treatment regimen for treating skin subject to an Intense Pulse Light procedure involves the application of supplemental composition(s) such as preparatory composition(s), protective composition(s), and combinations thereof, and a corrective composition.... Agent: Carter, Deluca, Farrell & Schmidt, LLP Previous industry: Perfume compositionsNext industry: Colloid systems and wetting agents; subcombinations thereof; processes of ###### RSS FEED for 20091029: Integrate FreshPatents.com into your RSS reader/aggregator or website to track weekly updates. For more info, read this article. ###### Thank you for viewing Drug, bio-affecting and body treating compositions patents on the FreshPatents.com website. These are patent applications which have been filed in the United States. There are a variety ways to browse Drug, bio-affecting and body treating compositions patent applications on our website including browsing by date, agent, inventor, and industry. If you are interested in receiving occasional emails regarding Drug, bio-affecting and body treating compositions patents we recommend signing up for free keyword monitoring by email. ### FreshPatents.com Support Results in 3.13006 seconds |
* Easy, fast online form * Protect your Inventions * US Patent Office filing Provisional Patent Utility Patent - - - - - - - - - - - - - - - - - - - - - - * Fast online form * Protect your Name/Design * US Government filing Trademark Services - - - - - - - - - - - - - - - - - - - - - - PATENT INFO |