Drug, bio-affecting and body treating compositions inventions 05/07

20070123448 - Novel chemical entities affecting neuroblastoma tumor-initiating cells: Disclosed are neuroblastoma tumor-initiating cell inhibiting compositions comprising chemical entities capable of affecting neuroblastoma tumor-initiating cells. Pharmaceutical preparations that include these chemical entities are also provided for the treatment of neuroblastoma. These pharmaceutical preparations are suitable for the treatment of humans, and are particularly suited for the treatment of children... Agent: Jagtiani + Guttag

20070123449 - High load particles for inhalation having rapid release properties: The invention generally relates to formulations having particles comprising phospholipids, bioactive agent and excipients and the pulmonary delivery thereof. Dry powder inhaled insulin formulations are disclosed. Improved formulations comprising DPPC, insulin and sodium citrate which are useful in the treatment of diabetes are disclosed. Also, the invention relates to a... Agent: Elmore Patent Law Group, PC

20070123450 - Methods for production of the oxidized glutathione composite with cis-diamminedichloroplatinum and pharmaceutical compositions based thereof regulating metabolism, proliferation, differentiation and apoptotic mechanisms for normal and transformed cells: The present invention relates to a composite for the treatment of a variety of medical conditions, the composite comprising an oxidized glutathione-based compound, which has a disulfide bond, and a metal material, in particular where the metal is either platinum or palladium. The oxidized glutathione-based compound and metal material can... Agent: Wolf Greenfield & Sacks, P.C.

20070123451 - Use of adiponectin to diagnose and treat malignancy: Methods aiding in the diagnosis of endometrial cancer or a risk of endometrial cancer are disclosed, in which the level of adiponectin is assessed in a test sample. Methods aiding in the diagnosis of an epithelial cancer or a risk of an epithelial cancer are also disclosed, in which the... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20070123452 - Method of selecting novel immunosuppressant: The present invention provides a method of selecting an IL-2 production inhibitor and/or an immunocyte proliferation inhibitor having low GATA-1 production inhibitory activity, which comprises measuring the HDAC4 and/or HDAC8 inhibitory activity of a test substance, and a method of selecting an immunosuppressant having low thrombocytopenic activity, which comprises measuring... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070123454 - Peptide anti-tumor agent: Disclosed herein are isolated, purified peptides, biologically active fragments and analogs of the peptides having anti-tumor activity in mammals, pharmaceutical formulations comprising the peptides, fragments and analogs and methods of treating mammals suffering from tumors using such materials.... Agent: Darby & Darby P.C.

20070123453 - Uses of melanocortin-4 receptor (mc4r) agonist peptides administered by continuous infusion: The present invention provides a method of inducing weight loss in a patient, comprising continuous infusion of an effective amount of an MC4R agonist peptide into the patient. Additionally, the present invention provides a method of treating obesity in a patient, comprising continuous infusion of an effective amount of an... Agent: Eli Lilly & Company

20070123457 - Carrier chimeric proteins, targeted carrier chimeric proteins and preparation thereof: A chimeric carrier protein having a multimerization domain and at least one drug attached thereto via a spacer is disclosed. The protein may be targeted by associating at least one amino acid sequence having an amino acid domain targeted to a specific site of action. In a further embodiment of... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20070123458 - Contortrostatin (cn) and methods for its use in preventing metastasis and other conditions: Contortrostatin, a homodimeric disintegrin, modulates the adhesion, motility, and invasiveness of integrin expressing tumor cells. When formulated as a pharmaceutically acceptable composition, the proteins can be used to treat patients by inhibiting or disrupting disease processes associated with an integrin binding to an αvβ3 or αvβ5 integrin.... Agent: Foley & Lardner LLP

20070123462 - Effects of tissue transglutaminase on beta-amyloid-induced apoptosis: The present invention relates to a method of inhibiting beta-amyloid-induced death of neuronal cells in a subject by inhibiting human tissue transglutaminase in the subject under conditions effective to inhibit beta-amyloid-induced death of neuronal cells. Also disclosed are methods for identifying candidate compounds suitable for inhibiting beta-amyloid-induced death of neuronal... Agent: Nixon Peabody LLP - Patent Group

20070123459 - Il-17 like molecules and uses thereof: Novel IL-17 like polypeptides and nucleic acid molecules encoding the same. The invention also provides vectors, host cells, selective binding agents, and methods for producing IL-17 like polypeptides. Also provided for are methods for the treatment, diagnosis, amelioration, or prevention of diseases with IL-17 like polypeptides, agonists, or antagonists thereof.... Agent: Marshall, Gerstein & Borun LLP

20070123455 - Immunomodulatory agents for treatment of inflammatory diseases: The present invention provides methods and compositions suitable for treating inflammatory disorders such as allergy, asthma, artherosclerosis, autoimmune disease, infection, injury, meningitis, psoriasis, and transplant rejection. In particular, the present invention provides methods and compositions comprising human S100A8 and/or S100A9 for reducing inflammation.... Agent: Medlen & Carroll

20070123463 - Methods and compositions for modulating carbohydrate metabolism: Methods and compositions for modulating carbohydrate metabolism in a host are provided. In the subject methods, diacylglycerol acyltransferase (DGAT) activity (specifically DGAT1 activity) is modulated, e.g., reduced or enhanced, to achieve a desired insulin and/or leptin sensitivity, thereby modulating carbohydrate metabolism, e.g., increasing or decreasing blood glucose levels, glucose uptake... Agent: Bozicevic, Field & Francis LLP

20070123464 - Methods and reagents for treating inflammation and fibrosis: Methods are provided for providing anti-inflammatory activity and inhibiting a fibrotic disease, such as pulmonary fibrosis, in an individual. The methods comprise administering a biologically effective amount of latency-associated peptide (LAP) to the individual. Also provided are pharmaceutical compositions comprising LAP for use in accordance with these methods.... Agent: Calfee Halter & Griswold, LLP

20070123456 - Novel regulator of endothelial cell function and vessel remodeling: The present invention relates to previously unknown biological roles of Nogo-B. We have discovered that Nogo-B is a component of endothelial cells. We have also discovered that Nogo-B is highly expressed in intact blood vessels. The amino terminus of Nogo-B promotes the adhesion, spreading and migration of endothelial cells and... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20070123465 - Oligomeric peptides and their use for the treatment of hiv infections: e

20070123460 - Probiotic compounds from lactobacillus gg and uses therefor: The invention provides methods and compositions for the treatment of inflammatory disorders, such as inflammatory bowel diseases (IBDs). The use of bacteria-free, probiotic-derived compounds instead of live bacteria provides a safety advantage over the use of live bacteria. In addition, the administration of isolated compounds will provide more reliable dosing,... Agent: Marshall, Gerstein & Borun LLP

20070123461 - Reproductive management: A method for breeding, especially a method for breeding dairy cattle without use of heat detection prior to insemination.... Agent: Patterson, Thuente, Skaar & Christensen, P.A.

20070123466 - Method of treating recurrent miscarriages: Described are methods for treating, preventing, or reducing the risk of, miscarriages, especially recurrent miscarriages. The methods comprise administering to a female subject a therapeutic agent that modulates the activity or binding of components of the complement system, together with a pharmaceutically acceptable carrier. For example, the therapeutic agent can... Agent: Darby & Darby P.C.

20070123467 - Amniotic-derived peptide and uses thereof: The present invention relates to the method(s) of synthesis of and the therapeutic and cosmetic applications of biologically active peptides for improving the appearance of skin, for hastening wound healing and for treating and/or preventing the progression of various conditions, injuries and diseases, including but not limited to viral hepatitis... Agent: Law Offices Of Albert Wai-kit Chan, LLC

20070123468 - Prodrugs of active agents: Disclosed herein are prodrugs of active agents which contain at least one amine, phenol, carboxylic acid, or thiol functionality. Also disclosed herein are methods of making prodrugs of active agents, pharmaceutical compositions of prodrugs of active agents and methods of using prodrugs of active agents and pharmaceutical compositions.... Agent: Morgan, Lewis & Bockius, LLP

20070123469 - N- or c- terminally modified small peptides: N- or C-terminally modified small peptides having antiarrhythmic properties are disclosed, and in particular small peptides that possess improved pharmacokinetic properties such as having a reduced tendency to inhibit the activity of isozyme 3A4 of cytochrome P450 oxidase. The invention further relates to uses of said compounds in the preparation... Agent: Clark & Elbing LLP

20070123470 - Enhancement of growth hormone levels with a dipeptidyl peptidase iv inhibitor and a growth hormone secretagogue: The present invention is directed to methods for increasing levels of endogenous growth hormone in a mammal by the administration of a combination of a dipeptidyl peptidase IV (DP-IV) inhibitor and a growth hormone secretagogue.... Agent: Merck And Co., Inc

20070123471 - Derivative of glucose and of vitamin f, compositions comprising it, uses and preparation process: An O-acyl product derived from glucose which may be obtained by partial or total esterification of glucose and of vitamin F, comprising a mixture of esters, for example, monoesters, of glucose and of at least one acid chosen from linoleic acid, oleic acid, palmitic acid and stearic acid, compositions, for... Agent: Thomas L. Irving Finnegan, Henderson, Farabow,

20070123472 - Filtering predictive data: An apparatus, device, methods, computer program product, and system are described that access at least one dataset, based on at least one treatment parameter and at least one predictive basis, determine a graphical illustration of a first possible outcome of a use of the at least one treatment parameter with... Agent: Searete LLC Clarence T. Tegreene

20070123473 - Glycosylated steroid derivatives with anti-migratory activity: Glycosylated steroid compounds having anti-migratory activity and methods for their preparation are disclosed. Pharmaceutical compositions having an effective amount of the glycosylated steroid compounds are also disclosed. The glycosylated steroid compounds may be used as a medicament. Preparation of medicaments containing the glycosylated steroid compounds for treatment of diseases associated... Agent: Knobbe Martens Olson & Bear LLP

20070123474 - Novel loganin analogues and a process for the preparation thereof: The present invention provides novel loganin analogues and a process for the preparation thereof. The present invention further provides the use of Iridoid glycoside loganin isolated from the fruit pulp of Strychnos nux-vomica and its bioactive semi-synthetic analogues against various human cancer cell lines grown in-vitro.... Agent: Cooper & Dunham, LLP

20070123475 - Water-soluble etoposide analogs and methods of use thereof: Etoposide analogs with improved water-solubility such as 4′-O-Demethyl-4′-(N′,N′-dimethyl-glycyl)-4β-(4″-nitroanilino)-4-desoxy-podophyllotoxin (8) and 4′-O-Demethyl-4′-(N′,N′-dimethyl-glycyl)-4β-(4″-fluoroanilino)-4-desoxy-podophyllotoxin (9) are described, along with pharmaceutical formulations containing the same, methods of use thereof, and intermediates and methods of making the same.... Agent: Myers Bigel Sibley & Sajovec

20070123477 - Compositions comprising amphotericin b, methods, and systems: The present invention comprises compositions and formulations comprising amphotericin B, compositions and formulations comprising amphotericin B with one or more excipients, methods of making amphotericin B compositions and formulations, as well as systems for using amphotericin B compositions and formulations. Also provided are pharmaceutical compositions comprising the formulation, methods of... Agent: Nektar Therapeutics

20070123476 - Polyene antibiotic for controlling fungal growth in banana crops: The present invention relates to a process to treat banana plants against disease wherein a polyene antibiotic is applied on the plant. In particular a process is described to protect banana crops from the devastating Sigatoka and Panama diseases. To that effect, banana plants are treated with a preparation comprising... Agent: Nixon & Vanderhye, PC

20070123478 - Compositions useful for reducing nephrotoxicity and methods of use thereof: The present invention provides compositions and methods to reduce renal damage caused by nephrotoxic drugs. The invention provides compositions comprising an anionically substituted oligosaccharide, a nephrotoxic drug and a pharmaceutically acceptable carrier, where the oligosaccharide is present in an amount effective for substantially inhibiting the nephrotoxic effect of the drug.... Agent: Greenberg Traurig, LLP

20070123481 - Antisense iap oligonucleotides and uses thereof: The present invention features antisense IAP oligonucleotides and other negative regulators of the IAP anti-apoptotic pathway, and methods for using them to enhance apoptosis.... Agent: Philip Swain, Phd C/o Gowling Lafleur Henderson

20070123482 - Chemically modified oligonucleotides for use in modulating micro rna and uses thereof: This invention relates generally to chemically modified oligonuceotides useful for modulating expression of microRNAs and pre-microRNAs. More particularly, the invention relates to single stranded chemically modified oligonuceotides for inhibiting microRNA and pre-microRNA expression and to methods of making and using the modified oligonucleotides.... Agent: Fish & Richardson PC

20070123486 - Composition for coordinated vegf and pdgf expression, and methods of use: Compositions for co-expression of VEGF and PDGF at a desired ratio, and their methods of use, are provided.... Agent: Bozicevic, Field & Francis LLP

20070123484 - Double strand compositions comprising differentially modified strands for use in gene modulation: The present invention provides double stranded compositions wherein each strand is modified to have a motif defined by positioning of β-D-ribonucleosides and sugar modified nucleosides. More particularly, the present compositions comprise one strand having an alternating motif and another strand having a hemimer motif, a blockmer motif, a fully modified... Agent: Woodcock Washburn LLP

20070123483 - Method and composition for treating obesity by targeting cathespin: Methods and compositions are provided for modulating fat storage of animals by targeting the gene and gene products of cathepsins, particularly cathepsins L, K, and S. The method comprises: administering to the animal an agent that reduces an in vivo level of cathepsin L activity such that fat storage by... Agent: Wilson Sonsini Goodrich & Rosati

20070123487 - Methods and compositions for treating prostate cancer using dna vaccines: A DNA vaccine for the treatment of prostate cancer, comprising a plasmid vector comprising a nucleotide sequence encoding prostatic acid phosphatase (PAP) operably linked to a transcription regulatory element, wherein upon administration to a mammal a cytotoxic immune reaction against cells expressing PAP is induced. In preferred embodiment, the PAP... Agent: Quarles & Brady LLP

20070123480 - Oligonucleotides targeting prion diseases: Randomer phosphorothioate oligonucleotide compositions have been described that inhibit PrPc conversion to PrPcs with a high level of potency. Pharmaceutical compositions or kits containing such compounds, and methods of using such compounds in the treatment, control, or prevention of prion diseases are also described.... Agent: Birch Stewart Kolasch & Birch

20070123479 - Pharmaceutical compositions comprising bispecific anti-cd3, anti-cd19 antibody constructs for the treatment of b-cell related disorders: The present invention relates to a pharmaceutical composition comprising a bispecific single chain antibody construct, said bispecific single chain antibody construct comprising binding domains specific for human CD3 and human CD19, wherein the corresponding variable heavy chain regions (VH) and the corresponding variable light chain regions (VL) regions are arranged,... Agent: Foley And Lardner LLP Suite 500

20070123485 - Universal target sequences for sirna gene silencing: The present invention provides methods for designing a sequence for efficient short interference RNA molecules. In particular, the present invention defines a universal target for siRNA derived from the consensus sequence of the polyadenylation signal in conjunction with unique sequences for gene silencing and inhibition of viral replication in a... Agent: Winston & Strawn LLP Patent Department

20070123489 - Method and medicament for sulfated polysaccharide treatment of heparin-induced thrombocytopenia (hit) syndrome: A method and medicament for treating and preventing platelet activation or thrombosis in the presence of heparin- and platelet factor 4-complex reactive antibodies using a 2-O desulfated heparin with an average degree of sulfation of 0.6 sulfate groups per monosaccharide or greater and an average molecular weight or 2.4 kD... Agent: Alston & Bird LLP

20070123488 - Pharmaceutical composition comprising a zinc-hyaluronate complex for the treatment of multiple sclerosis: The invention relates to pharmaceutical compositions for the treatment of multiple sclerosis which comprises a zinc-hyaluronan complex, preferably a zinc-hyaluronan complex with a molecular weight of 800-1200 kDa, as active ingredient and a pharmaceutically acceptable carrier and/or additive. The process for the preparation of said pharmaceutical compositions as well as... Agent: The Firm Of Karl F Ross

20070123490 - Preventing or reducing oxidative stress or oxidative cell injury: A water-soluble cellulose derivative is useful for preventing or reducing oxidative stress or oxidative cell injury in tissues of an animal and in particular for regulating Stearoyl-CoA Desaturase-1 gene expression and/or ATPF1 gene expression in non-adipose tissues of the animal.... Agent: The Dow Chemical Company

20070123491 - Podophyllotoxin derivatives as igf-1r inhibitors: The invention refers to new compounds, e.g. podophyllotoxin derivatives, as well as to the use thereof and of known compounds as specific inhibitors of the insulin-like growth factor-1 receptor (IGF-1R). Said compounds can be used for treatment of IGF-1/IGF-1R dependent diseases, such as cancer, psoriasis, arteriosclerosis, certain endocrine and metabolic... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070123492 - Analogs of lysophosphatidic acid and methods of making and using thereof: Described herein are analogs of lysophosphatidic acid. Also described herein are methods of making and using analogs of lysophosphatidic acid.... Agent: Needle & Rosenberg, P.C.

20070123493 - Benzamide derivative: where A1 is C—X1 or N; Q1 is —A2═A3—, or a heteroatom selected from —O—, —S—, and —N(R10)—; Q2 is —A4═A5—, or a heteroatom selected from —O—, —S—, and —N(R10)—; provided that Q1 and Q2 are not heteroatoms at the same time; A2 is C—X2 or N, A3 is C—X3... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20070123494 - Pyridopyrazine derivatives and their use: The present invention provides new pyridopyrazine compounds which are suitable for the treatment or prevention of physiological and/or pathophysiological states mediated and/or modulated by signal transduction pathways and/or enzymes in mammals and in particular in humans.... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070123495 - Pyrrolo-naphthyl acids and methods for using them: e

20070123496 - Use of aminoguanidine or aminoguanidine analogs for the treatment of diseases of the nervous system: The present invention relates to the use of aminoguanidine compounds for treating diseases of the nervous system. Aminoguanidine compounds can be used as therapeutically effective agents against a variety of diseases of the nervous system such as diabetic and toxic neuropathies, peripheral nervous system diseases, Alzheimer's disease, Parkinson's disease, stroke,... Agent: Lahive & Cockfield, LLP

20070123497 - Crystalline solid forms of tigecycline and methods of preparing same: Crystalline solid forms of tigecycline, Form I, Form II, Form III, Form IV, and Form V, compositions comprising these crystalline solid forms, and processes for preparing these crystalline solid forms are described herein.... Agent: Wyeth/finnegan Henderson, LLP

20070123498 - Combination of organic compounds: The present invention relates to a combination of organic compounds, a pharmaceutical composition and a kit of parts comprising said combination of organic compounds and to a method of treatment or prevention of certain conditions or diseases.... Agent: Novartis Corporate Intellectual Property

20070123499 - Compositions and methods for treatment and prevention of gastrointestinal disorders: The present invention provides compositions and methods for treating and preventing inflammatory bowel disease and other gastrointestinal disorders (e.g., mucositis, radiation induced enteritis, and short bowel syndrome). In particular, the present invention provides methods of treating and preventing symptoms of inflammatory bowel disease and other gastrointestinal disorders using compositions comprising... Agent: Medlen & Carroll, LLP

20070123500 - Prodrugs of erbeta-selective substances, processes for their preparation and pharmaceutical compositions comprising these compounds: e

20070123501 - Glutathione peroxidase mimetics and uses thereof: This invention relates to novel organoselenium and tellurium compounds, processes of producing the same and methods of use thereof. The compounds function as mimetics for the catalyst selenoenzyme glutathione peroxidase, which protects cells from oxidative stress.... Agent: Pearl Cohen Zedek Latzer, LLP

20070123502 - Platinum iv complex inhibitor: The invention disclosed herein provides methods for diagnosing and treating diseases and/or conditions associated with dysregulated Stat3-mediated activity.... Agent: Morrison & Foerster LLP

20070123503 - Cyclic salen-metal compounds: reactive oxygen species scavengers useful as antioxidants in the treatment and prevention of diseases: This invention provides antioxidant cyclic salen-metal compounds, compositions of such antioxidant cyclic salen-metal compounds having superoxide activity, catalase activity and/or peroxidase activity and methods of using such antioxidant cyclic salen-metal compositions to treat or prevent a disease associated with cell or tissue damage produced by free radicals, such as superoxide.... Agent: Bozicevic, Field & Francis LLP

20070123506 - Acid-group-substituted diphenylazetidinones process for their preparation, medicaments comprising these compounds, and their use: in which R1, R2, R3, R4, R5 and R6 have the meanings given in the specification. Other embodiments of the invention relate to physiologically acceptable salts of the compounds of formula I, to processes for their preparation and to medicaments comprising these compounds. The compounds of the invention are suitable... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20070123504 - Diacylglycerol acyltransferase inhibitors:

20070123505 - Heterocycle-substituted 3-alkyl azetidine derivatives: Novel compounds of the structural formula (I) are antagonists and/or inverse agonists of the Cannabinoid-1 (CB1) receptor and are useful in the treatment, prevention and suppression of diseases mediated by the CB1 receptor. The compounds of the present invention are useful as centrally acting drugs in the treatment of psychosis,... Agent: Merck And Co., Inc

20070123507 - Process for converting heterocyclic ketones to amido-substituted heterocycles: The present invention provides a safe and convenient process for preparing compounds of Formula (I) from the corresponding heterocyclic ketone.... Agent: Pfizer Inc.

20070123508 - Par2-modulating compounds and their use: This invention relates to compounds, their uses for the elucidation of PAR2 activity and their uses for the treatment or prevention of diseases or disorders related to PAR2 activity, wherein the compound has the general chemical structure:... Agent: Squire, Sanders & Dempsey L.L.P.

20070123509 - Carboxamide derivatives: Novel compounds of the formula (I) in which D, E, Q, T, X, Y, Z, Z′, R1, R4 and R4′ have the meanings indicated in patent Claim 1, are inhibitors of coagulation factor Xa and can be employed for the prophylaxis and/or therapy of thromboembolic diseases and for the treatment... Agent: Millen, White, Zelano & Branigan, P.C.

20070123510 - Guanidine derivatives: The invention relates to the guanine derivatives of general formula (I), and to hydrates or solvents thereof, for use as neuropeptide FF receptor antagonists in the treatment of pains and hyperalgesia, of withdrawal symptoms of addiction to alcohol, psychotropic drugs or nicotine and in the prevention of or recovery from... Agent: Dickstein Shapiro LLP

20070123511 - Benzopyranone compounds, compositions thereof, and methods for treating or preventing cancer: e

20070123512 - Propionamide derivatives useful as androgen receptor modulators: wherein R1 to R4, X and A are as defined in the claims and pharmaceutically acceptable salts and esters thereof, are disclosed. The compounds of formula (I) possess utility as tissue-selective androgen receptor modulators (SARM) and are useful in hormonal therapy, e.g., in the treatment or prevention of male hypogonadism... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20070123513 - Pyridylsulfonamide derivatives: e

20070123514 - Methods of modulating neurotrophin-mediated activity: Disclosed are compositions which modulate the interaction with nerve growth factor and precursors thereof with neurotrophic receptors. Also disclosed are methods of using the compositions of the invention, including methods of administration.... Agent: Lahive & Cockfield, LLP

20070123515 - 1,5-substituted indol-2-yl amide derivatives: s

20070123516 - Method of treating mucus hypersecretion: The invention relates to the use of p38 kinase inhibitors for the preparation of a pharmaceutical composition suitable for inhalation for the treatment of mucus hypersecretion. Furthermore the invention is directed to pharmaceutical compositions suitable for inhalation comprising p38 kinase inhibitors and to methods for the preparation thereof.... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070123517 - Pharmacological treatment for sleep apnea: The present invention relates generally to pharmacological methods for the prevention of amelioration of sleep-related breathing disorders via administration of agents or combinations of agents that possess serotonin-related pharmacological activity.... Agent: Marshall, Gerstein & Borun LLP

20070123519 - Benzo-1,4-diazepin-2-one derivatives as phosphodiesterase pde2 inhibitors, preparation and therapeutic use thereof: The invention relates to compounds having PDE2 inhibitory activities, as well as therapeutic methods by administering said compounds, in particular for treating various diseases of the central or peripheral nervous system. It further deals with pharmaceutical compositions comprising said compounds and methods for preparing said compounds.... Agent: Nixon & Vanderhye, PC

20070123518 - Product designed to protentiate the therapeutic effects and to enhance the action of medicinal preparations: Said invention is characterised by the application of a small and mini doses of an activated medical substance in the form of an agent for potentiating curing effects, i.e enhancing action of the therapeutic dose of the same medical substance.... Agent: Ilya Zborovsky

20070123520 - Methylene blue therapy of avian influenza: A method for using thiazine dyes, especially methylene blue, alone or in combination with low levels of light, to treat or prevent avian influenza virus is described. Examples of useful thiazine dyes are methylene blue, azure A, azure C, toluidine, and thionine. The preferred dye is methylene blue, administered orally... Agent: Patrea L. Pabst Pabst Patent Group LLP

20070123522 - 5-lipoxygenase-activating protein (flap) inhibitors: Described herein are compounds and pharmaceutical compositions containing such compounds, which modulate the activity of 5-lipoxygenase-activating protein (FLAP). Also described herein are methods of using such FLAP modulators, alone and in combination with other compounds, for treating respiratory, cardiovascular, and other leukotriene-dependent or leukotriene mediated conditions or diseases.... Agent: Wilson Sonsini Goodrich & Rosati

20070123521 - Cinnamoyl derivatives and use thereof: The present invention relates to a cinnamoyl compound represented by the formula (I):... Agent: Wenderoth, Lind & Ponack, L.L.P.

20070123523 - Inhibitors of cathepsin s: The present invention provides compounds, compositions and methods for the selective inhibition of cathepsin S. In a preferred aspect, cathepsin S is selectively inhibited in the presence of at least one other cathepsin isozyme. The present invention also provides methods for treating a disease state in a subject by selectively... Agent: Townsend And Townsend And Crew, LLP

20070123524 - N-substituted hydroxypyrimidinone carboxamide inhibitors of hiv integrase: are described as inhibitors of HIV integrase and inhibitors of HIV replication, wherein R1, R2, R3 and R4 are defined herein. These compounds are useful in the prevention and treatment of infection by HIV and in the prevention, delay in the onset, and treatment of AIDS. The compounds are employed... Agent: Merck And Co., Inc

20070123526 - 1,1-dioxo-thiomorpholinyl indolyl methanone derivatives: e

20070123525 - 5-substituted indole-2-carboxamide derivatives:

20070123527 - 3-amino-1-arylpropyl indoles and aza-substituted indoles and uses thereof:

20070123528 - Indole-amid derivatives which possess glycogen phosphorylase inhibitory activity: and pharmaceutically acceptable salts or pro-drugs thereof wherein variable groups are as described herein; which possess glycogen phosphorylase inhibitory activity and accordingly have value in the treatment of disease states associated with increased glycogen phosphorylase activity are described. Processes for the manufacture of said heterocyclic amide derivatives and pharmaceutical compositions... Agent: Astrazeneca R&d Boston

20070123529 - Substituted biphenyl compounds: d

20070123531 - 4-bromo-5-(2-chloro-benzoylamino)-1h-pyrazole-3-carboxylic acid (phenyl) amide derivatives and related compounds as bradykinin b1 receptor antagonists for the treatment of inflammatory diseases: Disclosed are compounds that are bradykinin B1 receptor antagonists and are useful for treating diseases, or relieving adverse symptoms associated with disease conditions, in mammals mediated by bradykinin B1 receptor. Certain of the compounds exhibit increased potency and are also expected to exhibit increased duration of action.... Agent: Foley & Lardner LLP

20070123530 - Azole methylidene cyanide derivatives and their use as protein kinase modulators: s

20070123532 - Piperazine derivatives:

20070123533 - New process for preparing an optically pure 2-morpholinol derivative: The present invention relates to a process for preparing optically pure (+)-(2S,3S)-2-(3-chlorophenyl)-3,5,5-trimethyl-2-morpholinol and pharmaceutically acceptable salts and solvates from a mixture of (+)-(2S,3S)-2-(3-chlorophenyl)-3,5,5-trimethyl-2-morpholinol and (−)-(2R,3R)-2-(3-chlorophenyl)-3,5,5-trimethyl-2-morpholinol. The process utilizes continuous chromatography, including techniques like Multi Column Chromatography (MCC), VARICOL, and Cyclojet.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475

20070123534 - Pyrrolotriazine kinase inhibitors: e

20070123535 - 3-amino-1-arylpropyl azaindoles and uses thereof:

20070123536 - Treatment of sexual disorders: The present invention relates to a method of treatment of sexual dysfunction e.g. female sexual disfunction by administering to a person in need of treatment an effective amount of gepirone as either a short-term or a long-term therapy.... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070123537 - Quinazoline derivatives for the treatment of herpesviral infections: The present invention relates to phenyl-quinazolinyl-amine derivatives and pharmaceutically acceptable salts thereof and pharmaceutical compositions comprising at least one of these derivatives and/or pharmaceutically salts thereof, as well as the use of these derivatives for the prophylaxis and/or treatment of herpesviral induced infections, including opportunistic infections, especially for the prophylaxis... Agent: Brooks Kushman P.C.

20070123538 - Compositions comprising a combination of ccr5 and cxcr4 antagonists: e

20070123539 - Treatment of restenosis and stenosis with dasatinib: A method for treating or inhibiting artery obstructive disease, such as restenosis after angioplasty and stenting procedures and stenosis after coronary artery bypass surgery, in a subject by administering to the subject a therapeutically effective amount of dasatinib or a derivative thereof Also provided are drug-eluting medical devices, including stents,... Agent: Smith Hopen, Pa

20070123540 - Sexual desire enhancing medicaments comprising benzimidazolone derivatives: The invention relates to the use of benzimidazolone derivatives of formula (I) for the preparation of a medicament for the treatment of sexual desire disorders.... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070123541 - Fungicidal composition comprising a pyridylethylbenzamide derivative and a compound capable of inhibiting the ergosterol biosynthesis: A composition comprising at least a pyridylethylbenzamide derivative of general formula (I) (a) and a compound capable of inhibiting the ergosterol biosynthesis (b) in a (a)/(b) weight ratio of from 0.01 to 20. A composition further comprising an additional fungicidal compound. A method for preventively or curatively combating the phytopathogenic... Agent: Ostrolenk Faber Gerb & Soffen

20070123542 - Substituted [4-(4-phenyl-piperazin-1-yl)-cyclohexyl]-urea compounds: and pharmaceutically acceptable forms thereof, as α1a/α1d adrenoreceptor modulators for the treatment of benign prostatic hypertrophy and lower urinary tract symptoms. The present invention also relates to pharmaceutical compositions comprising said new compounds, new processes to prepare these new compounds and new uses as a medicine as well as methods... Agent: Philip S. Johnson Johnson & Johnson

20070123543 - Novel compounds: The invention provides compounds of formula (I) wherein m, R1, n, R2, q, X, Y, R3, R4, R5, R6, R7 and R8 are as defined in the specification, processes for their preparation, pharmaceutical compositions containing them and their use in therapy.... Agent: Fish & Richardson P.C.

20070123544 - Non-nucleotide compositions and method for treating pain: The present invention is directed to a method of treating pain. The method comprises administering to a subject a pharmaceutical composition comprising an effective amount of a P2X receptor antagonist. The methods of the present invention are useful in reducing pain, such as traumatic pain, neuropathic pain, organ pain and/or... Agent: Howery LLP

20070123545 - Process for the preparation of aminoalcohol derivatives and their further conversion to (1r, 4s)-4(2-amino-6-chloro-5-formamido-4- pyrimidinyl)-amino-2-cyclopentenyl-1-methanol: e

20070123546 - 2-amino-7,8-dihydro-6h-pyrido[4,3-d]pyrimidin-5-ones: Disclosed are 2-amino-7,8-dihydro-6H-pyrido[4,3-d]pyrimidin-5-one compounds, their stereoisomers, tautomers, pharmaceutically acceptable salts, and prodrugs thereof; compositions that include a pharmaceutically acceptable carrier and one or more of the 2-amino-7,8-dihydro-6H-pyrido[4,3-d]pyrimidin-5-one compounds, either alone or in combination with at least one additional therapeutic agent. Disclosed also are methods of using the 2-amino-7,8-dihydro-6H-pyrido[4,3-d]pyrimidin-5-one compounds, either... Agent: Novartis Vaccines And Diagnostics Inc.

20070123547 - [4-(6-halo-7-substituted-2,4-dioxo-1,4-dihydro-2h-quinazolin-3-yl)-phenyl]-5-chloro-thiophen-2-yl-sulfonylureas and forms and methods related thereto: The present invention provides novel sulfonylurea compounds of formula (I) and pharmaceutically acceptable derivatives and polymorph and amorphous forms thereof. The compounds in their various forms are effective platelet ADP receptor inhibitors and may be used in various pharmaceutical compositions, and are particularly effective for the prevention and/or treatment of... Agent: Townsend And Townsend And Crew, LLP

20070123548 - Pth agonists: R6 is hydrogen, alkyl, aryl, alkylaryl, heterocycloalkyl, or heteroaryl and is unsubstituted or substituted by one or more groups selected from the group consisting of alkyl, C1-8alkoxy, aryl, heteroaryl, halogen, NO2, CN, N3, SCF3, and CF3, or when R1 and/or R2 contains S(O)2NR5R6, CONR5R6, or C(S)NR5R6, then R5R6 together with... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20070123549 - Pyrimidine compounds:

20070123550 - Crystalline rosuvastatin intermediate: Provided is a crystalline rosuvastatin intermediate and processes for preparation thereof.... Agent: Kenyon & Kenyon LLP

20070123551 - Use of metabotropic glutamarate receptor 5 (mglur5) antagonists for the treatment of gastrointestinal disorders: The present invention relates to the use of metabotropic glutamate receptor 5 (mGluR5) antagonists for the treatment of functional gastrointestinal disorders, such as functional dyspepsia.... Agent: White & Case LLP Patent Department

20070123552 - Method of manufacturing of 7-ethyl-10-hydroxycamptotecin: The method of manufacturing of 7-ethyl-10-hydroxycamptothecin of formula I characterized in that 7-ethyl-1,2,6,7-tetrahydrocampotothecin of formula IV is oxidized with an oxidizing agent selected from the group coprising iodosobenzene, an ester of iodosobenzene, sodium periodate, potassium periodate, potassium peroxodisulfate and ammonium peroxodisulfate, in a solvent formed by a saturated aliphatic monocarboxylic... Agent: Notaro And Michalos

20070123553 - Aryl imidazoles and their use as anti-cancer agents: Therapeutically effective 2,4,5-trisubstituted imidazole compounds are provided. Also provided are methods -of preparing the compounds and pharmaceutical compositions comprising the compounds alone or in combination with other agents. The present invention further provides for the use of the compounds as anti-cancer agents; wherein: R1 is aryl, substituted aryl, heterocycle, substituted... Agent: Needle & Rosenberg, P.C.

20070123555 - Prevention and treatment of hearing disorders: Compositions, and methods of use thereof, are provided for the prevention, treatment or alleviation of symptoms of hearing are provided. The methods employ nicergoline, MMDL or MDL as the sole active pharmaceutical agent or a combination of nicergoline, MMDL or MDL and another pharmaceutical agent, such as an antioxidant, a... Agent: Wilson Sonsini Goodrich & Rosati

20070123554 - Pyrazoloacrydone derivative-containing solution: m

20070123556 - Treatment with sigma receptor agonists post-stroke: A method of post-stroke treatment at delayed timepoints with sigma receptor agonists. Sigma receptors are promising targets for neuroprotection following ischemia. One of the key components in the demise of neurons following ischemic injury is the disruption of intracellular calcium homeostasis. The sigma receptor agonist, DTG, was shown to depress... Agent: Smith Hopen, Pa

20070123557 - Soft anticholinergic esters: wherein R1 and R2 are both phenyl or one of R1 and R2 is phenyl and the other is cyclopentyl; R is C1-C8 alkyl, straight or branched chain; and X− is an anion with a single negative charge; and wherein each asterisk marks a chiral center; said compound having the... Agent: Buchanan, Ingersoll & Rooney PC

20070123558 - Immune response modifier formulations containing oleic acid and methods: Pharmaceutical formulations and methods including an immune response modifier (IRM) compound and an oleic acid component are provided where stability is improved by using oleic acid have low polar impurities such as peroxides.... Agent: 3m Innovative Properties Company

20070123559 - Packaging for 1-(2-methylpropyl)-1h-imidazo[4,5-c] quinolin-4-amine-containing formulation: A packaged composition of 1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-4-amine dissolved in a fatty acid formulation and contained in a laminated packaging material having a contact layer that includes an acrylonitrile-methyl acrylate copolymer; an outer layer; and a moisture barrier layer disposed between the contact layer and outer layer.... Agent: Edwards Angell Palmer & Dodge LLP

20070123560 - Dehalogeno-compounds: 3-(1-Aminocycloalkyl)pyrrolidinyl-substituted-6-dehalodeno(hydrogen-substituted)quinolon carboxylic acid derivatives having specific substituents as represented by the following formula (I), its salts, and hydrates thereof exhibit a broad and potent antibacterial activity on gram-negative and gram-positive bacteria, in particular, resistant bacteria typified by gram-positive cocci, including MRSA, PRSP and VRE. Thus these compounds are usable as... Agent: Sughrue Mion, PLLC

20070123562 - Compositions and methods for treating middle-of-the-night insomnia: The present invention provides compositions and methods for treating middle-of-the-night insomnia without residual sedative effects upon awakening by administering low doses (about 5 mg or less) of zolpidem or a salt thereof.... Agent: Townsend And Townsend And Crew, LLP

20070123561 - Preparation of 1,7-disubstituted azabensimidazoles as kinase inhibitors: Novel inhibitors of Rho-kinases are disclosed.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20070123563 - Selective androgen receptor modulators and method of use thereof: This invention provides SARM compounds and uses thereof in treating a variety of diseases or conditions in a subject, including, inter-alia, a muscle wasting disease and/or disorder or a bone-related disease and/or disorder.... Agent: Pearl Cohen Zedek, LLP Pearl Cohen Zedek Latzer, LLP

20070123564 - Method for preparing phenyl acetic acid derivatives: i

20070123565 - Donepezil hydrochloride form vi: The present invention discloses a novel, stable polymorph of 1-benzyl-4-[(5,6-dimethoxy-1-indanone)-2-yl] methyl piperidine hydrochloride commonly known as Donepezil hydrochloride. Further the present invention discloses a process for producing Donepezil HCl amorphous and its polymorph Form (VI).... Agent: Pharmaceutical Patent Attorneys, LLC

20070123566 - Isoflavone derivatives of tectoridin, the preparation thereof and the anti-virus medicines containing the same as an effective constituents: e

20070123567 - Prophylactic pretreatment with antioxidants: Methods, compositions, and uses for pre-treating patients who are susceptible to ischemia, including stroke, with nitroxides, in order to prevent or ameliorate the effects of stroke or other ischemic disease.... Agent: Knobbe Martens Olson & Bear LLP

20070123568 - Therapeutic methods using prostaglandin ep4 agonist components: Methods are provides directed to administering a therapeutically effective amount of a prostaglandin EP4 agonist component to a mammal afflicted with or prone to affliction with a disease or condition selected from an esophageal ulcer, alcohol gastropathy, a duodenal ulcer, non-steroidal anti-inflammatory drug-induced gastroentroeropathy and intestinal ischemia. Such administration results... Agent: Allergan, Inc.

20070123569 - Therapeutic methods using prostaglandin ep4 agonist components: Methods are provided directed to adminstering a therapeutically effective amount of a prostaglandin EP4 agonist component to a mammal afflicted with or prone to affliction with a disease or condition selected from an esophageal ulcer, alcohol gastrophathy, a duodenal ulcer, non-steroidal anti-inflammatory drug-induced gastropathy, non-steroidal anti-inflammatory drug-induced enteropathy and intestinal... Agent: Allergan, Inc.

20070123570 - Phosphodiesterase 4 inhibitors, including aminoindazole and aminobenzofuran analogs: t

20070123571 - Use of a compound in the treatment of sleep disorders: There is disclosed the use of triprolidine, in combination with at least one further active pharmaceutical agent, for enabling an individual to wake refreshed after sleep and the method of treating such an individual with triprolidine. Use of triprolidine, in combination with at least one further active pharmaceutical agent, as... Agent: Nixon & Vanderhye, PC

20070123572 - Novel method of preparation of 5-chloro-3-imidazol-1-yl-[1,2,4]thiadiazole and (3-imidazol-1-yl-[1,2,4]thiadiazol-5yl)-dialkyl-amines: The present invention discloses a novel method for preparing 3-imidazol-1-yl-[1,2,4]thiadiazole derivatives, particularly to a method of preparing 5-halo-3-imidazol-1-yl-[1,2,4]thiadiazole, more particularly (3 -imidazol-1-yl-[1,2,4]thiadiazol-5-yl)-dialkyl-amines, that afford a high yield of pure product.... Agent: International Patent Group Attn: Ms Lavern Hall

20070123573 - Process for the preparation of biologically active tetrahydrobenzthiazole derivative: The process comprises reacting 4-amino cyclohexanol of formula (III) or its acid addition salts with phthalic anhydride in presence of acid catalyst and their salts, in polar aprotic solvent or its mixture with organic solvent, capable of removing water azeotropically to give 4-(phthalimido)-cyclohexanol of formula (IV); oxidizing 4-(phthalimido)-cyclohexanol of formula... Agent: Hamre, Schumann, Mueller & Larson, P.C.

20070123574 - Methods for the preparation of benzoxazole sulfonamide compounds and intermediates thereof: The present invention relates to methods for the preparation of benzoxazole sulfonamide compounds as well as novel intermediates for use in said method. More in particular the invention relates to methods for the preparation of 2-amino-benzoxazole sulfonamide compounds which make use of 2-mercapto-benzoxazole sulfonamide intermediates, more in particular methods employing... Agent: Philip S. Johnson Johnson & Johnson

20070123575 - Ep4 receptor antagonists: e

20070123576 - Compounds inducing differentiation of myoblasts or muscle fibers into neuron cells, pharmaceutical composition including said compounds, a method for inducing neuron differentiation and a screening method for identifying additional compounds useful for in: The present invention relates to compounds inducing differentiation of myoblasts or muscle fibers into neuron cells, pharmaceutical composition including said compounds, a method for inducing neuron differentiation and a screening method for identifying additional compounds useful for inducing neuron differentiation. More specifically, it relates to compounds that induce neuron differentiation... Agent: Cantor Colburn, LLP

20070123577 - Inhibitor of protein modification products formation: [PROBLEMS] To provide a inhibitor of protein modification products formation capable of inhibiting of vitamin B6 deficiency disease as a side effect, especially a renal protective agent. [MEANS FOR SOLVING PROBLEMS] There is provided a use, as an active ingredient, of any of free or salt-form compounds of either of... Agent: Wenderoth, Lind & Ponack, L.L.P.

20070123578 - Hexahydro-cycloheptapyrazole cannabinoid modulators: R

20070123579 - Process for preparing a dipeptidyl peptidase iv inhibitor and intermediates employed therein:

20070123580 - Combination of histone deacetylase inhibitors with chemotherapeutic agents: The invention relates to a combination which comprises (a) one or more chemotherapeutic agents and (b) a histone deacetylase inhibitor (“HDAI”) for simultaneous, concurrent, separate or sequential use, especially for use in the treatment of proliferative diseases including pre-malignant lesions (e.g. colon polyps) and malignancies, both solid and undifferentiated or... Agent: Novartis Corporate Intellectual Property

20070123581 - Process for the synthesis of (2s, 3as, 7as)-1-[(s)-alanyl]-octahydro-1h-indole-2-carboxylic acid compounds and application in the synthesis of perindopril: e

20070123582 - Crystalline form of a drug: Atrasentan Hydrochloride Crystalline Form 3, compositions containing it and methods of treatment of diseases and inhibition of adverse physiological events using it are disclosed.... Agent: Robert Deberardine Abbott Laboratories

20070123583 - Method for treating atherosclerosis or restenosis using microtubule stabilizing agent: The present invention is a method of preventing or reducing atherosclerosis or restenosis, and a pharmaceutical preparation used therefor. In particular, it is a method of preventing or reducing atherosclerosis or resenosis after arterial injury by treatment with a low dose of a microtubule stabilizing agent such as taxol or... Agent: Klarquist Sparkman, LLP

20070123584 - Method of treating premenstrual dysphoric disorder with escitalopram: The present invention relates to a method of treating the symptoms of premenstrual dysphoric disorder (PMDD) in a patient in need thereof by administering an effective amount of escitalopram or a pharmaceutically acceptable salt thereof.... Agent: Darby & Darby P.C.

20070123585 - Nitroglycerin therapy for those unable to metabolize nitroglycerin: Those in need of nitroglycerin (GTN) therapy who have polymorphism in the mtALDH gene, e.g., those of Asian descent for whom this polymorphism is common, and/or who are being treated with or ingesting or exposed to mtALDH inhibitor are treated with GTN in combination with agent which converts GTN to... Agent: Bacon & Thomas, PLLC

20070123586 - Nitroso derivatives of diphenylamine: o

20070123587 - Prodrugs of diaryl-2-(5h)-furanone cyclooxygenase-2 inhibitors: The invention encompasses the novel compounds of Formula (I) and Formula (II), which are prodrugs that convert in vivo to diaryl-2-(5H)-furanones useful in the treatment of cyclooxygenase-2 mediated diseases. These prodrugs are far more soluble in aqueous media than the active agents into which they convert, in vivo. As such... Agent: Merck And Co., Inc

20070123588 - Five and fifteen carbon fatty acids for treating metabolic disorders and as nutritional supplements: According to the present invention, acquired metabolic derangements or fatty acid disorders in humans that are manifested by a deficiency in at least one enzyme involved in fatty acid metabolism are treated with a five carbon or a fifteen carbon fatty acid source. Rapid nutritional supplementation can also be provided... Agent: Chalker Flores, LLP

20070123591 - Gabapentin analogues and process thereof: The present invention relates to compounds trans (E) and cis (Z) stereoisomers of 4-t-butyl gabapentin of formula (11) and (12) and a process for the preparation of the said stereoisomers.... Agent: Foley And Lardner LLP Suite 500

20070123589 - Method for producing chiral or enantiomer-enriched beta-amino acids, aldehydes, ketones and gama-amino alcohols: The invention relates to an improved method for producing chiral or enantiomer-enriched beta amino acids, -aldehydes, -ketones and gamma-amino alcohols, during which an allyl amine of formula (I), in which: R1 represents an alkyl radical, a cycloalkyl radical, an alkyl radical, a heterocycle radical or a condensed or bridged ring... Agent: Nixon & Vanderhye, PC

20070123590 - Process for the purification of gabapentin: A process for the preparation of gabapentin comprising the passage of a salt of the same through a ionic exchange resin of strong cationic type, the elution of the gabapentin which has fixed onto the column and the crystallization from organic solvent, characterized in that the resin is regenerated by... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070123592 - Terephthalamide peptidomimetic compounds and methods: The present invention relates to compounds and pharmaceutical compositions based upon terephthalamide which are proteomimetic and to methods for inhibiting the interaction of an alpha-helical protein with another protein or binding site. Methods for treating diseases or conditions which are modulated through interactions between alpha helical proteins and their binding... Agent: Coleman Sudol Sapone, P.C.

20070123593 - Pharmaceutical composition comprising 5-methyl-2(2'-chloro-6'-fluoroanilino)phenylacetic acid: The invention relates to a composition for the treatment of a cyclooxygenase-2-mediated disorder or condition comprising 5-methyl-2-(2′-chloro-6′-fluoroanilino)phenylacetic acid or a pharmaceutically acceptable salt, preferably the potassium salt, thereof suitable for parenteral administration, and to a method for the treatment of a cyclooxygenase-2-mediated disorder or condition in a human or animal... Agent: Novartis Corporate Intellectual Property

20070117741 - Defensin-inducing agents and related methods: This application provides, in part, novel polypeptides and nucleic acids that affect induction of defensins, and methods of making and using same.... Agent: Hahn Loeser & Parks, LLP

20070117742 - Methods and means for producing proteins with predetermined post-translational modifications: Described are methods for identifying, selecting, and obtaining mammalian cells capable of producing proteinaceous molecules having predetermined post-translational modifications, wherein the post-translational modifications are brought about by the mammalian cell in which the proteinaceous molecule is expressed. Preferably, the predetermined post-translational modifications include glycosylation. Also described are methods for obtaining... Agent: Trask Britt

20070117743 - New antitumoral compounds: New analogues of kahalalide F are provided.... Agent: King & Spalding

20070117744 - Compositions comprising poorly water soluble pharmaceutical agents and antimicrobial agents: The present invention provides compositions comprising a poorly water soluble pharmaceutical agent, a carrier protein, and an antimicrobial agent, wherein significant microbial growth is inhibited in the composition. The amount of the antimicrobial agent in the composition may be below the level that induces a toxicological effect or at a... Agent: Morrison & Foerster LLP

20070117745 - Cardio myopeptidin, the production and the use thereof: The present invention relates to a cardio myopeptidin which is isolated from the hearts of non-human healthy mammals. The molecular weight of the cardio myopeptidin is less than 10000 Dalton, the peptide content thereof being 75%˜90%, the free amino acid content 6%˜15%, the ribonucleic acid content less than 2%, and... Agent: Wallenstein & Wagner, Ltd.

20070117751 - Compositions and methods for diagnosing and treating cancer: The present invention relates to compositions and methods for characterizing, diagnosing, and treating cancer. In particular the invention provides the means and methods for the diagnosis, characterization, prognosis and treatment of cancer and specifically targeting cancer stem cells. The present invention provides a soluble FZD receptor comprising an extracellular domain... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070117753 - Conversion of apoptotic proteins: Compounds that modulate the function of anti-apoptotic proteins such as Bcl-2 and Bcl-XL are identified. These compounds have the ability to convert the activity of Bcl-2-family member proteins from anti-apoptotic to pro-apoptotic. Methods for inducing apoptosis are described, together with methods for identifying molecules that induce apoptosis through interaction with... Agent: Knobbe Martens Olson & Bear LLP

20070117757 - Copolymer-1 improvements in compositions of copolymers: The present invention relates to an improved composition of copolymer-1 comprising copolymer-1 substantially free of species having a molecular weight of over 40 kilodaltons.... Agent: Kenyon & Kenyon LLP

20070117756 - Fvii or fviia gla domain variants: Gla domain variants of human Factor VII or human Factor VIIa, comprising 1-15 amino acid modifications relative to human Factor VII or human Factor VIIa, wherein a hydrophobic amino acid residue has been introduced by substitution in position 34; or having an amino acid substitution in position 36; and use... Agent: Maxygen, Inc. Intellectual Property Department

20070117752 - Glucagon-like-peptide-2 (glp-2) analogues: GLP-2 analogues are disclosed which comprise one of more substitutions as compared to [hGly2]GLP-2 and which improved biological activity in vivo and/or improved chemical stability, e.g., as assessed in in vitro stability assays. More particularly, preferred GLP-2 analogues disclosed herein comprise substitutions at one or more of positions 8, 16,... Agent: Clark & Elbing LLP

20070117750 - Method for enhanced ocular drug penetration: Provided is a method for enhanced intraocular drug penetration that comprises the co-administration of ocular therapeutics with agents that increases the permeability of ocular and periocular vessels and ocular epithelial barriers. Due to its unique and novel concept and additive nature, the method of the present invention can be used... Agent: Edward Langer C/o Shiboleth

20070117755 - Methods for blocking tnf-alpha activity in mammals with trimeric soluble tnf receptors: This invention relates to a general methodology for efficient creation of trimeric soluble receptors for therapeutic applications. The process involves gene fusion between a soluble receptor with a ligand binding domain and a trimerization tag from the C-propeptide domain of pro-collagen, which is capable of self-assembly into a covalently linked... Agent: Lambert & Associates, P.l.l.c.

20070117754 - Nectin polypeptides, polynucleotides, methods of making and use thereof: This invention relates to nectin polypeptides and polynucleotides, to methods of making such polypeptides and polynucleotides, and to methods of using such polypeptides and polynucleotides to modulate cell adhesion, cell migration, and angiogenesis, to treat conditions related to cell adhesion including endothelial and epithelial cell proliferation, migration, and barrier function,... Agent: Immunex Corporation Law Department

20070117748 - Novel apoptosis-modulating proteins, dna encoding the proteins and methods of use thereof: The present invention provides a novel family of apoptosis-modulating proteins. Nucleotide and amino acid residue sequences and methods of use thereof are also provided.... Agent: Sheridan Ross PC

20070117749 - Production of mersacidin and its variants in sigh and/or mrsa negative bacillus host cells: The present invention relates to methods and products for improved production of the lantibiotic mersacidin. There is provided a method of producing a mersacidin variant which comprises introducing into a cell which is a ΔMrsA host cell an expression vector encoding said variant, and recovering said variant from the cell... Agent: Nixon & Vanderhye, PC

20070117747 - Treating disorders of the nervous system: A polypeptide may include an amino acid sequence having at least about 95% identity to the amino acid sequence of SEQ ID NO: 42, wherein a residue at position 94 of the polypeptide is an amino acid other than threonine or wherein a residue at position 82 of the polypeptide... Agent: Foley Hoag, LLP Patent Group, World Trade Center West

20070117746 - Treatment of viral infections: The present invention concerns polypeptides derived from a tandem repeat of apoE141-149 and their uses as medicaments. The peptides may comprise the tandem repeat, and truncations thereof, for which at least one Leucine (L) is replaced by an amino acid with a side chain comprising at least 4 carbon atoms... Agent: Davis Wright Tremaine LLP

20070117758 - Therapeutic agents and methods of use thereof for the modulation of angiogenesis: The present invention provides angiogenesis inhibitor compounds comprising a MetAP-2 inhibitory core coupled to a peptide, as well as pharmaceutical compositions comprising the angiogenesis inhibitor compounds and a pharmaceutically acceptable carrier. The present invention also provides methods of treating an angiogenic disease, e.g., cancer, in a subject by administering to... Agent: Lahive & Cockfield, LLP

20070117759 - Blister pack and solid dosage form therefor: The present invention relates to a blister pack for pharmaceutical use comprising blisters containing a solid dosage form of desmopressin, or a pharmaceutically acceptable salt thereof, and to say solid dosage form. In one embodiment it specifically relates to a blister pack for pharmaceutical use comprising blisters containing a solid... Agent: Foley And Lardner LLP Suite 500

20070117760 - Dna minor groove binding compounds: There is provided an oligopeptide compound comprising: (a) at least one nitrogen-containing basic group attached to at least one end of the oligopeptide; and (b) two or more heterocyclic monomers, at least one of which is substituted in the heterocyclic part by a branched, cyclic or part cyclic C3-5 alkyl... Agent: Fish & Richardson PC

20070117761 - Novel ligand activators of the rar receptors and pharmaceutical/cosmetic applications thereof: e

20070117762 - Use of an alkanoyl l-carnitine for the treatment of the erectile dysfunction: Erectile dysfunction is treated with a combination of propionyl L-carnitine in combination with sildenafil, apomorphine prostaglandin E1, pentolamine and papaverine.... Agent: Nixon & Vanderhye, PC

20070117763 - Compositions and methods for treatment and prevention of metabolic syndrome and its associated conditions with combinations of flavonoids, liminoids and tocotrienols: The present invention is directed to compositions and methods for the treatment and/or prevention of metabolic syndrome and its associated conditions, such as insulin resistance, which involve using a combination composition of limonoids, flavonoids and tocotrienols.... Agent: Davidson, Davidson & Kappel, LLC

20070117764 - Compositions comprising macrolide t-cell immunomodulators or immunosuppressants in combination with antibacterials: Highly compatible or synergistic combinations of a macrolide T-cell immunomodulator or immunosuppressant such as 33-epichloro-33-desoxyascomycin and an antibacterial such as sulfasalazin, ciprofloxacin, ofloxacin, erythromycin or gentamycin, optionally with a further pharmaceutically active agent, especially a retinoid, are provided, which are useful in particular in the treatment of diseases involving bacterial... Agent: Novartis Corporate Intellectual Property

20070117765 - Nicotinoyl riboside compositions and methods of use: The invention relates to compositions of nicotinoyl ribosides and nicotinamide riboside derivatives and their methods of use. In some embodiments, the invention relates to methods of making nicotinoyl ribosides. In some embodiments, the invention relates to pharmaceutical compositions and nutritional supplements containing a nicotinoyl riboside. In further embodiments, the invention... Agent: Medlen & Carroll, LLP

20070117768 - Anti-apoptotically active apatamers: The invention relates to anti-apoptotically active apatamers. The invention describes possible therapeutic and diagnostic applications for, among other things, treating arteriosclerosis, promoting the healing of wounds, treating AIDS, cancer, Alzheimer's disease, systemic lupus erythematosus as well a rheumatoid arthritis and other chronic inflammatory diseases.... Agent: Marshall, Gerstein & Borun LLP

20070117770 - Human ribosomal dna (rdna) and ribosomal rna (rrna) nucleic acids and uses thereof: Provided herein are isolated nucleic acids that comprise a human rRNA or rDNA subsequence and related compositions and methods of use.... Agent: Morrison & Foerster LLP

20070117772 - Methods for slowing familial als disease progression: Methods for slowing disease progression in an individual suffering from familial ALS are provided. Also provided are methods of increasing the survival time of an individual suffering from familial ALS. These methods employ antisense oligonucleotides targeted to SOD1, for use in inhibiting the expression of SOD1 in the central nervous... Agent: Knobbe, Martens, Olson & Bear, LLP

20070117769 - Methods of modulating cell cycle and cell signaling pathways using biliverdin reductase: The present invention relates to a method of modifying expression of cell cycle or cell signaling proteins. This method involves modifying the nuclear or cellular concentration of biliverdin reductase, or fragments or variants thereof, in a cell, whereby a change in the nuclear or cellular concentration of biliverdin reductase, or... Agent: Nixon Peabody LLP - Patent Group

20070117767 - Sirna molecules and method of suppressing gene expression with the use of the same: The present invention relates to a double-stranded RNA molecule improved to control the gene expression suppressing effect of an siRNA. The double-stranded RNA molecule of the present invention is designed such that, in a double-stranded RNA molecule capable of suppressing the expression of a target gene in a cell by... Agent: Ladas & Parry

20070117774 - Somatic transgene immunization and related methods: The invention provides a method for stimulating an immune response by administering to a lymphoid tissue a nucleic acid molecule comprising an expression element operationally linked to a nucleic acid sequence encoding one or more heterologous epitopes. The heterologous epitope can be inserted into a complementarity-determining region of an immunoglobulin... Agent: Needle & Rosenberg, P.C.

20070117773 - Telomerase-inhibiting ena oligonucleotide: A telomerase-inhibiting ENA oligonucleotide compound represented by a formula: E1-B1-B2-B3-B4-E2 (I), wherein E1 represents a group represented by the formula R1-; E2 represents a group represented by the formula -B7-R2; B4, B5, and B8 are identical or different, and each represents Tp; B1, B2, B3, and B12 are identical or... Agent: Frishauf, Holtz, Goodman & Chick, PC

20070117771 - Vglut-specific dsrna compounds: VGLUT-specific dsRNAs capable of triggering the phenomenon of RNA interference, host cells containing theses dsRNAs, and pharmaceutical compositions containing these dsRNAs, in particular for the treatment of pain and other diseases associated with VGLUT family members.... Agent: Crowell & Moring LLP Intellectual Property Group

20070117766 - Vigilant cells: The invention concerns a system for modulating tissue physiology, for example, to prevent or reverse tissue damage caused by disease. The system utilizes vigilant cells that include stable vectors containing a gene switch/biosensor and a gene amplification system. The vectors allow expression of a transgene (such as a cardioprotective gene)... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20070117775 - Compositions and methods for treating inflammatory disorders: The present disclosure relates to methods of treating inflammatory disorders by administering a Syk inhibitory 2,4-pyrimidinediamine compound and an anti-inflammatory agent.... Agent: Dechert LLP

20070117776 - Low dose therapy of dna methylation inhibitors: Methods are provided for treating patients with hematological disorders such as acute myeloid leukemia (AML), chronic myelogenous leukemia (CML), and the myelodysplastic syndromes (MDS). By administering a DNA methylation inhibitor to the patients following unique dosing regimens, the diseases can be efficaciously treated with reduced toxic side effects.... Agent: Wilson Sonsini Goodrich & Rosati

20070117778 - Beta glycolipids as immuno-modulators: The present invention relates to a process for the modulation of the Th1/Th2 cell balance toward anti-inflammatory cytokine producing cells, in a subject suffering from an immune related disorder. The process of the invention comprises the step of increasing the intracellular, extra-cellular or serum level of a naturally occurring β-glycolipid... Agent: Fleit Kain Gibbons Gutman Bongini & Bianco

20070117777 - Composition containing beta-glucan for prevention and treatment of osteoporosis: The present invention relates to a composition containing beta-glucan as an effective ingredient for prevention and treatment of osteoporosis. The above captioned beta-glucan is preferably the beta-1.3/1.6 glucan having a lactic acid as a substituent and this beta-1.3/1.6 glucan is preferably produced from Auerobasidium pullulans SM2001(KCCM 10307).... Agent: Mathews, Shepherd, Mckay, & Bruneau, P.A.

20070117779 - Use of lipid conjugates in the treatment of disease: The invention relates to methods of use for compounds in treating, reducing the incidence, reducing the severity or pathogenesis of an intestinal disease or condition in a subject, including, inter alia, inflammatory bowel disease, Crohn's disease, ulcerative colitis, or a combination thereof.... Agent: Pearl Cohen Zedek Latzer, LLP

20070117780 - Process to prepare eplerenone: e

20070117781 - Pharmaceutical formulation with improved stability: An oral formulation which includes an intragranular phase comprising a bisphosphonic acid derivative and at least one carbohydrate alcohol, together with an aqueous binder. A process of preparing the same and a therapeutic method employing such a formulation in the treatment of various skeletal diseases, such as systemic bone diseases... Agent: Conley Rose, P.C.

20070117782 - Inhibitors of epoxide hydrolases for the treatment of inflammation: wherein Z is oxygen or sulfur, W is carbon phosphorous or sulfur, X and Y is each independently nitrogen, oxygen, or sulfur, and X can further be carbon, at least one of R1-R4 is hydrogen, R2 is hydrogen when X is nitrogen but is not present when X is sulfur... Agent: Townsend And Townsend And Crew, LLP

20070117783 - Aqueous suspensions of ciclesonide for nebulisation: This invention relates to a method for the preparation of sterile aqueous suspensions of ciclesonide by sterilization with moist heat. The invention further relates to pharmaceutical compositions in particular to sterile aqueous suspensions of ciclesonide for administration by nebulization in the prophylaxis and/or treatment of respiratory diseases.... Agent: Nath & Associates PLLC

20070117784 - Treatment of hyperproliferative diseases with anthraquinones: The invention relates to anthraquinone compounds having activity for treating hyperproliferative disorders. Further, the invention relates to methods of using the compounds, alone or in combination with one or more other active agents or treatments, to treat hyperproliferative disorders.... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070117785 - Substituted pyrazoles and methods of treatment with substituted pyrazoles: Substituted pyrazoles, methods of manufacturing them, compositions containing them, and methods of using them to treat, for example, autoimmune diseases or allergic conditions, including atopic allergic conditions, mediated by cathepsin S are described.... Agent: Philip S. Johnson Johnson & Johnson

20070117786 - Intermediates for the preparation of tricyclic dihydropyrano-imidazo-pyridines derivatives: b

20070117787 - Benzoxazepine compounds, their production and use: [wherein R stands for a lower alkyl group optionally substituted with a hydroxyl group, X stands for an optionally substituted carbamoyl group or an optionally substituted heterocyclic group having a deprotonatable hydrogen atom, R1 stands for a lower alkyl group and W stands for a halogen atom] having activities of... Agent: Edwards & Angell, LLP

20070117788 - Combination of a dopamine d2-receptor agonist and tiotropium or a derivative therof for treating obstructive airways and other inflammatory diseases: The present invention relates to a combination of therapeutic agents useful in the treatment of obstructive airways and other inflammatory diseases comprising (I) a dopamine D2-receptor agonist that is therapeutically effective in the treatment of said diseases when administered by inhalation; together with (II) an anti-cholinergic agent consisting of a... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070117789 - Method of treatment: e

20070117790 - Nonpeptide substituted spirobenzoazepines as vasopressin antagonists: wherein A, X, n, R1, R2, R3, R4, R5, a and b are as described in the specification, which are useful as vasopressin receptor antagonists for treating conditions associated with vasopressin receptor activity such as those involving increased vascular resistance and cardiac insufficiency. Pharmaceutical compositions comprising a compound of Formula... Agent: Philip S. Johnson Johnson & Johnson

20070117791 - Bicyclic compounds: wherein R1, R2, R3, R4 and R5, X, X′, Y and Y′ are as defined in the description and claims, processes for their preparation, pharmaceutical compositions containing said derivatives and their use for the preparation of medicaments useful for the prevention and treatment of diseases in which selective inhibition of... Agent: Hoffmann-la Roche Inc. Patent Law Department

20070117792 - Pharmaceutical compositions for suppressing b-amyloid production: To provide pharmaceutical compositions for suppressing β-amyloid production on the basis of the cyclin-dependent kinase inhibitory activity. When a substance having a cyclin-dependent kinase inhibitory activity was allowed to contact with nerve cells, the β-amyloid production was suppressed.... Agent: Sughrue-265550

20070117793 - Compounds which inhibit beta-secretase activity and methods of use: The present invention provides novel beta-secretase inhibitors and methods for their use, including methods of treating Alzheimer's disease.... Agent: Townsend And Townsend And Crew, LLP

20070117794 - Methods of treatment using oxytocin receptor agonists: Methods for treating and preventing anxiety, anxiety-related disorders, schizophrenia and schizophrenia-related disorders are described herein wherein said methods comprise the administration of oxytocin receptor agonists.... Agent: Wyeth Patent Law Group

20070117795 - Methods and compositions of novel triazine compounds: The present invention relates to methods and compositions comprising compounds that treat pathophysiological conditions arising from inflammatory responses. In particular, the present invention is directed to compounds that inhibit or block glycated protein produced induction of the signaling-associated inflammatory response in endothelial cells. The present invention relates to compounds that... Agent: Dr. Reddy's Laboratories, Inc.

20070117796 - Carbamate compounds as 5-ht4 receptor agonists: e

20070117797 - Alkylamino, arylamino, and sulfonamido cyclopentyl amide modulators of chemokine receptor activity: Compounds of the formula (I) which are modulators of chemokine receptor activity useful in the prevention or treatment of certain inflammatory and immunoregulatory disorders and diseases, allergic diseases, atopic conditions including allergic rhinitis, dermatitis, conjunctivitis, and asthma, as well as autoimmune pathologies such as rheumatoid arthritis and atherosclerosis, and pharmaceutical... Agent: Merck And Co., Inc

20070117798 - Morpholine type cinnamide compound: or a pharmacologically acceptable salt thereof, wherein R1, R2, R3, and R4 are the same or different and each represent a hydrogen atom or a C1-6 alkyl group; X1 represents a C1-6 alkylene group that may be substituted; Xa represents a methoxy group or a fluorine atom; Xb represents an... Agent: Birch Stewart Kolasch & Birch

20070117799 - Oxabispidine compounds useful in the treatment of cardiac arrhythmias:

20070117800 - Pyrimidinyl-thiophene kinase modulators: The present invention provides novel pyrimidinyl-thiophene kinase modulators and methods of using the novel pyrimidinyl-thiophene kinase modulators to treat diseases mediated by kinase activity.... Agent: Townsend And Townsend And Crew, LLP

20070117801 - Indane derivatives as modulator of ion channels: The present invention relates to indane derivatives useful as inhibitors of ion channels. The invention also provides pharmaceutically acceptable compositions comprising the compounds of the invention and methods of using the compositions in the treatment of various disorders.... Agent: Vertex Pharmaceuticals Inc.

20070117802 - Met kinase inhibitors: The invention is directed to compounds that are useful for the treatment of cancer having the following Formula:... Agent: Louis J. Wille Bristol-myers Squibb Company

20070117803 - Cyclohexyl-1,4-diamine compounds: e

20070117804 - Imidazopyrazines as protein kinase inhibitors: In its many embodiments, the present invention provides a novel class of imidazopyrazine compounds as inhibitors of protein and/or checkpoint kinases, methods of preparing such compounds, pharmaceutical compositions including one or more such compounds, methods of preparing pharmaceutical formulations including one or more such compounds, and methods of treatment, prevention,... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20070117807 - Anthranilamides and methods of their use: in which R(1) to R(7) have the meanings indicated herein, a process for their preparation, their use as medicaments, and pharmaceutical preparations containing them. The compounds act on the Kv1.5 potassium channel and inhibit a potassium current which is referred to as the ultra-rapidly activating delayed rectifier in the atrium... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC

20070117806 - Neutrophilia inhibitor: An antineutrophilia agent containing a 3(2H)-pyridazinone compound represented by the formula (I) or a pharmaceutically acceptable salt thereof [wherein each of R1, R2 and R3 is independently a hydrogen atom or a C1-6 alkyl group, X is a halogen atom, cyano or a hydrogen atom, Y is a halogen atom,... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070117808 - Substituted cycloalkylpyrrolones as allosteric modulators of glucokinase:

20070117805 - Glucocorticoid receptor modulators: The present invention provides non-steroidal compounds of formula I which are selective modulators (i.e., agonists and antagonists) of a steroid receptor, specifically, the glucocorticoid receptor. The present invention also provides pharmaceutical compositions containing these compounds and methods for using these compounds to treat animals requiring glucocorticoid receptor agonist or antagonist... Agent: Pharmacia Corporation Global Patent Department

20070117809 - Combination therapy for the treatment of cancer: The present invention provides methods of treating cancer comprising treating a patient in need thereof with hormone therapy and administering to the patient a therapeutically effective amount of at least one metalloprotease inhibitor. The present invention also provides pharmaceutical compositions comprising a therapeutically effective amount of at least one hormone... Agent: Jordan S. Fridman

20070117810 - Process for the preparation of ziprasidone: A process for the preparation of ziprasidone and a novel intermediate useful in its preparation. The process comprises the reduction of a compound (III) to give a compound (V) which is then reduced to compound (II). This is reacted with compound (IV) to give the desired compound.... Agent: Young & Thompson

20070117811 - N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-phenyl-1-piperazinealkylamide derivatives, and therapeutic use thereof as 5-ht7 receptor ligands: A series of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinealkylamides was prepared and their affinity for serotonin 5-HT7, 5-HT1A, and 5-HT2A receptors was measured using in vitro binding assays. In relation to 5-HT7 receptor affinity, receptor binding studies indicated that: (i) the optimal alkyl chain length was five methylenes; (ii) an unsubstituted 1,2,3,4-tetrahydronaphthalenyl nucleus was selected... Agent: Beusse Wolter Sanks Mora & Maire, P. A.

20070117812 - Dihydropyrimidines: The invention relates to compounds of the formulae... Agent: Jeffrey M. Greenman

20070117813 - Fungicidal mixtures: e

20070117814 - Fungicidal mixtures:

20070117815 - Method of treating cancers with saha and pemetrexed: The present invention relates to a method of treating cancer in a subject in need thereof, by administering to a subject in need thereof a first amount of a histone deacetylase (HDAC) inhibitor or a pharmaceutically acceptable salt or hydrate thereof, and a second amount of an anti-cancer agent. The... Agent: Mintz Levin Cohn Ferris Glovsky & Popeo

20070117816 - Kinase inhibitors: e

20070117819 - Methods of suppression of rage gene expression and rage triggered inflammatory genes by selected age-inhibitors: Accelerated formation of advanced glycation/lipoxidation end products (AGEs/ALEs) has been implicated in the pathogenesis of various diabetic complications. Several natural and synthetic compounds have been proposed and tested as inhibitors of AGE/ALE formation. We have previously reported the therapeutic effects of several new AGE/ALE inhibitors on the prevention of nephropathy... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20070117817 - Pyrimidine derivatives for treatment of hyperproliferative disorders: Pyrimidine derivatives of formula (I) in which J and Y represent aromatic or heteroaromatic rings; R2, G, G′, and G″ represent substituent groups and R2a represents H or halogen; L represents a linking group; and M represents CH or N. Pharmaceutical compositions containing these compounds, and methods of using these... Agent: Jeffrey M. Greenman

20070117818 - Pyrimidinone compounds useful as kinase inhibitors: This invention relates to newly identified compounds for inhibiting hYAK3 proteins and methods for treating diseases associated with the imbalance or inappropriate activity of hYAK3 proteins.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20070117821 - 4-aminopyrimidine-5-thione derivatives: Novel 4-aminopyrimidine-5-thione derivatives are disclosed. These compounds inhibit cyclin-dependent kinases, in particular Cdk1, Cdk2 and Cdk4. These compounds and their pharmaceutically acceptable salts have antiproliferative activity and are useful in the treatment or control of cancer, in particular solid tumors. This invention is also directed to pharmaceutical compositions containing such... Agent: Hoffmann-la Roche Inc. Patent Law Department

20070117820 - Heterocyclic urea derivatives for the treatment of pain: v

20070117822 - Novel antimalarial baylis-hillman adducts and a process for the preparation thereof: The present invention is directed towards the synthesis of novel and new chloropyridine skeleton based compounds and these are Bayllis Hillman adducts having a remarkable in vitro anti-malarial activity. These compounds have been found to possess anti-malarial activity against chloroquine sensitive and chloroquine resistant Plasmodium falciparum. The anti-malarial compounds of... Agent: Dla Piper US LLP Attn: Patent Group

20070117823 - N-sulfamoyl-n'-benzopyranpiperidine compounds and uses thereof: N-sulfamoyl-N′-benzopyranpiperidine compounds of formula I and their physiologically acceptable acid addition salts, pharmaceutical compositions comprising them, processes for their preparation, and their use for the treatment and/or inhibition of glaucoma, epilepsy, bipolar disorders, migraine, neuropathic pain, obesity, type II diabetes, metabolic syndrome, alcohol dependence, and/or cancer, and related concomitant and/or... Agent: Crowell & Moring LLP Intellectual Property Group

20070117824 - Spirocyclic compounds: The present invention relates to a novel class of substituted spirocyclic compounds. These compounds can inhibit histone deacetylase and are suitable for use in selectively inducing terminal differentiation, and arresting cell growth and/or apoptosis of neoplastic cells, thereby inhibiting proliferation of such cells. Thus, the compounds of the present invention... Agent: Merck And Co., Inc

20070117825 - Use of amide derivative of ge 2270 factor a3 for the treatment of acne: Use of the compound of formula (I) and the pharmaceutically acceptable addition salts thereof for the manufacture of a medicament for topical treatment or 5 prevention of acne formula (I) wherein: R represents methoxymethyl, R1 represents methyl, Rz represents methyl, Y represents the group formula (II) The compound of formula... Agent: O'melveny & Myers LLP

20070117827 - Compositions for affecting weight loss: Disclosed are compositions for affecting weight loss comprising a first compound and a second compound, where the first compound is a metabolite of naltrexone, such as 6-β-naltrexol or a prodrug of a naltrexone metabolite, and the second compound causes increased agonism of a melanocortin 3 receptor (MC3-R) and/or a melanocortin... Agent: Knobbe Martens Olson & Bear LLP

20070117829 - Oxycodone hydrochloride having less than 25 ppm 14-hydroxycodeinone: In certain embodiments the invention is directed to a process for preparing an oxycodone hydrochloride composition having less than 25 ppm of 14-hydroxycodeinone.... Agent: Davidson, Davidson & Kappel, LLC

20070117830 - Oxycodone hydrochloride having less than 25 ppm 14-hydroxycodeinone: In certain embodiments the invention is directed to a process for preparing an oxycodone hydrochloride composition having less than 25 ppm of 14-hydroxycodeinone.... Agent: Davidson, Davidson & Kappel, LLC

20070117831 - Oxycodone hydrochloride having less than 25 ppm 14-hydroxycodeinone: In certain embodiments the invention is directed to a process for preparing an oxycodone hydrochloride composition having less than 25 ppm of 14-hydroxycodeinone.... Agent: Davidson, Davidson & Kappel, LLC

20070117828 - Pharmaceutical compositions: A method of providing systemic analgesia to cats, dogs and other small mammals by the otic or transdermal administration of opioids is disclosed. Compositions for use in such a method are also disclosed.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20070117826 - Pharmaceutical formulations comprising ibuprofen, oxycodone, and 14-hydroxycodeinone: The present invention relates to pharmaceutical formulations of ibuprofen, oxycodone and 14-hydroxycodeinone and their use for the treatment of acute, moderate to severe pain.... Agent: Forest Laboratories, Inc. Att: Michael Ciraolo

20070117832 - Novel compound, corresponding compositons, preparation and/or treatment methods: Disclosed is a novel crystalline form of topotecan monohydrochloride pentahydrate, which is a pentahydrate of 10-[(dimethylamino)methyl]4-ethyl-4,9-dihydroxy-1H-pyrano[3′,4′:6,7]indolizino[1,2-b]quinoline-3,14(4H, 12H)dione monohydrochloride, corresponding pharmaceutical compositions, methods preparation and/or use thereof to treat anti-viral and/or cancer related diseases.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20070117834 - Methods and compositions for treating huntington's disease: The invention provides method for treating Huntington's disease, slowing the onset and/or development and/or progression of Huntington's disease or preventing the development of Huntington's disease using hydrogenated pyrido[4,3-b]indoles, including dimebon.... Agent: Morrison & Foerster LLP

20070117835 - Methods and compositions for treating huntington's disease: The invention provides method for treating Huntington's disease, slowing the onset and/or development and/or progression of Huntington's disease or preventing the development of Huntington's disease using hydrogenated pyrido[4,3-b]indoles, including dimebon.... Agent: Morrison & Foerster LLP

20070117833 - Pharmaceutical compositions: Pharmaceutical combinations comprising at least one mTOR inhibitor and their uses in treating arthritis or rheumatic arthritis and disorders associated therewith.... Agent: Novartis Corporate Intellectual Property

20070117836 - Napthalimide derivatives, methods for their production and pharmaceutical compositions therefrom: Novel substituted naphthalimide derivatives, pharmaceutically acceptable salts thereof and solvates thereof, are useful for making pharmaceutical compositions for the treatment of cell proliferative diseases such as cancer. The invention also provides methods for making such derivatives.... Agent: Clark & Elbing LLP

20070117837 - Process for the preparation of amorphous form of a platelet aggregation inhibitor drug: The present invention relates to a new method of preparation of the polymorph form 1 of methyl (S)-(+)-(2-chlorophenyl)-2-(6,7-dihydro-4H-thieno[3,2-c]pyridine-5-yl-acetate hydrogensulfate of the formula (I).... Agent: Birch Stewart Kolasch & Birch

20070117838 - Quinine dosage forms and methods of use thereof: Disclosed herein are quinine formulations and methods of using quinine formulations. Specifically disclosed are methods of using quinine and informing a user of information, including potential adverse effects, the effect of food on quinine's pharmacokinetics, effect of dosing various strengths of quinine, effect of maximum plasma concentrations of quinine in... Agent: Cantor Colburn, LLP

20070117839 - Two cyclic cinnamide compound: wherein represents a single bond or a double bond; Ar1 represents a phenyl group or pyridinyl group that may be substituted with 1 to 3 substituents; R1 and R2 each represent a C1-6 alkyl group, a hydroxyl group, or the like; Z1 represents a methylene group or vinylene group,... Agent: Birch Stewart Kolasch & Birch

20070117840 - Receptor antagonist: wherein ring A represents an aromatic ring; X represents a bond, oxygen, NR4 (R4 represents hydrogen, a hydrocarbon group, or a heterocyclic group), or alkylene; R1 represents a hydrocarbon group, or a heterocyclic group; R2 represents —COYR5 (Y represents a bond, alkylene, oxygen, sulfur, or NR6 (R6 represents hydrogen, a... Agent: Takeda Pharmaceuticals North America, Inc Intellectual Property Department

20070117841 - Use of pirfenidone in therapeutic regimens: The present invention provides methods for treating a disorder, and methods for inhibiting a stress-activated protein kinase (SAPK) in a cell in an individual, the methods generally involving administering to an individual in need thereof an effective amount of pirfenidone or a pirfenidone analog; comparing a post-treatment SAPK activity level... Agent: Knobbe Martens Olson & Bear LLP

20070117842 - Polymorph of 4-[3-chloro-4-(cyclopropylaminocarbonyl)aminophenoxy]-7-methoxy-6- quinolinecarboxamide and a process for the preparation of the same: A polymorph (A) of 4-(3-chloro-4-(cyclopropylaminocarbonyl)aminophenoxy)-7-methoxy-6-quinolinecarboxamide, having a diffraction peak at a diffraction angle (2θ±0.2°) of 15.75° in a powder X-ray diffraction; and a polymorph (B) of 4-[3-chloro-4-(cyclopropylaminocarbonyl)aminophenoxy]-7-methoxy-6-quinolinecarboxamide, having a diffraction peak at a diffraction angle (2θ±0.2°) of 21.75° in a powder X-ray diffraction.... Agent: Choate, Hall & Stewart LLP

20070117843 - Quinoline inhibitors of cgmp phosphodiesterase: p

20070117844 - 5-htp combination therapy: The present invention relates to combination therapies and pharmaceutical compositions comprising a combination of 5-hydroxytryptophan and a serotonin reuptake inhibitor. The present invention provides a pharmaceutical composition comprising (i) a serotonin reuptake inhibitor and (ii) 5-hydroxytrytophan. The present invention further provides a pharmaceutical composition comprising (i) 5-hydroxytryptophan in an amount... Agent: Lundbeck Research Usa, Inc. Attention: Stephen G. Kalinchak, Legal

20070117845 - 2-pyridinylethylcarboxamide derivatives and their use as fungicides: e

20070117846 - Processes for producing 1-benzyl-4-[(5,6-dimethoxy-1indanon)-2-yl]methylpiperidine and hydrochloride thereof: Processes for preparing 1-benzyl-4-[(5,6-dimethoxy-lindanon)-2-yl]methylpiperidine (donepezil), which is useful as an intermediate for medicines, and for producing 1-benzyl-4-[(5,6-dimethoxy-1-indanon)-2-yl]methylpiperidine hydrochloride (donepezil hydrochloride), which is useful as a medicine. The process for donepezil hydrochloride production comprises catalytically hydrogenating the compound represented by the structural formula (III) [1-benzyl-4-[(5,6-dimethoxy-lindanon)-2-ylidene]methylpiperidine] with a Raney nickel catalyst under... Agent: Birch Stewart Kolasch & Birch

20070117847 - N-(3-(4-substituted-1-piperiding1)-1-phenylpropyl) substituted sulfonamides as nk-3 receptor antagonists: o

20070117848 - Metalloprotein inhibitors: wherein X is O or S and each R1, R2, R3, and R4 is individually hydrogen or an organic radical. The metalloprotein inhibitors are useful for preventing or treating a pathological disease, condition, or symptom that is associated with pathological metalloprotein activity and/or that is alleviated by inhibition of said... Agent: Schwegman, Lundberg, Woessner & Kluth, P.A.

20070117849 - Alfavbeta3 and alfavbet6 integrin antagonists as antifibrotic agents: This invention relates to inhibition of αv integrins, especially αvβ3 and αvβ6 integrins, by specific antagonists, preferably non-peptidic antagonists, related compounds and compounds with comparable specificity, that downregulate fibrogenesis by inhibiting cell migration and production of pro-fibrogenic molecules (e.g., collagens, TIMP-1) and cytokines (e.g., CTGF) by activated hepatic stellate cells/myofibroblasts,... Agent: Millen, White, Zelano & Branigan, P.C.

20070117850 - Novel pyrazole compounds as transforming growth factor (tgf) inhibitors: Novel pyrazole compounds, including derivatives thereof, to intermediates for their preparation, to pharmaceutical compositions containing them and to their medicinal use are described. The compounds of the present invention are potent inhibitors of transforming growth factor (“TGF”)- signaling pathway. They are useful in the treatment of various TGF-related disease states... Agent: Warner-lambert Company

20070117851 - Liquid pharmaceutical compositions of nimodipine: The present invention relates to liquid compositions of nimodipine and administration of said compositions. New stable liquid compositions of nimodipine can be used to treat conditions such as, but not limited to, aneurysms, subarachnoid hemorrhage, vasospastic angina, Prenzmetal's angina, stable angina, acute myocardial infarction, myocardial arrest, arrhythmia, systemic hypertension, pulmonary... Agent: Philip S. Johnson Johnson & Johnson

20070117852 - (hetero)cyclyl carboxanilides for controlling harmful fungi: e

20070117853 - Inhibitor of pain threshold decrease: The invention aims to provide a drug having an activity on inhibiting a decrease in pain threshold. Since a κ-opioid receptor agonist effectively inhibits the decrease in pain threshold, it is useful as an inhibitor of pain threshold decrease.... Agent: Frishauf, Holtz, Goodman & Chick, PC

20070117854 - Malononitrile compounds and use thereof: A nitrile compound shown by the formula (1) has an excellent pesticidal activity and it is useful as an active ingredient of pesticide.... Agent: Birch Stewart Kolasch & Birch

20070117855 - Phenyl-sulfamates as aromatase inhibitors: wherein X, Y and Z are each independently of each other an optional linker group; R1 is a ring system; R2 is selected from hydrocarbyl groups, oxyhydrocarbyl groups, cyano (—CN), nitro (—NO2) and halogens; R3 and R4 are independently selected from H and hydrocarbyl, ring A and B are independently... Agent: Frommer Lawrence & Haug

20070117856 - Indazole derivatives: R2 represents a hydrogen atom, CONR2aR2b (wherein R2a and R2b may be the same or different and each represents a hydrogen atom, substituted or unsubstituted lower alkyl, substituted or unsubstituted aryl, substituted or unsubstituted ararkyl or a substituted or unsubstituted heterocyclic group, or R2a and R2b are combined together with... Agent: Fitzpatrick Cella Harper & Scinto

20070117857 - Substituted 3-amido-tetrahydro-indazolyl cannabinoid modulators:

20070117858 - Substituted 5-heteroaryl-1-phenyl-pyrazole cannabinoid modulators:

20070117859 - Heterocyclic antiviral compounds: Chemokine receptor antagonists, in particular, 3,7-diazabicyclo[3.3.0]octane compounds according to formula (I) are antagonists of chemokine CCR5 receptors which are useful for treating or preventing an human immunodeficiency virus (HIV) infection, or treating AIDS or ARC. The invention further provides methods for treating diseases that are allieviated with CCR5 antagonists. The... Agent: Roche Palo Alto LLC Patent Law Dept. M/s A2-250

20070117860 - Bicyclic indolinesulphonamide derivatives: The invention relates to novel bicyclic indoline sulfonamide derivatives of general formula (I), methods for the production thereof, and the use thereof in medicaments, especially as potent PPAR delta agonists for preventing and/or treating cardiovascular diseases, particularly dyslipidemia, arteriosclerosis, and coronary heart diseases.... Agent: Jeffrey M. Greenman

20070117861 - Treatment or prevention of cardiovascular and respiratory disorders with novel substituted cyclic-amp specific phosphodiesterase inhibitors: Compositions and methods are described for the prevention and/or treatment of cardiovascular and respiratory disorders, the method comprising administering to the subject a novel cAMP-specific PDE inhibitor. Also described are therapeutic compositions, pharmaceutical compositions and kits that are useful in the present invention.... Agent: Nelson Mullins Riley & Scarborough, LLP

20070117862 - Novel formulations of pharmacological agents, methods for the preparation thereof and methods for the use thereof: In accordance with the present invention, there are provided compositions and methods useful for the in vivo delivery of substantially water insoluble pharmacologically active agents (such as the anticancer drug paclitaxel) in which the pharmacologically active agent is delivered in the form of suspended particles coated with protein (which acts... Agent: Morrison & Foerster LLP

20070117863 - Novel formulations of pharmacological agents, methods for the preparation thereof and methods for the use thereof: In accordance with the present invention, there are provided compositions and methods useful for the in vivo delivery of substantially water insoluble pharmacologically active agents (such as the anticancer drug paclitaxel) in which the pharmacologically active agent is delivered in the form of suspended particles coated with protein (which acts... Agent: Morrison & Foerster LLP

20070117864 - Composition for preventing and treating hepatoma: The present invention provides a liver cancer prophylactic and therapeutic composition, and the present invention relates to a liver cancer prophylactic and therapeutic composition characterized in that this composition contains compounds that have a hepatoma proliferation inhibiting effect as active ingredients, these compounds comprising enterolactone (ENL) or plant lignan precursors... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070117865 - Sugar derivatives comprising oxiranes or alpha, beta-unsaturated gamma-lactones, process for their preparation and their utilisation as pesticides: wherein R7 represents hydrogen or alkyl, R8 represents phenylsulfanyl, phenylselenyl, phenylsulfoxy or phenylselenoxy, and R9 represents hydrogen, ethoxycarbonyl or carbamoyl; and R4 represents, independently, hydrogen, alkoxy or substituted alkoxy, or R1 and R4, taken together, represent an alkylidenedioxy or a substituted alkylidenedioxy group; wherein the pest dies as a result... Agent: Merchant & Gould PC

20070117866 - Calcium bis [ (2s) - 3- [3-[ (2s) -3- (4-chloro-2-cyanophenoxy) -2- fluoropropoxy]phenyl ]-2-isopropoxypropionate] and intermediate thereof: The present invention relates to calcium bis[(2S)-3-[3-[(2S)-3-(4-chloro-2-cyanophenoxy)-2-fluoropropoxy]phenyl]-2-isopropoxypropionate] represented by formula (I), a hydrate thereof, a crystal of the compound of formula (I), and a crystal of the hydrate of the compound of formula (I) which are useful as pharmaceuticals, and to processes for producing the same, and intermediates therefore, and... Agent: Birch Stewart Kolasch & Birch

20070117867 - Kit comprising three independent compositions and methods for building muscle, increasing strength, increasing muscle size, increasing muscle performance and reducing muscle fatigue: A kit, and a method of using same, that comprises first, second and third components wherein the first, second and third components collectively comprise Glycine, Arginine, Leucine, Creatine, Alpha Lipoic Acid, and earth metal salts of Ketoisocaproic Acid. Use of the kit may enhance muscle performance, build muscle, increase muscle... Agent: Kenyon & Kenyon LLP

20070117868 - Use of n-arylhydrazine derivatives for combating non-crop pests: k

20070117869 - Methods for treating coginitive impairment and improving cognition: Cognitive impairments are treated and cognition is improved with an amphetamine compound. In one embodiment, the method includes administering an I-amphetamine compound. In another embodiment, the method includes administering an l-methamphetamine compound.... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20070117870 - Enantiomers of n-desmethyl venlafaxine: The present invention provides enantiomers of N-Desmethyl venlafaxine, as well as their use in pharmaceutical compositions and medically useful treatments, particularly including central nervous system uses.... Agent: Wyeth Patent Law Group

20070111926 - Conjugation of peptides: Methods for the selective conjugation of peptides which comprises an enzymatic incorporation of a functional group at the C-terminal end of a peptide followed by reaction with a second compound comprising the moiety to be conjugated to the peptide, wherein said second compound comprises a functional group which selectively reacts... Agent: Novo Nordisk, Inc. Patent Department

20070111927 - Peptoid compounds: The invention relates to new peptoid compounds of formula (I), as well as their use in the treatment of bacterial infections, such as those caused by vancomycin resistant microorganisms, and to compositions thereof.... Agent: Seed Intellectual Property Law Group PLLC

20070111928 - Didemnin analogs and fragments and methods of making and using them: The present invention relates to macrocyclic depsipeptides, including didemnin analogs and fragments thereof, which are useful as anti-cancer agents and for other purposes. The invention includes numerous didemnin analogs and fragments and methods of making them. Methods of using these compounds as inhibitors of protein synthesis, cell growth, and tumorigenesis... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070111929 - Methods for the treatment of anxiety and for identification of anxiolytic agents: Methods for the treatment of neuropsychiatric disorders such as anxiety are disclosed. The methods involve modulating the expression of the angiotensin IV receptor or modulating the biological activity of the angiotensin IV receptor by utilizing antagonists to the receptor. Also disclosed are methods for identifying antagonists of the angiotensin IV... Agent: Woodcock Washburn LLP

20070111930 - Process for preparing vapreotide: A solution phase process for preparing vapreotide, having the formula:... Agent: Dr. Reddy's Laboratories, Inc.

20070111935 - Combination growth factor therapy and cell therapy for treatment of acute and chronic diseases of the organs: Acute and chronic diseases of the organs are treated using a rational, multi-tier approach. A patient is pretreated with growth factor proteins or gene therapy, followed by the administration of adult stem cells or other cell therapy. The patient can be a fetus treated in utero or removed from the... Agent: Ernest D. Buff Ernest D. Buff And Associates, LLC.

20070111936 - Complex of alpha-fetoprotein and inducers of apoptosis for the treatment of cancer: The invention relates to a composition comprising exogenous alpha-fetoprotein, a first compound reversibly bound to exogenous alpha-fetoprotein in vitro, and an unbound second compound wherein the first and second compound are anticancer drugs or combinations of anticancer drugs and wherein the second compound reversibly binds to recycled exogenous alpha-fetoprotein in... Agent: Conley Rose, P.C.

20070111931 - Compositions and methods for promoting wound healing and tissue repair: The present invention relates to methods for promoting tissue repair, angiogenesis and cell migration. The method of the invention utilizes thymosin β4 (Tβ4) peptide to promote tissue repair, angiogenesis and cell migration. The invention further relates to modulating Tβ4 activity in tissues.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20070111941 - Cytokine receptor zalpha11: Novel polypeptides, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed for zalpha11, a novel cytokine receptor. The polypeptides may be used within methods for detecting ligands that stimulate the proliferation and/or development of hematopoietic, lymphoid and myeloid cells in vitro and in vivo. Ligand-binding receptor polypeptides can... Agent: Zymogenetics, Inc. Intellectual Property Department

20070111942 - Cytokine receptor zcytor19: Novel polypeptides, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed for zcytor19, a novel class II cytokine receptor. The polypeptides may be used within methods for detecting ligands that stimulate the proliferation and/or development of hematopoietic, lymphoid and myeloid cells in vitro and in vivo. Ligand-binding receptor... Agent: Zymogenetics, Inc. Intellectual Property Department

20070111933 - Diagnosis and treatment methods related to aging, especially of liver: Mouse genes differentially expressed in comparisons of older and younger livers by gene chip analysis have been identified, as have corresponding human genes and proteins. The human molecules, or antagonists thereof, may be used for protection against faster-than-normal biological aging, or to achieve slower-than-normal biological aging. The human molecules may... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20070111939 - Human interleukin-11 receptor: Polynucleotides encoding the human IL-11 receptor and fragments thereof are disclosed. IL-11 receptor proteins, methods for their production, inhibitors of binding of human IL-11 and its receptor and methods for their identification are also disclosed.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.C.

20070111932 - Method of enhancing and/or inducing neuronal migration using erythropoietin: Methods are described for the enhancement and/or induction of migration of neural stem cells or neuronal progenitor cells. Multipotent neural stem cells are exposed to erythropoietin which enhances the migration of multipotent neural stem cells and neuronal progenitor cells. The erythropoietin may be exogenously applied to the multipotent neural stem... Agent: Fish & Richardson P.C.

20070111940 - Peptide agonists of glp-1 activity: Novel peptide agonists of GLP-1 activity useful for lowering blood glucose levels. The novel peptides comprise variants of the GLP-1 or the exendin-4 polypeptide sequence and are pharmacologically active and stable. These peptides are useful in the treatment of diseases that benefit from regulation of excess levels of blood glucose... Agent: Clark & Elbing LLP

20070111938 - Peptide pharmaceutical compositions: The present invention relates to alkylglycoside-containing compositions and methods for increasing the stability, reducing the aggregation and immunogenicity, increasing the biological activity, and reducing or preventing fibrillar formation of a peptide, polypeptide, or variant thereof, for example insulin and Peptide T or analog thereof.... Agent: Dla Piper US LLP

20070111934 - Procaspase 1 activation inhibitor: A method and an agent for inhibiting the oligomerization of procaspase-1, a method and an agent for inhibiting the activation of procaspase-1, a method and an agent for inhibiting the production of caspase-1, a method of preventing and/or treating an inflammatory disease, and an agent for preventing and/or treating an... Agent: Kilyk & Bowersox, P.l.l.c.

20070111944 - Purification of vascular endothelial growth factor-b: The present invention provides a method for purifying recombinant peptides, polypeptides or proteins away from truncated or other full-length forms of these molecules. In particular the invention contemplates a method of purifying a vascular endothelial growth factor (VEGF) molecule by subjecting a biological sample containing the molecule to be purified... Agent: Scully Scott Murphy & Presser, PC

20070111943 - Tetrodotoxin-resistant sodium channel alpha subunit: The present invention is directed to a chimp sodium channel alpha subunit and methods and compositions for making and using the same.... Agent: Vertex Pharmaceuticals Inc.

20070111945 - Use of corticotroph-derived glycoprotein hormone to treat inflammation and potentiate glucocorticoid action: The use of corticotroph-derived glycoprotein hormone (CGH) to potentiate glucocorticoid action and to reduce glucocorticoid-induced adrenocortical suppression is described. CGH can be co-administered with glucocorticoids to enable a lower dosage of glucocorticoids to be used and to prevent or reduce glucocorticoid-induced side-effects. The invention additionally provides methods for the use... Agent: Zymogenetics, Inc. Intellectual Property Department

20070111937 - Use of fibrous tissue inducing proteins for hernia repair: The present disclosure relates to hernia repair and methods for stimulating growth of fascia tissue employing compositions comprising fibrous tissue inducing proteins.... Agent: Wyeth/finnegan Henderson, LLP

20070111946 - Bioactive peptides and peptide derivatives of parathyroid hormone (pth) and parathyroid hormone-related peptide (pthrp): Novel parathyroid hormone peptide (PTH) and parathyroid hormone related peptide (PTHrP) or derivatives thereof which are biologically active are disclosed, as are pharmaceutical compositions containing such peptides, and synthetic and recombinant methods for producing such peptides. Also disclosed are methods for treating mammalian conditions characterized by decreases in bone mass... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070111947 - Fibrin targeted therapeutics: Fibrin targeted therapeutic agents for the treatment of thromboembolism, infection, and cancer are provided.... Agent: Fish & Richardson P.C.

20070111948 - Agent derived from tortoise spleen stimulating mammalian hemopoiesis: The present invention relates to a proteinaceous extract derived from tortoise spleen and to a tetrapeptide FTGN, which have stimulatory activity on hematopoietic cells. In particular, this tetrapeptide enhances hemopoietic reconstruction, and bone marrow re-population, reduced as a consequence of a high dose of radiation or chemotherapy exposure. The invention... Agent: Merchant & Gould PC

20070111949 - Inhibiting gs-fdh to modulate no bioactivity: Patients needing NO donor therapy or inhibition of pathologically proliferating cells or increased NO bioactivity are treated with a therapeutically effective amount of an inhibitor of glutathione-dependent formaldehyde dehydrogenase.... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.C.

20070111950 - Indole compounds useful for the treatment of cancer: The present invention provides novel indole derivatives useful to inhibit cancer or sensitize cancer cells to chemotherapeutic agents, radiation or other anti-cancer treatments.... Agent: Schwegman, Lundberg, Woessner & Kluth, P.A.

20070111951 - Novel galactosylceramide analogues, and beta-glucocerebrosidase activator, external skin preparations and method of activating beta-glucocerebrosidase using the same: e

20070111952 - Glycosylated triketide delta lactones: The present invention relates to compounds of formula (1) and salts, stereoisomeric forms, racemic mixtures, prodrugs, esters and metabolites thereof. R1 is a glycosyl moiety, hydroxyl-protected acetate derivatives thereof or amino derivatives thereof; R2, R3 and R4 are, each independently, selected from hydrogen, C1-6alkyl, C2-20alkenyl, C6-20arylalkyl, C3-7cycloalkyl, C3-7cycloalkylC1-6alkyl, C6-20aryl aralkyl,... Agent: Knobbe Martens Olson & Bear LLP

20070111954 - Apparatus and method of wart treatment: A single-use, delivery vehicle for the treatment of warts and molluscum contagiosum, consisting of a solution of cantharidin, salicylic acid, and podophyllin packaged in a crushable ampoule with a soft, absorbent, applicator tip. A method of delivering wart-removing and molluscum removing compositions to the skin, consisting of the steps of... Agent: Briggs And Morgan P.A.

20070111953 - Compositions to improve the bioavailability of polymethoxyflavones and tocotrienols for treatment of cardiovascular disease: The present invention relates to solid compositions comprised primarily of phospholipids (also known commercially as lecithin), or enriched phospholipids, in an amount of at least 20% up to 90% by weight of the total phospholipid composition. More particularly, the present invention relates to solid phospholipid compositions that provide enhanced bioactivity... Agent: Davidson, Davidson & Kappel, LLC

20070111955 - Extraction and purification method of active constituents from stem of lonicera japonica thunb., its usage for anti-inflammatory and analgesic drug: Disclosed is a method for extracting and purifying active constituents from honeysuckle (Lonicera japonica Thunb.) and its use. More particularly, this invention relates to an extraction and purification method of active constituents including sweroside from for honeysuckle stem (stem of honeysuckle where leaves are removed) by removing tannins, hardly soluble... Agent: Frommer Lawrence & Haug

20070111956 - Remedy for sarcoidosis and method of treating the same: The present invention provides a remedy for sarcoidosis, one of systemic granulomatous diseases, and a method for treating sarcoidosis. A remedy for sarcoidosis containing a Propionibacterium acnes-targeting antibiotic such as minocycline hydrochloride and clindamycin as an active component is prepared. Further, sarcoidosis is treated by administering this remedy for sarcoidosis... Agent: Alston & Bird LLP

20070111959 - Combination gene for use in inhibiting cancerous cell growth: An expression vector for use in inhibiting cancerous cell growth includes the following: (a) a first promoter nucleotide sequence; (b) a first coding nucleotide sequence encoding for a receptor that interacts with an angiogenic growth factor operatively linked to the first promoter sequence; (c) a second promoter nucleotide sequence upstream... Agent: Workman Nydegger (f/k/a Workman Nydegger & Seeley)

20070111961 - Dbait and uses thereof: The invention relates to compositions and methods for interfering with the DNA repair of double strand breaks (DSBs). The invention discloses novel double-stranded nucleic acid molecules. that act as baits and hijack the holocomplex of enzymes responsible of DNA DSB sensing, signaling and/or repair pathways, in particular the non homologous... Agent: Nixon & Vanderhye, PC

20070111960 - High affinity probes for analysis of human papillomavirus expression: This invention is directed toward methods kits and compositions pertaining to the use of high affinity probes for diagnostic applications. The invention is further directed toward the use of the high affinity probes for the detection of clinically important human papillomavirus (HPV) strains. High affinity probes enable rapid diagnostic assays... Agent: Edwards & Angell, LLP

20070111962 - Immunosuppression compound and treatment method: A method and compound for suppressing an immune response in a mammalian subject, for the treatment or prevention of an autoimmune condition or transplantation rejection are disclosed. The compound is an antisense oligonucleotide analog compound having a targeting sequence complementary to a preprocessed CTLA-4 mRNA region identified by SEQ ID... Agent: Perkins Coie LLP

20070111958 - Inhibition of hiv and shiv replication with antisense interleukin-4: A method of treating or preventing SHIV or HIV infection in a subject comprising administering a therapeutically effective amount of a antisense IL-4. The antisense IL-4 inhibits viral replication in the liver, lungs, spleen, and even the lymph nodes of the subject. Further, the antisense IL-4 can be used in... Agent: Stinson Morrison Hecker LLP Attn: Patent Group

20070111963 - Modulation of gene expression by oligomers targeted to chromosomal dna: Synthesis of a target transcript of a gene is selectively increased in a mammalian cell by contacting the cell with a polynucleotide oligomer of 12-28 bases complementary to a region within a target promoter of the gene under conditions whereby the oligomer selectively increases synthesis of the target transcript.... Agent: Richard Aron Osman Science And Technology Law Group

20070111957 - Synthetic gene encoding human epidermal growth factor 2/neu antigen and uses thereof: Synthetic polynucleotides encoding human HER2/neu or a truncated form thereof, are provided, the synthetic polynucleotides being codon-optimized for expression in a human cellular environment. The gene encoding hHER2 is commonly associated with the development of human carcinomas. The present invention provides compositions and methods to elicit or enhance immunity to... Agent: Merck And Co., Inc

20070111964 - Vitamin b12 nasal spray and method of use: The present invention relates generally to vitamin B12 nasal spray compositions and methods of using the same in the treatment of vitamin B12 deficiency and various disorders that are related to such deficiency. In particular embodiments, the present invention is directed to treatment methods comprising intranasal administration of a cobalamin... Agent: Senniger Powers

20070111965 - Compositions comprising lipoxygenase inhibitors and cyclodextrin: The present invention is directed to formulations of inclusion complexes of lipoxygenase inhibitors and cyclodextrins having a therapeutically effective concentration of the lipoxygenase inhibitor, methods of making the same and methods of treating disease states using the same. Forming cyclodextrin complexes permits the enhancement of the aqueous solubility of lipoxygenase... Agent: Baxter Healthcare Corporation

20070111966 - Method for the treatment and/or prevention of urinary disorders: The present invention relates to a method for the treatment and/or prevention of urinary disorders, comprising administering an effective amount of an osmotic diuretic agent and an effective amount of an appetence-inducing agent to a subject in need thereof.... Agent: Young & Thompson

20070111968 - 1-aza-dibenzo[e,h]azulenes for the treatment of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of 1-aza-dibenzo[e,h]azulenes and of their pharmacologically acceptable salts and solvates in a pharmaceutical formulation for the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the neurochemical equilibrium of... Agent: Darby & Darby P.C.

20070111967 - Organosilicon compounds and their use: A compound of formula (I) or formula (II): wherein the variables are as defined in the claims.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20070111969 - Pharmaceutical compositions for the administration of aptamers: Pharmaceutical compositions comprising an aptamer and an amino acid ester or amide or an aptamer; a divalent metal cation; and a carboxylic acid, a phospholipid, a phosphatidyl choline, or a sphingomyelin. Methods of treating or preventing a condition in an animal comprising administering to the animal the pharmaceutical compositions.... Agent: Kenyon & Kenyon LLP

20070111970 - Inositol compounds and uses of same in the treatment of diseases characterized by abnormal protein folding or aggregation or amyloid formation, desposition, accumulation or persistence: wherein X is a radical of scyllo-inositol wherein one or more of R1, R2, R3, R4, R5, and R6 are independently alkyl, alkenyl, alkynyl, alkylene, alkenylene, alkoxy, alkenyloxy, cycloalkyl, cycloalkenyl, cycloalkoxy, aryl, aryloxy, arylalkoxy, aroyl, heteroaryl, heterocyclic, acyl, acyloxy, sulfoxide, sulfate, sulfonyl, sulfenyl, sulfonate, sulfinyl, amino, imino, azido, thiol, thioalkyl,... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20070111971 - Novel compounds: e

20070111972 - \"methods and products for treatment of diseases\": The present invention relates to the treatment of diseases and conditions with an effective amount of a steroid having those formulas given in the specification, or a pharmacologically-acceptable salt or ester thereof. The disease or conditions treatable according to the invention include angiogenic diseases and conditions of the eye, angiogenic... Agent: Sheridan Ross PC

20070111973 - Treatment of tumours: The present invention refers to steroid derivatives for use as medicaments. More specifically, the invention also relates to the use of a steroid derivative of 5-androstene-, 5-pregnenolone or corresponding saturated derivatives (androstane- or pregnane-) in the manufacture of a medicament for the treatment of a benign and/or malignant tumour, which... Agent: Gauthier & Connors, LLP

20070111977 - Combination preparation for oral contraception and oral therapy of dysfunctional uterine bleeding containing estradiol valerate and dienogest and method of using same: The multiphase combination preparation for oral therapy of dysfunctional uterine bleeding and for oral contraception contains a first phase consisting of 2 daily dosage units, each containing 3 mg of estradiol valerate or<3 mg of estradiol; a second phase consisting of a first group of 5 daily dosage units, each... Agent: Striker, Striker & Stenby

20070111976 - Method of preventive on-demand hormonal contraception: The invention relates to a method of hormonal female controlled on-demand contraception in which a pharmaceutical preparation comprising at least one progestogen is administered transdermally on demand and on a single occasion prior to anticipated sexual intercourse.... Agent: Millen, White, Zelano & Branigan, P.C.

20070111975 - Methods of hormonal treatment utilizing ascending-dose extended cycle regimens: The present invention provides ascending-dose extended cycle regimens in which a female is administered an estrogen and a progestin for a period of greater than 30 or 31 consecutive days, optionally followed by a hormone-free period or by a period of administration of estrogen. The disclosed regimens can be administered... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070111974 - Therapeutic gestagens for the treatment of premenstrual dysphoric disorder: A method of treating premenstrual dysphoric disorders comprising administering to a patient in need of such treatment daily from day 1 to day 24 3 mg of drospirenone and 0.02 mg of ethinylestradiol.... Agent: Millen, White, Zelano & Branigan, P.C.

20070111978 - Viscous budesonide for the treatment of inflammatory diseases of the gastrointestinal tract: Provided herein are methods for preventing or alleviating the symptoms of and inflammation associated with inflammatory diseases and conditions of the gastrointestinal tract, for example, those involving the esophagus. Also provided herein are pharmaceutical compositions useful for the methods of the present invention.... Agent: Biotechnology Law Group C/o Portfolioip

20070111979 - Methods of treating cell proliferative disorders using a compressed temozolomide dosing schedule: There are disclosed methods and kits for treating cancer in a patient in need of such treating comprising administering temozolomide according to improved dosing schedules.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20070111980 - Process for preparing pure cephalosporine intermediates: The present invention relates to a process for preparing key intermediates for cephalosporin antibiotics substantially free of undesired Δ2 isomer. Thus, 7-aminocephalosporanic acid (7-ACA) is silylated with hexamethyldisilazane in cyclohexane at reflux temperature. (6R,7R)-3-[(Acetyloxy)methyl]-7-(trimethylsilyl)aminoceph-3-em-4-oic acid obtained is reacted with the mixture of N-methylpyrrolidine and trimethylsilyl iodide in cyclohexane, desilylated with... Agent: Caesar, Rivise, Bernstein, Cohen & Pokotilow, Ltd.

20070111981 - New (hetero)aryl compounds with mch antagonistic activity and medicaments comprising these compounds: wherein the groups and radicals A, B, Q, W, X, Y, Z, R1, R2, R4a, R4b, R5a, R5b, have the meanings given in claim 1. Moreover the invention relates to pharmaceutical compositions containing at least one compound according to the invention. By virtue of their MCH-receptor antagonistic activity the pharmaceutical... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070111982 - Carboxamide spirohydantoin cgrp receptor antagonists: The present invention is directed to compounds that are antagonists of CGRP receptors and that are useful in the treatment or prevention of diseases in which the CGRP is involved, such as headache, migraine and cluster headache. The invention is also directed to pharmaceutical compositions comprising these compounds and the... Agent: Merck And Co., Inc

20070111983 - Fasudil in combination therapies for the treatment of pulmonary arterial hypertension: Preferred embodiments of the present invention are related to novel therapeutic drug combinations and methods for treating and/or preventing pulmonary arterial hypertension and/or stable angina. More particularly, aspects of the present invention are related to therapeutic combinations comprising a Rho-kinase inhibitor, such as fasudil, and one or more additional compounds... Agent: Knobbe Martens Olson & Bear LLP

20070111984 - Hiv integrase inhibitors: The invention encompasses a series bicyclic pyrimidinone compounds of Formula I which inhibit HIV integrase and prevent viral integration into human DNA. This action makes the compounds useful for treating HIV infection and AIDS. The invention also encompasses pharmaceutical compositions and methods for treating those infected with HIV.... Agent: Louis J. Wille Bristol-myers Squibb Company

20070111985 - Hiv integrase inhibitors: The invention encompasses a series bicyclic pyrimidinone compounds of Formula I which inhibit HIV integrase and prevent viral integration into human DNA. This action makes the compounds useful for treating HIV infection and AIDS. The invention also encompasses pharmaceutical compositions and methods for treating those infected with HIV.... Agent: Louis J. Wille Bristol-myers Squibb Company

20070111986 - Preparation method for quetiapine: The present invention discloses a process for the preparation of quetiapine, which comprises the ring closure and deprotection of a compound of the formula (I), as well as novel intermediates in the process.... Agent: Birch Stewart Kolasch & Birch

20070111987 - Preparation of quetiapine: The present invention discloses a process for the preparation of quetiapine, which comprises the ring closure of a compound of the formula shown below, as well as novel intermediates in the process.... Agent: Birch Stewart Kolasch & Birch

20070111988 - Selective estrogen receptor modulators: The present invention relates to a selective estrogen receptor modulators of formula I (I); or a pharmaceutical acid addition salt thereof; and of formula II (II); or a pharmaceutical salt thereof; useful, e.g., for treating endometriosis and/or uterine leiomyoma/leiomyomata.... Agent: Eli Lilly & Company

20070111990 - 3-aza-1-oxa-dibenzo[e,h]azulenes for the treatment of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of 3-aza-1-oxa-dibenzo[e,h]azulenes and of their pharmacologically acceptable salts and solvates for the use in the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the neurochemical equilibrium of biogenic... Agent: Darby & Darby P.C.

20070111989 - Novel diazabicyclononene derivatives and use: The invention relates to novel 3,9-diazabicyclo[3.3.1]nonene derivatives of formula (I), wherein Z is 0 or 1, one of m, n is 0 and the other is 1, and their use as inhibitors of renin.... Agent: Hoxie & Tso LLP

20070111991 - Novel dibenzo [b, f] oxepine-10-carboxamides and pharmaceutical uses thereof: The present invention pertains to novel dibenzo[b,f]oxepine-10-carboxamides compound to a process for the preparation of such compounds of formula I, their use as a pharmaceuticals, especially in the treatment of neurological and vascular disorders related to beta-amyloid generation and/or aggregation, and to pharmaceutical compositions and combinations comprising such compounds of... Agent: Novartis Corporate Intellectual Property

20070111992 - 4-phenyl-6-substituted-pyrimidine-2-carbonitrile derivatives: wherein each of the substituents is given the definition as set forth in the specification and claims; or a pharmaceutically acceptable salt thereof. Also disclosed are pharmaceutical compositions comprising these 4-phenyl-6-substituted-pyrimidine-2-carbonitrile derivatives and use of these 4-phenyl-6-substituted-pyrimidine-2-carbonitrile derivatives for the treatment of cathepsin K and cathepsin S related disorders, e.g.... Agent: Akzo Nobel Inc.

20070111994 - Novel 1,4-benzodiazepine-2,5-diones with therapeutic properties: The present invention relates to novel chemical compounds, methods for their discovery, and their therapeutic use. In particular, the present invention provides novel 1,4-benzodiazepine-2,5-dione compounds, and methods of using novel 1,4-benzodiazepine-2,5-dione compounds as therapeutic agents to treat a number of conditions associated with the faulty regulation of the processes of... Agent: Medlen & Carroll, LLP

20070111993 - Pharmaceutical composition comprising a salt of mirtazapine: The invention provides for a pharmaceutically suitable non-sublimating and solid salt of an enantiomer of mirtazapine, in particular, a mirtazapine salt selected from the list of the salt of maleic acid, hydrobromic acid and fumaric acid, for use in the manufacture of a pharmaceutical composition comprising a salt of S-... Agent: Howrey Simon Arnold & White L.l.p Docketing Dept.

20070111998 - Novel heterocyclic compounds as pstat3/il-6 inhibitors: The present invention relates to novel heterocyclic compounds of the general formula (I), as IL-6 inhibitors, their derivatives, their analogs, their tautomeric forms, their stereoisomers, their polymorphs, their hydrates, their solvates, their pharmaceutically acceptable salts and compositions, their metabolites and prodrugs thereof. The present invention more particularly provides novel heterocyclic... Agent: Oliff & Berridge, PLC

20070111995 - Pyrazolo [3,4-b] pyridine compounds and their use as phosphodiesterase inhibitors: e

20070111996 - Pyrazolopyrimidines and related analogs as hsp90-inhibitors: Pyrazolopyrimidines and related analogs are described and demonstrated or predicted to have utility as Heat Shock Protein 90 (HSP90) inhibiting agents in the treatment and prevention of various HSP90 mediated disorders, e.g., proliferative disorders. Method of synthesis and use of such compounds are also described and claimed.... Agent: Wilson Sonsini Goodrich & Rosati

20070111997 - Triazolopyrimidines and related analogs as hsp90-inhibitors: Triazolopyrimidines and related compounds are described and demonstrated or predicted to have utility as Heat Shock Protein 90 (HSP90) inhibiting agents in the treatment and prevention of various HSP90 mediated disorders, e.g., proliferative disorders. Method of synthesis and use of such compounds are also described and claimed.... Agent: Wilson Sonsini Goodrich & Rosati

20070111999 - P-38 kinase inhibitors: Compounds and compositions for modulating the activity of p38 kinases are provided, including p38α, and p38β kinase. Methods for treating, preventing or ameliorating one or more symptoms of a p38 kinase mediated disease or disorder are also provided.... Agent: Novartis Corporate Intellectual Property

20070112000 - Chemical compounds: The use of compounds of formula (I) wherein variable groups are defined within; in the manufacture of medicaments for use in the inhibition of 11βHSD1, process for making them, certain compounds within the definition of the formula (I) and pharmaceutical compositions comprising them are described. The compounds are useful in... Agent: Morgan Lewis & Bockius LLP

20070112001 - Pyrrolidine derivatives: e

20070112002 - 1,2-di(cyclic)substituted benzene compounds:

20070112003 - 3,5-disubstituted-[1,2,4]-oxadiazoles and analogs as activators of caspases and inducers of apoptosis and the use of thereof: wherein Ar1, R2, A, B and D are defined herein. The present invention relates to the discovery that compounds having Formula I are activators of caspases and inducers of apoptosis. Therefore, the activators of caspases and inducers of apoptosis of this invention may be used to induce cell death in... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070112004 - 4'-thio-l-xyloy furanosyl nucleosides, precursors thereof, preparation and use thereof: wherein each R individually is H or acyl, Y is X, N3, NH2, monoalkylamino, or dialkylamino; Z is O or S; and X is selected from the group consisting of hydrogen, halo, hydroxy, alkoxy, alkyl, haloalkyl, alkenyl, haloalkenyl, alkynyl, amino, monoalkylamino, dialkylamino, thioaryl, thioalkyl, allylamino, cyano and nitro; tautomers thereof;... Agent: Connolly Bove Lodge & Hutz LLP

20070112005 - Fused bicyclic mtor inhibitors: e

20070112006 - Amine derivatives: Compounds of the formula (I), in which R1, R2, R3, R4, R5, B and X have the meanings indicated in claim 1, are inhibitors of tyrosine kinases, in particular TIE-2, and Raf kinases and can be employed, inter alia, for the treatment of tumours.... Agent: Millen, White, Zelano & Branigan, P.C.

20070112007 - Cyclohexyl-1, 4-diamine compounds: m

20070112008 - Saframycins, analogues and uses thereof: In another aspect, the present invention provides pharmaceutical compositions comprising a compound of formula (I) and a pharmaceutically acceptable carrier. In yet another aspect, the present invention provides methods for treating cancer comprising administering a therapeutically effective amount of a compound of formula (I) to a subject in need thereof.... Agent: Choate, Hall & Stewart/harvard University

20070112009 - 1-n-phenyl-amino-1h-imidazole derivatives and pharmaceutical compositions containing them:

20070112010 - Use of pde iii inhibitors for the treament of asymptomatic (occult) heart failure: The invention relates to the use of a phosphodiesterase type III (PDE III) inhibitor or Ca2+-sensitizing agent or a pharmaceutically acceptable derivative thereof for the preparation of a medication for the prolongation of time until onset of clinical symptoms in patients having an asymptomatic (occult) heart failure or for the... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070112011 - Substituted 1-propiolylpiperazine compounds, their preparation and use: in which X denotes N or C—R2, and n is an integer from 0 to 8, a method for producing such substituted 1-propiolylpiperazine compounds, pharmaceutical compositions containing such substituted 1-propiolylpiperazine compounds, and the use of such substituted 1-propiolylpiperazine compounds for modulating mGluR5 receptor activity or for treating or inhibiting pain... Agent: Crowell & Moring LLP Intellectual Property Group

20070112012 - Carbocyclic fused cyclic amines:

20070112013 - Method of modulating ion channel functional activity: The present invention relates generally to a method of retarding, reducing or otherwise inhibiting viral functional activity and, more particularly, to a method of reducing, retarding or otherwise inhibiting viral functional activity by down-regulating Vpu ion channel functional activity. Even more particularly, the present invention provides a method of treating... Agent: Buchanan, Ingersoll & Rooney PC

20070112014 - Therapeutic compounds based on pyrazolopyridine: e

20070112015 - Substituted dihydropyridines and methods of use: Compounds are provided that are modulators of the C5a receptor. The compounds are substituted dihydropyridines and are useful in pharmaceutical compositions, methods for the treatment of diseases and disorders involving the pathologic activtation of C5a receptors.... Agent: Townsend And Townsend And Crew, LLP

20070112016 - Novel 3-spirocyclic indolyl derivatives useful as orl-1 receptor modulators: The present invention is directed to novel 3-spirocyclic indolyl derivatives, pharmaceutical compositions containing them and their use in the treatment of disorders and conditions modulated by the ORL-1 receptor.... Agent: Philip S. Johnson Johnson & Johnson

20070112017 - Gaba receptor mediated modulation of neurogenesis: The instant disclosure describes methods for treating diseases and conditions of the central and peripheral nervous system by stimulating or increasing neurogenesis. The disclosure includes compositions and methods based on use of a GABA agent, optionally in combination with one or more other neurogenic agents, to stimulate or activate the... Agent: Townsend And Townsend And Crew, LLP

20070112018 - Treatment of peripheral arterial occlusive disease: The invention relates to the treatment of peripherial arterial occlusive disease.... Agent: Clark & Elbing LLP

20070112019 - 9-azabicyclo[3.3.1]nonane derivatives: e

20070112020 - Azaindolylidene derivatives as kinase inhibitors, process for their preparation and pharmaceutical compositions comprising them:

20070112021 - Novel crystalline forms of 2,3-dimethyl-8-(2,6-dimethylbenzylamino)-n-hydroxyethyl- imidazo [1,2-a] pyridine-6-carboxamide mesylate salt: The present invention relates to novel crystalline forms of 2,3-dimethyl-8-(2,6-dimethylbenzylamino)-N-hydroxyethyl-imidazo[1,2-a]pyridine-6-carboxamide mesylate salt and to mixture thereof. Further, the present invention also relates to processes for obtaining them, the use of said compounds for the treatment of gastrointestinal disorders, and pharmaceutical compositions containing them.... Agent: White & Case LLP Patent Department

20070112022 - Piperidine derivatives as ccr5 receptor modulators: Compounds of formula (I) wherein R1, R2, R3, A and n are as defined; and X is S(O)2NR4R5 or NR6S(O)2R7; compositions comprising them, processes for preparing them and their use in medical therapy (for example modulating CCR5 receptor activity in a warm blooded animal).... Agent: Fish & Richardson P.C.

20070112023 - N-biarylamides: The invention relates to N-biarylamides, methods for production and use thereof for the production of medicaments for the treatment and/or prophylaxis of diseases and for improvement in cognition, concentration power, learning power and/or memory.... Agent: Jeffrey M. Greenman

20070112024 - Crystal form of quinoline compound and process for its production: A method for producing a drug substance of crystalline pitavastatin calcium excellent in stability, is presented. In the production of a compound (pitavastatin calcium) represented by the formula (1): The water content is adjusted to a level of from 5 to 15%, and the crystal form is controlled to be... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070112026 - Carbostyril derivatives for accelerating salivation: Novel pharmaceutical composition for accelerating salivation and for prophylaxis and/or treatment of xerostornia, which comprises as an active ingredient a carbostyril compound of the formula (1), wherein R is a halogen atom, and the substitution position of the subsistuent on said carbostyril nucleus is the 3- or 4-position, and the... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20070112025 - Use of kynurenine-3-hydroxylase inhibitors for the preparation of medicaments for the treatment of l-dopa induced movement disorders, dyskinesias, drug addiction, pain and cataract: Use of kynurenine-3-hydroxylase inhibitors for the preparation of medicaments for the treatment of L-DOPA induced movement disorders, dyskinesias, drug addiction, pain and cataract.... Agent: Young & Thompson

20070112027 - Crystalline forms of a biphenyl compound: The invention provides crystalline forms of biphenyl-2-ylcarbamic acid 1-(2-{[4-(4-carbamoylpiperidin-1-ylmethyl)benzoyl]methylamino}ethyl)piperidin-4-yl ester, and pharmaceutically acceptable solvates thereof. The crystalline form can be a freebase, or a salt such as a diphosphate, monosulfate or dioxalate salt. The invention also provides pharmaceutical compositions comprising these crystalline compounds or prepared using these compounds; processes and... Agent: Theravance, Inc.

20070112028 - 2-hydroxymethyl-3,4,5-trihydroxy-1-benzilpiperidine derivatives as inhibitors of glucosylceramide: e

20070112029 - Piperidine compound and process for preparing the same: Disclosed are a novel piperidine compound represented by the general formula [I] below which has an excellent tachykinin receptor antagonizing activity and pharmacologically acceptable salts thereof. [I] In the formula, ring A represents an optionally substituted benzene ring; ring B represents an optionally substituted benzene ring; R1 represents an optionally... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20070112030 - Processes for preparing bicyclo [3.1.0] hexane derivatives, and intermediates thereto: Processes for the preparation of certain [3.1.0]hexane derivatives which are useful as mGluR agonists, and intermediates prepared during such processes.... Agent: Sughrue Mion, PLLC

20070112031 - Substituted phenylpiperidines with serotoninergic activity and enhanced therapeutic properties: Chemical syntheses and medical uses of novel inhibitors of the uptake of monoamine neurotransmitters and pharmaceutically acceptable salts and prodrugs thereof, for the treatment and/or management of psychotropic disorders, anxiety disorder, generalized anxiety disorder, depression, post-traumatic stress disorder, obsessive-compulsive disorder, panic disorder, hot flashes, senile dementia, migraine, hepatopulmonary syndrome, chronic... Agent: Knobbe Martens Olson & Bear LLP

20070112032 - Prevention and/or reduction of photoreceptor degeneration with retinoids: The present invention provides a method for reducing and/or preventing degeneration of photoreceptors in the eye of a human caused by radiation in the visible range which comprises administering to said mammal a retinoid compound having RARβ and/or RARδ-selective agonist activity.... Agent: Allergan, Inc.

20070112034 - 2-(benzimidazol-1-yl)-acetamide bisaryl derivatives: wherein n is 0 or 1; Ar1 represents a diradical derived from a 5- or-6-membered aromatic ring, optionally comprising 1-3 heteroatoms selected from N, O and S, said ring being optionally substituted with (C1-4)alkyl, (C1-4)alkyloxy, halogen, CF3 or cyano; Ar2 represents a 6-membered aryl ring, optionally comprising 1-3 nitrogen atoms,... Agent: Akzo Nobel Inc.

20070112033 - Beta-agonists, methods for the preparation thereof and their use as pharmaceutical compositions: wherein the groups R1 to R4 have the meanings given in ths claims and specification, the tautomers, racemates, enantiomers, diastereomers, solvates, hydrates, mixtures thereof, the prodrugs thereof and the salts thereof, particularly the physiologically acceptable salts thereof with inorganic or organic acids or bases, methods of preparing these compounds and... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070112035 - Substituted oxyarenes: The invention relates to compounds of formula (I), wherein A1, A2, R1, R2, R3, R4, R5, and Y have the meaning indicated in the description, methods and intermediate compounds for the production thereof, and the use thereof for controlling pests.... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070112036 - Opioid receptor antagonists: A compound of the formula (I); wherein the variables X1 to X10, R1 to R7 including R3′, E, W, v, y, z, A and B are as described, or a pharmaceutically acceptable salt, solvate, enantiomer, racemate, diastereomer or mixtures thereof, useful for the treatment, prevention or amelioration of obesity and... Agent: Eli Lilly & Company

20070112037 - Pyrazole derivatives: c

20070112038 - Heterocyclic inhibitors of mek and methods of use thereof: and pharmaceutically acceptable salts and prodrugs thereof, wherein R1, R2, R7, R8 and R9, W, X and Y are as defined in the specification. Such compounds are MEK inhibitors and useful in the treatment of hyperproliferative diseases, such as cancer and inflammation, in mammals, and inflammatory conditions. Also disclosed are... Agent: Hogan & Hartson LLP

20070112040 - Amino nicotinate derivatives as glucokinase (glk) modulators: The invention is related to novel compounds of Formula (I) or a salt, solvate or prodrug thereof, wherein R1, R2, R3, n and m are as described in the specification, useful in the treatment of a disease or condition mediated through glucokinase (GLK), such as type 2 diabetes. The invention... Agent: Morgan Lewis & Bockius LLP

20070112039 - Novel pharmaceutical salts and polymorphs of a factor xa inhibitor: The present invention provides for salts comprising a compound of Formula I and an acid that has activity against mammalian factor Xa. The present invention is also directed to methods of making the compound of Formula I.... Agent: Foley & Lardner LLP

20070112041 - Nicardipine injection composition: A nicardipine hydrochloride injection composition comprising sorbitol in amounts sufficient to stabilize the injection preparation and a physiologically and pharmaceutically acceptable buffer, in an amount effective to maintain the pH of the composition at about 3.0 to about 4.5.... Agent: Sughrue Mion, PLLC

20070112042 - Topical agent for application to the skin prior to luminous treatment: There is disclosed a topical agent in the form of a topical vasodilator for the application to the skin prior to luminous treatment, e.g. laser treatment, wherein said topical vasodilator in a suitable vehicle includes the active substance consisting of nicotinic acid (Niacin) in the range of 0.5-10.0% by weight... Agent: Antonelli, Terry, Stout & Kraus, LLP

20070112043 - Acylated and non-acylated imidazo[2,1-b]-1,3,4,-thiadiazole-2-sulfonamides, and uses thereof: This invention relates to novel compounds of Formula (I): and the use of compounds of Formula (I) in the treatment of neuronal disorders of the central and peripheral nervous systems and for the treatment of proliferative diseases, such as cancer.... Agent: Aegera Therapeutics Inc.

20070112044 - Thiadiazoline derivative: (wherein Z represents a sulfur atom and the like, R1 represents substituted or unsubstituted lower alkynyl and the like, R2 represents a hydrogen atom and the like, R3 represents substituted or unsubstituted lower alkyl and the like, and R4 represents substituted or unsubstituted aryl and the like), and the like... Agent: Greenblum & Bernstein, P.L.C

20070112045 - Triazole ppar modulators: The present invention is directed to compounds represented by the following structural formula, Formula (I): wherein: (a) X is selected from the group consisting of a single bond, O, S, S(O)2 and N; (b) U is an aliphatic linker; (c) Y is selected from the group consisting of O, C,... Agent: Eli Lilly & Company

20070112046 - 2'-methyl-5'-(1,3,4-oxadiazol-2-yl)-1,1'-biphenyl-4-carboxamide derivatives and their use as p38 kinase inhibitors: e

20070112047 - Substituted 1h-benzimidazole-4-carboxamides are potent parp inhibitors:

20070112048 - Broad spectrum antibacterial compounds: Disclosed herein are methods of inhibiting, reducing or preventing growth of or destroying bacteria of at least one bacterial strain which comprises contacting the bacteria with the compounds disclosed herein. Also disclosed are methods of treating, inhibiting or preventing an infection or intoxication caused by bacteria of at least one... Agent: Office Of The Staff Judge Advocate (sks) U.s. Army Med. Research & Material Command

20070112049 - Small molecule inhibitors of botulinum neurotoxins: Disclosed herein are methods of inhibiting the activity of Botulinum neurotoxin A metalloprotease with the compounds disclosed herein. Also disclosed are methods of treating, inhibiting or preventing intoxication caused by bacteria of at least one bacterial strain in a subject, and pharmaceutical and cosmetic compositions comprising the compounds disclosed herein.... Agent: Office Of The Staff Judge Advocate (sks) U.s. Army Med. Research & Material Command

20070112051 - Cyclopentane heptan(ene)oic acid, 2-heteroarylalkenyl derivatives as therapeutic agents: or derivatives thereof, or pharmaceutically acceptable salts, tetrazoles, or prodrugs of compounds of the structure or derivatives thereof, said derivatives being described in detail herein. Also disclosed herein are methods of treating diseases or conditions, including glaucoma and elevated intraocular pressure. Compositions and methods of manufacturing medicaments related thereto are... Agent: Allergan, Inc.

20070112050 - Hmgcoa reductase inhibitor combinations and uses thereof: The invention provides a compound comprising a first pharmacological moiety connected to at least a second pharmacological moiety through a physiologically labile linker, or a salt thereof. The invention also provides a method of reducing cardiovascular disease or cardiovascular disease-related conditions in an individual. The method involves administering to an... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20070112052 - Methods and compositions for treating headache pain with topical nsaid compositions: Methods and compositions are provided for treating a host suffering from headache pain. In the subject methods, a topical NSAID formulation is applied to a keratinized skin site proximal to the pain associated with the headache pain, e.g., a keratinized skin surface of the head, such as the forehead, temple,... Agent: Bozicevic, Field & Francis LLP

20070112053 - Pharmaceutical compositions and methods using temozolomide and a protein kinase inhibitor: The present invention provides formulations, kits, and methods useful for treating a cell proliferative disorder.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20070112054 - Process for the preparation of indoles: A process for the preparation of indoles, e.g. 1,2,3,9-tetrahydro-carbazol-4-one and derivatives thereof.... Agent: Hoffmann-la Roche Inc. Patent Law Department

20070112055 - Crystalline forms of almotriptan and processes for their preparation: Crystalline forms of almotriptan and almotriptan malate are disclosed. Processes for their preparation and pharmaceutical compositions containing the same are also disclosed. The amorphous form of almotriptan malate, processes for its preparation and a pharmaceutical composition containing the same are also disclosed... Agent: M. Carmen & Associates, PLLC

20070112058 - Novel prostamides for the treatment of glaucoma and related diseases: Disclosed herein are compositions comprising an amide related to a prostaglandin and an amine wherein the amine is selected from the group consisting of epinephrine, dopamine, serotonin, and analogs or prodrugs thereof. Also disclosed are certain chemical compounds, pharmaceutical compositions, and methods of treating glaucoma.... Agent: Allergan, Inc.

20070112057 - Polymorphic forms of tegaserod maleate: Provided are crystalline forms of tegaserod maleate and processes for the preparation thereof.... Agent: Kenyon & Kenyon LLP

20070112056 - Stable modifications of tegaserod hydrogen maleate: The present invention relates to crystalline forms of tegaserod hydrogen maleate, their use, in pharmaceutical compositions useful in the treatment of irritable bowel syndrome, gastro-esophageal reflux diseases, functional dyspepsia, chronic constipation or diarrhea, and their production.... Agent: Novartis Corporate Intellectual Property

20070112060 - Acetylated amino acids as anti-platelet agents, nutritional and vitamin supplements: This invention relates to pharmaceutical compounds and nutritional supplements that are acetylated derivatives of naturally occurring amino acids and acetylated derivatives of peptides derived from naturally occurring amino acids containing hydroxyl groups. They are as useful as anti-platelet drugs, and as nutritional supplements.... Agent: Scully Scott Murphy & Presser, PC

20070112059 - Cyanopyrrolidine derivatives: i

20070112061 - Heat- or singlet oxygen-generating agents and cancer treatment compositions comprising organic peroxide or chemiluminescent compound: The present invention provides a heat-generating agent or singlet oxygen-generating agent effective as a new cancer treatment agent which, unlike an anticancer agent based on an alkylating agent such as MMC, uses the action of heat and/or singlet oxygen to kill cancer cells and reduce the burden on patients. A... Agent: Frishauf, Holtz, Goodman & Chick, PC

20070112062 - Use of dialkylketone peroxide as biocidal, sterilizing, antiseptic, disinfecting and anti-parasitic agent: The invention presented here establishes the use of a dialkyl ketone peroxide as a sterilizing, antiseptic, disinfecting and anti-parasitic agent, with no apparent toxicity nor ecotoxicity, and a very wide spectrum of activity in terms of the type of organisms on which it acts (bacteria, virus, fungi, spores, mycobacteria, protozoa,... Agent: Ostrolenk Faber Gerb & Soffen

20070112063 - Benzopyran derivatives, method of production and use thereof: e

20070112064 - Nucleic acid antioxidant compositions, methods for obtaining such compositions and formulations thereof: Compositions containing purified nucleic acid wherein the nucleic acid acts as an antioxidant. Such compositions also include materials subject to oxidative damage such as antioxidants, vitamins, lipids, foods and pharmaceuticals. The invention also includes methods for preparing such compositions. These methods include dissolving the nucleic acid and a hydrophilic material... Agent: Baker Botts L.L.P. Patent Department

20070112066 - Remedy: The present invention provides a novel chalcone compound, its derivative or a salt thereof, each having a suppressive action of NO production or an inhibitory action of aldose reductase. In addition, the present invention provides a medicament, a food, a beverage or a feed having a therapeutic or prophylactic effect... Agent: Birch Stewart Kolasch & Birch

20070112065 - Use of l-butylphthalide in the manufacture of medicaments for prevention and treatment of cerebral infarct: The present invention discloses the use of L-butylphthalide of formula (I) in the manufacture of medicaments for the prevention and treatment of cerebral infarct, especially induced by focal cerebral ischemia.... Agent: Kenyon & Kenyon LLP

20070112067 - Nitrosated and nitrosylated prostaglandins, compositions and methods of use: The invention describes novel nitrosated and/or nitrosylated prostaglandins, and novel compositions comprising at least one nitrosated and/or nitrosylated prostaglandin, and, optionally, at least one compound that donates, transfers or releases nitric oxide, elevates endogenous levels of endothelium-derived relaxing factor, stimulates endogenous synthesis of nitric oxide or is a substrate for... Agent: Wilmerhale/nitromed

20070112068 - Nitrile compound and its use in pest control: The present invention provides a nitrile compound represented by the formula (I): wherein R represents C1-C4 fluoroalkyl, Q represents halogen, C1-C11 alkyl optionally substituted with halogen, C2-C6 alkenyl group optionally substituted with halogen, C2-C6 alkynyl optionally substituted with halogen, C3-C7 cycloalkyl optionally substituted with halogen or (C3-C7 cycloalkyl optionally substituted... Agent: Wenderoth, Lind & Ponack, L.L.P.

20070112069 - Adjuvant formulation for enhancing the fungicidal efficacy and fungicidal composition containing same: Disclosed in this invention is an adjuvant formulation for enhancing the fungicidal efficacy of KNF-1001 or KNF-1002 against plant diseases comprising an adjuvant selected from the group consisting of a polyoxyethylene-based nonionic surfactants which has an aliphatic alcohol, a fatty acid or triacyl glyceride as a lipophilic moiety containing at... Agent: Anderson, Kill & Olick, P.C.

20070112070 - Novel biaromatic compounds which activate ppary-type receptors and cosmetic/pharmaceutical compositions comprised thereof: s

20070112071 - Use of a fatty acid composition comprising at least one of epa and dha or any combinations thereof: A method is disclosed for treatment and prevention of obesity, an overweight condition or for controlling body weight reduction, wherein an effective amount of a fatty acid composition comprising at least one of (all-Z omega-3)-5,8,11,14,17-eicosapentaenoic acid (EPA) and (all-Z omega-3)-4,7,10,13,16,19-docosahexaenoic acid (DHA) or any combinations thereof, is administered to a... Agent: Harness, Dickey & Pierce, P.L.C

20070112072 - Quinoneimines of malonic acid diamides: wherein R1 is O or S when double bonded to the ring or is OH, SH, or a protected equivalent, when single bonded to the ring, R2 is hydrogen or more preferably an C1-C10 organic group attached by a carbon atom, X is H, O, OO, S or SS R3... Agent: Bacon & Thomas, PLLC

20070112073 - Protriptyline hydrochloride crystalline form: Protriptyline hydrochloride crystalline Form B, a process for its preparation, a pharmaceutical composition containing it the use thereof.... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20070112074 - Tramadol recovery process: A process for the resolution of isomeric tramadol mixtures comprising: providing a purification stock comprising both cis and trans tramadol; contacting the purification stock with an acid under conditions effective to form an acid salt of the cis and trans tramadol in the purification stock; and separating the cis tramadol... Agent: Law Offices Of Albert Wai-kit Chan, LLC

20070112076 - Methods and materials for treating retinopathy: The present invention is directed to topical ophthalmic compositions and methods for treating retinopathy.... Agent: Marshall, Gerstein & Borun LLP

20070112075 - Stable pharmaceutical formulations containing escitalopram and bupropion: The present invention relates to stable pharmaceutical formulations of escitalopram and bupropion and their use for the treatment a central nervous system disorder, such as a mood disorder (e.g., major depressive disorder) or an anxiety disorder (e.g., general anxiety disorder, social anxiety disorder, post traumatic stress disorder, or panic disorder).... Agent: Darby & Darby P.C.

20070112077 - Des-c,d analogs of 1alpha,25-dihydroxy-19-norvitamin d3: Des-C,D 2-methylene-19-norvitamin D3 analogs are provided including compounds of formula 1, in which R1 is a straight or branched chain alkyl or alkylene group having from 8 to 27 carbons and bearing an Oy3 group; and y1, y2 and y3 are independently selected from H or hydroxy-protecting groups. Such compounds... Agent: Foley & Lardner LLP

20070105752 - Inhibition of the src kinase family pathway as a method of treating hbv infection and hepatocellular carcinoma: The present invention relates to therapeutic protocols and pharmaceutical compositions designed to target HBx mediated activation of Src kinase, members of the Src tyrosine kinase family and components of the Src kinase family signal transduction pathways for the treatment of HBV infection and related disorders and diseases, such as HCC.... Agent: Jones Day

20070105750 - Novel plasma protein affinity tags: Method for increasing half-life of therapeutic agents in plasma and novel polypeptide derivatives.... Agent: Novo Nordisk, Inc. Patent Department

20070105751 - Use of nf-kb inhibition in combination therapy for cancer: The use of NF-κB inhibitors to enhance the cytotoxic effects of chemotherapy or radiation therapy in the treatment of neoplastic conditions is described.... Agent: Myers Bigel Sibley & Sajovec

20070105753 - Use of dipyridamole or mopidamole for treatment and prevention of thrombo-embolic diseases and disorders caused by excessive formation of thrombin and/or by elevated expression of thrombin receptors: A method of treatment of the human or non-human animal body for treating or preventing disorders caused by elevated thrombin or elevated thrombin receptor expression is disclosed, for example thromboembolic disease vascular syndromes, or proliferative diseases, which method comprises administering to a human or non-human animal body in need of... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070105755 - One pot desialylation and glycopegylation of therapeutic peptides: The present invention provides conjugates between peptides and PEG moieties. The conjugates are linked via an intact glycosyl linking group that is interposed between and covalently attached to the peptide and the modifying group. The conjugates are formed from both glycosylated and unglycosylated peptides by the action of a glycosyltransferase.... Agent: Morgan, Lewis & Bockius LLP (sf)

20070105754 - Pharmaceutical composition to prevent and treat epithelial wounds, immunomodulating pharmaceutical composition, pharmaceutical composition, insecticide, insecticide composition insecticide use of lectin km+ to treat cicatrizations, use of lectin km+ to pr: The invention deals with a pharmaceutical composition comprising lectin KM+ to prevent and heal epithelial wounds. The invention also comprises the use of lectin KM+, obtained from the plant (Artocarpus integrifolia) or recombinant (expression heterologue) to prepare medicaments.... Agent: Thomas A. O'rourke Bodner & O'rourke

20070105756 - Vancomycin formulations having reduced amount of histamine: A pharmaceutical composition containing vancomycin that has been treated to remove histamine and a method of removing histamine from a vancomycin preparation containing histamine.... Agent: Brian R. Woodworth

20070105757 - Vancomycin formulations having reduced amount of histamine: Vancomycin composition treated to remove histamine and a method of removing histamine from vancomycin. The invention also includes an isolated polynucleotide sequence including an isolated polynucleotide sequence of histidine decarboxylase from Amycolatopsis orientalis. The vancomycin composition of the present invention is used to redue the incidence of Red Man Syndrome,... Agent: Brian R. Woodworth

20070105758 - Vancomycin formulations having reduced amount of histamine: A time-released formulation of vancomycin. The invention also includes a vancomycin composition having a reduced level of histamine and a process for reducing the level of histamine in a vancomycin composition. The invention also includes a pharmaceutical composition containing vancomycin that reduces the incidence of Red Man Syndrome, phlebitis, and... Agent: Brian R. Woodworth

20070105759 - Melanocortin receptor 4 (mc4) agonists and their uses: The present invention relates to peptide agonists of the MC4 receptor, and as such are useful in the treatment of disorders responsive to the activation of this receptor, such as obesity, diabetes mellitus and male and/or female sexual dysfunction.... Agent: Eli Lilly & Company

20070105760 - Process for the preparation of echinocandin derivatives: R being as defined in the description as well as their salts, the intermediates, the use of the dihydrochloride as a medicament and the pharmaceutical compositions containing them. The process for preparing formula (I) leads to greater than 50% yield of isomer A, and its intended use, e.g. as an... Agent: Harness, Dickey & Pierce, P.L.C

20070105761 - Methods, compositions, and kits for the treatment of opthalmic disorders: The invention features methods, kits, and compositions for the treatment of ophthalmic disorders. The compositions include a corticosteroid in combination with a non-steroidal immunophilin-dependent immunosuppressant.... Agent: Clark & Elbing LLP

20070105771 - Anti-cd26 antibodies and methods of use thereof: The present invention provides novel anti-CD26 antibodies and other, related polypeptides, as well as novel polynucleotides encoding the antibodies and polypeptides. The invention also provides methods of making the antibodies and polypeptides. Compositions and cells comprising the antibodies or polypeptides are further provided. Methods of using the antibodies and/or polypeptides,... Agent: Morrison & Foerster LLP

20070105765 - Compositions comprising a fragment of the herpesviral protein vp22 for delivery of substances to cells: This invention relates to aggregated compositions comprising short peptides, or sub-sequences, of full length VP22 protein for delivery of substances such as nucleic acids and proteins into cells. The invention relates to such compositions in themselves, and to methods for their manufacture and use.... Agent: Nixon & Vanderhye, PC

20070105776 - Compositions of active wnt protein: Compositions of purified biologically active Wnt proteins are provided. Wnt proteins are found to be hydrophobic and post-translationally modified by addition of a lipid moiety at a conserved cysteine residue. Methods for isolation of Wnt utilize detergents that maintain the solubility of the modified protein.... Agent: Bozicevic, Field & Francis LLP

20070105763 - Connective tissue derived polypeptides: The present invention relates to compositions comprising one or more connective tissue derived polypeptides having a molecular weight of less than 30,000 Da that are capable of tolerising individuals to antigenic components of cartilage and prevent the appearance of and/or treat symptoms of arthritis and other musculoskeletal degenerative conditions. The... Agent: Merchant & Gould PC

20070105777 - Cytokine receptor zcytor17: Novel polypeptides, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed for zcytor17, a novel cytokine receptor. The polypeptides may be used within methods for detecting ligands that stimulate the proliferation and/or development of hematopoietic, lymphoid and myeloid cells in vitro and in vivo. Ligand-binding receptor polypeptides can... Agent: Zymogenetics, Inc. Intellectual Property Department

20070105768 - Dry recombinant human alpha 1-antitrypsin formulation: A dry powder composition comprises recombinant human alpha 1-antitrypsin (rAAAT).... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20070105772 - Induction of apoptosis by cellular stress: The invention provides methods of screening to identify compounds that modulate the ability of a protein to translocate to the mitochondria when a cell is subjected to cellular stress. Such compounds can be useful to modulate the level of apoptosis in a cell. For example, compounds identified according to the... Agent: Fish & Richardson PC

20070105775 - Methods for fusion polypeptide delivery into a cell: The present invention relates to methods for delivery of fusion polypeptides into cells. Methods are provided for local delivery of fusion polypeptides, e.g., through the skin, eye and the airway, to prevent allergic inflammation, airway hyper-responsiveness and to block T cell activation. Methods for delivery of fusion polypeptides to suppress... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070105769 - Methods of treating tissue defects: Methods of treating tissue defects, including defects such as bone fractures, vertebrae fusions, and spinal disc repair, using electric or electromagnetic fields and growth factors. In various embodiments, the present invention provides methods for the treatment of a human or other mammal subject in need thereof, by administering electric stimulation... Agent: Harness, Dickey & Pierce, P.L.C

20070105767 - Modulation of the interaction of muc1 with muc1 ligands: The present invention provides for chimeric proteins comprising a MUC1 extracellular (MUC1-EC) polypeptide and a carrier polypeptide that function as traps for MUC1 ligands.... Agent: Fulbright & Jaworski L.L.P.

20070105766 - Modulators of the abc transporter family and methods for their use: An isolated factor derived from the bacterium Pseudomonas aeruginosa that reduces expression of ABC transmembrane proteins and active fragments and mimetics thereof are provided. Also provided is a method for inhibiting expression of ABC transmembrane proteins in cells by administering to the cells the isolated factor or active fragment or... Agent: Licata & Tyrrell P.C.

20070105762 - Non-activated polypeptides having a function of tissue regeneration and method for preparing the same: Non-activated tissue-regeneration polypeptides (TRPs) and the preparation methods thereof are disclosed. The TRPs contain: a protein transduction domain (PTD) making the polypeptides to permeate a cell membrane without cell membrane receptors; a furin activation domain (FAD) which has at least one proprotein convertase cleavage site and which can be cleaved... Agent: Intellectual Property / Technology Law

20070105764 - Peptide protein translation inhibitor and the use thereof for protein translation control: A peptide protein translation inhibitor has a size greater than 250 amino acids and it includes an amino acid sequence which is at least for 85% identical to an amino acid sequence SEQ ID No1. It also relates to a fusion polypeptide which specifically inhibits an interesting target polynucleotide translation,... Agent: Young & Thompson

20070105773 - Pharmaceutical composition comprising trkaig2 for use in the prevention and/or treatment of cancer: This invention relates to the treatment of cancer and is particularly, though not exclusively concerned with the treatment of pancreatic cancer. In particular the invention related to the use of TrkAIg2 in the preparation of a medicament for the treatment and/or prevention of cancer in a patient.... Agent: Hunton & Williams LLP Intellectual Property Department

20070105770 - Transglutaminase mediated conjugation of peptides: Methods for conjugating peptides are provided comprising i) reacting a peptide with a first compound comprising a functional group in the presence of a transglutaminase capable of incorporating said compound into the peptide to form a transaminated peptide, and ii) reacting said transaminated peptide with e.g. a functionalized polymer capable... Agent: Novo Nordisk, Inc. Patent Department

20070105774 - Use of calcitonin and calcitonin-like peptides to treat and prevent multiple sclerosis: Methods for treating and preventing multiple sclerosis by administering to a patient an effective amount of calcitonin, calcitonin-like peptides or calcitonin mimetics to a patient. Additionally, 1,25-dihydroxyvitamin D analogs can be used in combination with the calcitonin, calcitonin-like peptides or calcitonin mimetics.... Agent: Quarles & Brady LLP

20070105779 - Isolated, ssx-2 and ssx-2 related peptides useful as hla binders and ctl epitopes, and uses thereof: The invention related to peptides which bind to HLA molecules and are reactive with T cells that also react with complexes of HLA-A2 molecules and the peptide of SEQ ID NO: 17. Various uses of the peptides are disclosed.... Agent: Fulbright & Jaworski, LLP

20070105778 - Methods of screening molecular libraries and active molecules identified thereby: The present invention provides a peptide having 2 to 10 amino acids or a derivative thereof which is able to restore wild type function of human p53, for use in therapy; and a method of screening a library of molecules for the ability of members of that library to restore... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20070105780 - Therapeutic agent for inos generating illness: Treatment of SIRS, sepsis, severe sepsis and septic shock in a mammalian subject in which iNOS is present by decreasing the proteolytic cleavage of the iNOS protein using a protease inhibitor is described.... Agent: Theodore J. Bielen Jr.

20070105781 - Inhibitors of serine proteases: e

20070105783 - Process for the manufacture of peptide facilitators of reverse cholesterol transport: The embodiments provide solution phase processes for making amino acid-derived compositions that enhance reverse cholesterol transport in mammals. The compositions are suitable for oral delivery and useful in the treatment and/or prevention of disease conditions associated with hypercholesterolemia.... Agent: Knobbe Martens Olson & Bear LLP

20070105782 - Protectant combinations for reducing toxicities: Pharmaceutical compositions and methods of preventing or reducing hearing or balance loss and damage to ear cells in patients who have been exposed to toxic levels of noise and other toxic insults are provided. These methods comprise administering an effective amount of a protectant combination or composition comprising two or... Agent: Senniger Powers

20070105786 - Compounds for enzyme inhibition: Peptide-based compounds including heteroatom-containing, three-membered rings efficiently and selectively inhibit specific activities of N-terminal nucleophile (Ntn) hydrolases associated with the proteasome. The peptide-based compounds include an epoxide or aziridine, and functionalization at the N-terminus. Among other therapeutic utilities, the peptide-based compounds are expected to display anti-inflammatory properties and inhibition of... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20070105785 - Methods of treating non-inflammatory gastrointestinal tract disorders using cav2.2 subunit calcium channel modulators: A method is provided for using Cav2.2 subunit calcium channel modulators to treat non-inflammatory gastrointestinal tract disorders.... Agent: Alston & Bird LLP

20070105784 - Substituted quinolines for the treatment of cancer: Compounds of formula G1-L-G2, where -G1 is a radical structurally close to cryptolepine, -L- is a single covalent bond or a covalent linking biradical selected from (CH2)rNR′″(CH2)s and —(CH2)rNR′″(CH2)SNR″″(CH2)t—, —R′″ and —R″″ are radicals, same or different, selected from the group consisting of H and (C1-C3)-alkyl; r, s and t... Agent: Hensley Kim & Edgington, LLC

20070105787 - Use of ribose in recovery from anaesthesia: D-Ribose is administered before and after general anaesthesia to reduce the time to recover from the effects of general anaesthesia. Preferably, pyrogen-free D-Ribose is administered intravenously during general anaesthesia and the interval post-anaesthesia before oral administration can be resumed. D-Glucose may be co-administered to reduce the effect of hypoglycemia that... Agent: Kathleen R. Terry

20070105788 - Azithromycin for treatment of granulomatous rosacea: Systemic administration of azithromycin for a period of at least two weeks is effective in ameliorating the signs and symptoms of granulomatous rosacea, a variant form of rosacea that often fails to respond favorably to treatment regimens that are effective against forms of rosacea other than granulomatous rosacea.... Agent: Howard Eisenberg, Esq.

20070105789 - Combinatorial chemotherapy treatment using na+/k+ atpase inhibitors: The reagent, pharmaceutical formulation, kit, and methods of the invention provides a new approach to alleviate or eliminate certain negative effects associated with the use of certain cancer treatment agents (e.g. chemotherapy therapeutics, etc.) or regimens (e.g. radio therapies, etc.), including stimulation of the hypoxic stress response in tumor cells.... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20070105790 - Pancreatic cancer treatment using na+/k+ atpase inhibitors: The reagent, pharmaceutical formulation, kit, and methods of the invention provides a new approach for treating pancreatic cancers. The invention provides the use of Na+e/K+-ATPase inhibitors, such as cardiac glycosides (e.g. ouabain and proscillaridin, etc.), either alone or in combination with other standard therapeutic agents (chemo- or radio-therapies, etc.) for... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20070105791 - Method of treating clostridium difficile-associated diarrhea: A method of treating a disease or disorder caused by the presence of a bacterium selected from the group consisting Clostridium species, Staphylococcus species, Enterococcus species and combinations thereof comprising administering to a patient in need an effective amount of a mixture, which comprises tiacumicin B, lipiarmycin A4, and at... Agent: Kent H. Cheng

20070105792 - Administration of dna methylation inhibitors for treating epigenetic diseases: Methods are provided for treating patients with epigenetic diseases, especially those associated with aberrant DNA methylation such as hematological disorders and cancer. By administering a DNA methylation inhibitor to the patients following unique dosing regimens, the disease can be efficaciously treated with reduced toxic side effects.... Agent: Wilson Sonsini Goodrich & Rosati

20070105793 - Compositions and methods using nicotinic acid for treatment of hypercholesterolemia, hyperlipidemia nd cardiovascular disease: An improved method and composition for the treatment of hyperlipidemia, hypercholesterolemia, and hypertriglyceridemia as well as other disease states, particularly cardiovascular problems, uses a multiple release system that provides an immediate release of nicotinic acid followed by a subsequent release of nicotinic acid from the hydrolysis of a compound that... Agent: Koppel, Patrick & Heybl

20070105797 - Antisense inhibition of laminin-8 expression to inhibit human gliomas: Using gene array technology, we observed that an increase of the α4 chain-containing Laminin-8 correlated with poor prognosis for patients with brain gliomas. We established that inhibition of Laminin-8 expression by a new generation of highly specific and stable antisense oligonucleotides (Morpholino™) against chains of Laminin-8 could slow or stop... Agent: Davis Wright Tremaine LLP

20070105799 - Codon-optimized polynucleotide-based vaccines against bacillus anthracis infection: The invention is related to polynucleotide-based anthrax vaccines. In particular, the invention is plasmids operably encoding Bacillus anthracis antigens, in which the naturally-occurring coding regions for the B. anthracis antigens have been modified for improved translation in human or other mammalian cells through codon optimization. In certain embodiments, the coding... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070105806 - Compositions and methods for inhibiting expression of nav1.8 gene: The invention relates to a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of the Nav1.8 gene (Nav1.8 gene), comprising an antisense strand having a nucleotide sequence which is less that 25 nucleotides in length and which is substantially complementary to at least a part of the Nav1.8 gene. The... Agent: Fish & Richardson PC

20070105802 - Compositions and methods for modulating and monitoring neurotransmitter receptor populations: Compositions and methods modulating neurotransmitter receptor populations are provided.... Agent: Jane Massey Licata Licata & Tyrrell P.C.

20070105804 - Endosomolytic polymers: Processes are described for obtaining high levels of gene expression in primates after injection of nucleic acid to the liver via the lumen of the hepatic vein. The described process results in high level of gene expression with transient increases in liver enzymes.... Agent: Mirus Corporation

20070105805 - G-rich polynucleotides for the treatment of huntington's disease: The present invention relates to oligonucleotide compositions and therapeutic uses thereof to modify protein-protein interactions. In particular, the invention relates to the use of a guanidine-rich oligonucleotides to disrupt disease-causing protein aggregates, for example, Huntington's Disease (HD) protein aggregates... Agent: Mccarter & English, LLP Basil S. Krikelis

20070105795 - Gene expression suppression agents: A method is provided for making gene suppression agents to be used in eukaryotic cells by using a recombinant DNA construct containing at least one transcriptional unit compromising a transcriptional promoter, a template sequence for making a RNA molecule, and a transcriptional terminator. Mechanisms of the RNA mediated gene suppression... Agent: Butzel Long

20070105800 - Immunostimulatory properties of oligonucleotide-based compounds comprising modified immunostimulatory dinucleotides: The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides an immunostimulatory oligonucleotides for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunostimulatory oligonucleotides of the invention preferably comprise novel... Agent: Joseph C. Zucchero Keown & Associates

20070105801 - Immunostimulatory properties of oligonucleotide-based compounds comprising modified immunostimulatory dinucleotides: The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides an immunostimulatory oligonucleotides for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunostimulatory oligonucleotides of the invention preferably comprise novel... Agent: Joseph C. Zucchero Keown & Associates

20070105794 - Immunotherapy: The invention provides an improved method of inducing an immune response against targeted cells. Using gene therapy to express both a toxin or prodrug converting enzyme as a means of killing a targeted cell type and also stress response protein (in particular, a heat shock protein) enhances the subsequent immune... Agent: Rader, Fishman & Grauer PLLC

20070105808 - Inhibition of histone deacetylase: The invention relates to the inhibition of histone deacetylase expression and enzymatic activity and, in particular, to the inhibition of a specific histone deacetylase. The invention also relates to compositions comprising antisense oligonucleotides and methods of using the same to inhibit a histone deacetylase. Also disclosed are methods for identifying... Agent: Keown & Associates

20070105796 - Method for inhibiting telomerase activity and inhibitor thereof: The present invention provides a method for inhibiting the activation of telomerase and an agent for inhibiting the activation of telomerase, a method for inhibiting telomerase activity and an agent for inhibiting telomerase activity, a method for preventing and/or a method for treating a cancer disease, an agent for preventing... Agent: Kilyk & Bowersox, P.l.l.c.

20070105798 - Method of converting base in dna sequence: A method of converting one or more bases in a target DNA sequence in a cell comprising transferring a single-stranded DNA fragment having 300 to 3,000 bases, which is prepared from a single-stranded circular DNA, is homologous with the target DNA sequence and contains the base(s) to be converted, into... Agent: Wenderoth, Lind & Ponack, L.L.P.

20070105803 - Methods and compositions for treating neurological disease: This invention relates to methods and compositions for treating neurological disease, and more particularly to methods of delivering iRNA agents to neural cells for the treatment of neurological diseases.... Agent: Fish & Richardson PC

20070105809 - Modulators of coagulation factors with enhanced stability: The invention provides improved nucleic acid ligands with enhanced stability that inhibit coagulation and improved modulators of the nucleic acids to provide ideal modulators of coagulation. These improved nucleic acids and modulators are particularly useful for inhibiting coagulation in a host undergoing a therapeutic regime such as surgery or coronary... Agent: King & Spalding LLP

20070105807 - Splice switch oligomers for tnf superfamily receptors and their use in treatment of disease: Methods and compositions are disclosed for controlling expression of TNF receptors (TNFR1 and TNFR2) and of other receptors in the TNFR superfamily using compounds that modulate splicing of pre-mRNA encoding these receptors. More specifically these compounds cause the removal of the transmembrane domains of these receptors and produce soluble forms... Agent: Thelen Reid Brown Raysman & Steiner LLP

20070105812 - Lipid analogs for inhibiting hiv-1 activity: The invention relates to methods of treating viral infections, and in particular hepatitis B virus. The method comprises administering to a subject in need of such treatment an infection-controlling amount of a phospholipid or phospholipid derivative to inhibit the activity of the viral infection.... Agent: Morgan Lewis & Bockius LLP

20070105811 - Lipid analogs for inhibiting the activity of hepatitis b antigen: The invention relates to methods of treating viral infections, and in particular hepatitis B virus. The method comprises administering to a subject in need of such treatment an infection-controlling amount of a phospholipid or phospholipid derivative to inhibit the activity of the viral infection.... Agent: Morgan Lewis & Bockius LLP

20070105810 - Therapeutics: wherein: R1 comprises a carbonyl group and R2 is a hydrocarbyl group; optionally wherein said ring is further substituted; or a pharmaceutically acceptable salt thereof; in the manufacture of a medicament for use in one or more of: modulating the release of intracellular calcium from a store controlled by nicotinic... Agent: Frommer Lawrence & Haug

20070105815 - Biocompatible poly-beta-1-4-n-acetylglucosamine: The present invention relates to a purified, easily produced poly-β-1→4-N-acetylglucosamine (p-GlcNAc) polysaccharide species. The p-GlcNAc of the invention is a polymer of high molecular weight whose constituent monosaccharide sugars are attached in a β-1→4 conformation, and which is free of proteins, and substantially free of single amino acids, and other... Agent: Jones Day

20070105813 - Disialoundecasaccharide chain asparagine/fatty acid amide and medical drug containing the same: An asparagine-linked disialoundecaoligosaccharide-fatty acid amide, a drug containing the same, and a drug containing an asparagine-linked disialoundecaoligosaccharide.... Agent: Kubovcik & Kubovcik

20070105814 - Methods and compositions associated with administration of an extract of ganoderma lucidum: The present disclosure provides methods for increasing the lipopolysaccharide-induced secretion of IL-1 by macrophages, for increasing serum levels of IL-1 in a mammal, for increasing the serum level of IL-1 receptor antagonist (IL-1Ra) in a mammal, for increasing the secretion of IL-1 by a monocyte, for increasing the secretion of... Agent: Greenberg Traurig LLP

20070105816 - Edulcorant compositions: An edulcorating composition containing 5 to 20% by weight of inulin or fruitoligosaccharides, from 2 to 15% by weight of jellying fibres, 0.5 to 5% by weight of cellulose and 60 to 92.5% by weight of monosaccharides or disaccharides.... Agent: Stephen M Nipper Dykas Shaver & Nipper

20070105818 - Modafinil compound and cyclodextrin mixtures: Mixtures of a modafinil compound with a cyclodextrin, methods for their use, and compositions thereof are disclosed, along with complexes comprising a modafinil compound and a cyclodextrin which are taste-masked and suitable for oral consumption in an aqueous solution.... Agent: Cephalon, Inc.

20070105817 - Use of cicletanine and other furopyridines for treatment of systolic-predominant hypertension, isolated systolic hypertension, elevated pulse pressure, and general hypertension: This invention provides therapeutic compositions of cicletanine and other furopyridines for the treatment of, elevated pulse pressure or isolated systolic hypertension, as well as general hypertension, in monotherapy and in combined therapy with other anti-hypertensive agents (such as organic and inorganic nitrogen donors, calcium channel blockers, diuretics, beta blockers, angiotensin... Agent: Greenberg Traurig, LLP (sv2)

20070105819 - Cb-1 modulating compounds and their use: Disclosed herein is a compound of Formula (I). Also disclosed herein is a method of modulating the activity of a cannabinoid receptor using a compound of Formula (I). Furthermore, disclosed herein is a method of treating a disease or condition that would be alleviated, improved or prevented by administration of... Agent: Knobbe Martens Olson & Bear LLP

20070105820 - Oxindole compounds and their uses as therapeutic agents: This invention is directed to oxindole compounds that are useful for the treatment and/or prevention of sodium channel-mediated diseases or conditions, such as pain. Pharmaceutical compositions comprising the compounds and methods of using the compounds are also disclosed.... Agent: Seed Intellectual Property Law Group PLLC

20070105821 - Methods for the synthesis of unsymmetrical cycloalkyl substituted xanthines: The present invention provides compounds and pharmaceutical compositions that are selective antagonists of A2B adenosine receptors (ARs). These compounds and compositions are useful as pharmaceutical agents. Also provided are processes for the preparation of the compounds and their intermediates.... Agent: Williams Mullen

20070105822 - Novel uses of known drugs: Statins are able to block the mevalonate pathway at an early stage, preventing build up of isopentenyl pyrophosphate by nitrogen containing bisphosphonates by blocking the pathway further downstream, with medicaments containing statins being administered at an appropriate time being able to thereby prevent the build up of IPP, which has... Agent: Bell & Associates

20070105823 - Glycero-compound having triple bond and membrane material containing the same: wherein n and m each represents a number of 1 to 17 and the total (n+m) is a number of 4 to 18, n and m may be the same or different, and R represents a hydrogen atom, a metal atom, a phosphoric acid group, or an organic group which... Agent: Ostrolenk Faber Gerb & Soffen

20070105824 - Methods for treating degenerative diseases/injuries: Invented is a method of treating degenerative diseases/injuries, in a mammal, including a human, in need thereof which comprises the administration of a therapeutically effective amount of a non-peptide TPO receptor agonist to such mammal.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20070105825 - Concurrent drugs: v

20070105827 - Estrogen receptor modulators: The present invention relates to compounds and derivatives thereof, their synthesis, and their use as estrogen receptor modulators. The compounds of the instant invention are ligands for estrogen receptors and as such may be useful for treatment or pre-vention of a variety of conditions related to estrogen functioning including: bone... Agent: Merck And Co., Inc

20070105826 - Novel fusidic acid derivatives: Fusidic acid derivatives substituted at C-24 may be used in therapy for the treatment of infections.... Agent: Birch Stewart Kolasch & Birch

20070105828 - Novel polymorph form m of mifepristone and process for its preparation: Mifepristone substantially in polymorph form M is provided. Also provided is a process for the preparation of polymorph form M of mifepristone comprising the steps of (a) dissolving crude mifepristone in a polar solvent at an elevated temperature to obtain a clear solution; (b) cooling the solution to a temperature... Agent: M. Carmen & Associates, PLLC

20070105829 - 5-amidino-2-hydroxybenzenesulfonamide derivatives, pharmaceutical compositions containing the same and intermediates for their preparation: T is an oxygen atom, a sulfur atom, a sulfonyl group etc.; Q is a hydrogen atom or an optionally substituted lower alkyl group; and Z is a hydrogen atom, a hydroxy group etc., or a pharmaceutically acceptable salt thereof, which exert a potent and selective activated blood coagulation factor... Agent: Sughrue Mion, PLLC

20070105830 - Processes for the preparations of cefepime: This invention provides processes for preparing cefepime, including crystalline intermediates of Formula V.... Agent: Novartis Corporate Intellectual Property

20070105831 - Carboxamide derivatives as muscarinic receptor antagonists: i

20070105832 - Substituted azetidinones: Wherein A, B, C, D, m, Y, Ra, Rc, Rd, and Rd′ are as described herein, and which are useful as inhibitors of tryptase, thrombin, trypsin, Factor Xa, Factor VIIa, Factor XIa, and urokinase-type plasminogen activator and may be employed in preventing and/or treating asthma, chronic asthma, allergic rhinitis, and... Agent: Morgan, Lewis & Bockius LLP (sf)

20070105833 - Modulators of atp-binding cassette transporters: 4-amido-pyrimidine compounds, derivatives and compositions thereof, and synthetic methods described herein are useful for modulating ATP-Binding Cassette (“ABC”) transporters or fragments thereof, including Cystic Fibrosis Transmembrane Conductance Regulator (“CFTR”). The present invention also relates to methods of treating ABC transporter mediated diseases using such modulators.... Agent: Vertex Pharmaceuticals Inc.

20070105834 - Tetrahydroisoquinoline sulfonamide derivatives, the preparation thereof, and the use of the same in therapeutics: The invention relates to tetrahydroisoquinoline sulfonamide compounds (of formula (1) as defined in the specification), their preparation and their use in therapies for the treatment of central nervous system diseases such as vigilance and sleep disorders, narcolepsy, Alzheimer's disease and other dementias, Parkinson's disease, attention disorders in hyperkinetic children, memory... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC

20070105835 - Compositions and methods for modulating poly(adp-ribose) polymerase activity: The present invention is based, in part, on assays we conducted that revealed compounds that modulate (e.g., inhibit) PARP-1 and are therefore useful in treating or preventing diseases characterized by abnormal PARP-1 activity (e.g., undesirable PARP-1 activity).... Agent: Fish & Richardson PC

20070105836 - Prodrugs of muscarinic agonists and methods of treatment of neuropsychiatric disorders: Compounds are described that are prodrugs to active compounds that modulate a muscarinic receptor. In some cases, the compounds are prodrugs to N-desmethylclozapine. The compounds may be used to treat neuropsychiatric disorders.... Agent: Knobbe Martens Olson & Bear LLP

20070105837 - Novel derivatives of 4a,5,9,10,11,12-hexahydrobenzofuro[3a,3,2][2]-benzazepine, method for the production thereof and use thereof in the production of medicaments: The invention relates to novel derivatives of 4a,5,9,10,11,12-hexahydro-benzofuro[3a,3,2] [2]benzazepine of general formulae 1a, 1b and 1c. Compounds 1a, 1b and 1c can be produced in an efficient manner on an industrial scale with the desired optical purity and are suitable for the production of medicaments for the treatment of a... Agent: Popovich, Wiles & O'connell, PA 650 Third Avenue South

20070105838 - Bicyclic benzamide compoundssa as histamine h3 receptor ligand useful in the treatment of neurological diseases: The present invention relates to novel bicyclic benzamide derivatives having pharmacological activity, processes for their preparation, to compositions containing them and to their use in the treatment of neurological and psychiatric disorders.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475

20070105839 - 2, 4-di (phenylamino) pyrimidines useful in the treatment of proliferative disorders: A method of preventing or treating proliferative disorders such as a tumor disease, by inhibiting ALK activity with compounds of formula (1):... Agent: Novartis Corporate Intellectual Property

20070105840 - Pyrrolo-dihydroisoquinoline derivatives as pde10 inhibitors: The invention relates to the use of a pyrrolo ‘2,1-a’ isoquinoline structure-element as an integral part of the overall structure of compounds which inhibit PDE10.... Agent: Nath & Associates PLLC

20070105841 - Method for treating allergies using substituted pyrazoles: A method for treating an allergic condition, including an atopic allergic condition, using substituted pyrazoles.... Agent: Philip S. Johnson Johnson & Johnson

20070105842 - P2x7 receptor antagonists and methods of use: m

20070105843 - Combination of a serotonin reuptake inhibitor and a 5-ht2c antagonist, inverse agonist or partial agonist: The present invention relates to the use of compounds and compositions of compounds having serotonin reuptake inhibiting activity and 5-HT2C antagonistic, partial agonistic or inverse agonistic activity for the treatment of depression and other affective disorders. The combined serotonin reuptake inhibiting effect and the 5-HT2C antagonistic, partial agonistic or inverse... Agent: Darby & Darby P.C.

20070105844 - Therapeutic compositions and methods: The present invention relates to novel chemical compounds, methods for their discovery, and their therapeutic use. In particular, the present invention provides benzodiazepine derivatives and structurally and functionally related compounds and methods of using benzodiazepine derivatives and related compounds as therapeutic agents to treat a number of conditions.... Agent: Medlen & Carroll, LLP

20070105847 - 1,3-dioxane derivatives and analogues thereof useful in the treatment of i.a. obesity and diabetes: The present invention discloses novel compounds of formula (I) and their pharmaceutically useful compositions as modulators of PPAR ligands... Agent: Nixon & Vanderhye, PC

20070105846 - Phenylene derivative having tetrazole ring or thiazolidinedione ring: e

20070105845 - Quinolone derivatives:

20070105848 - Methylene blue therapy of parasitic infections: A method for using thiazine dyes, especially methylene blue, alone or in combination with low levels of light, to treat parasitic diseases is described. Examples of useful thiazine dyes are methylene blue, azure A, azure C, toluidine, and thionine. The preferred dye is methylene blue, administered orally twice a day.... Agent: Patrea L. Pabst Pabst Patent Group LLP

20070105849 - Rifamycin analogs and uses thereof: The present invention features rifamycin analogs that can be used as therapeutics for treating or preventing a variety of microbial infections. In one form, the analogs are acetylated at the 25-position, as is rifamycin. In another form, the analogs are deacetylated at the 25-position. In yet other forms, benzoxazinorifamycin, benzthiazinorifamycin,... Agent: Clark & Elbing LLP

20070105850 - Biphenyl-carboxamide derivatives and their use as p38 kinase inhibitors: Compounds of formula (I) or pharmaceutically acceptable derivatives thereof, and their use as pharmaceuticals, particularly as p38 kinase inhibitors.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20070105851 - Indolyl-thienopyrazinone derivatives useful for treating hyperproliferative disorders and diseases associated with angiogenesis: This invention relates to a compound of Formula (I): (I) and its use in treating hyper-proliferative disorders and diseases associated with angiogenesis.... Agent: Jeffrey M. Greenman

20070105852 - Thiophene and furan compounds: The present invention relates to thiophene and furan compounds and their pharmaceutically acceptable salts, and further relates to their use in treating schizophrenia, cognitive deficits associated with schizophrenia, Alzheimer's disease, dementia of the Alzheimer's type, mild cognitive impairment, or depression.... Agent: Eli Lilly & Company

20070105853 - 2-'4-(hydroxymethyl-phenylamino)-piperidine-1-yl!-n-(9h-carbazol-3-yl) - acetamine derivatives and related compounds as neuropeptide y5 (npy5) ligands for the treatment of obesity: The present invention relates to 1,4-disubstituted piperidine compounds of general formula (I), methods for their preparation, medicaments comprising these compounds as well as their use for the preparation of a medicament for the treatment of humans or animals. The substituents are as defined in the present claim 1.... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070105856 - Cannabinoid receptor ligands and uses thereof: Compounds of Formula (I) that act as cannabinoid receptor ligands and their uses in the treatment of diseases linked to the mediation of the cannabinoid receptors in animals are described herein.... Agent: Pfizer Inc.

20070105854 - Novel heterocyclic compounds useful for the treatment of inflammatory and allergic disorders: process for their preparation and pharmaceutical compositions containing them: The present invention relates to novel heterocyclic compounds, their analogs, their tautomers, their regioisomers, their stereoisomers, their enantiomers, their diastereomers, their polymorphs, their pharmaceutically acceptable salts, their appropriate N-oxides, their pharmaceutically acceptable solvates and their pharmaceutical compositions containing them. The present invention more particularly relates to novel Phosphodiesterase type 4... Agent: Darby & Darby P.C.

20070105855 - Novel heterocyclic compounds useful for the treatment of inflammatory and allergic disorders: process for their preparation and pharmaceutical compositions containing them: The present invention relates to novel heterocyclic compounds, their analogs, their tautomers, their regioisomers, their stereoisomers, their enantiomers, their diastereomers, their polymorphs, their pharmaceutically acceptable salts, their appropriate N-oxides, their pharmaceutically acceptable solvates and their pharmaceutical compositions containing them. The present invention more particularly relates to novel Phosphodiesterase type 4... Agent: Darby & Darby P.C.

20070105857 - Process for making heteroaryl amine intermediate compounds: Disclosed are processes to produce a compound of the formula (I):... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070105858 - Retinoic acid mimetic anilides: the N-oxides, the pharmaceutically acceptable addition salts and the stereochemically isomeric forms thereof, wherein X represents O, S or NR3; R1 represents hydrogen, hydroxy, C1-6alkyl or aryl; R2 represents hydrogen; optionally substituted C1-12alkyl; C3-7cycloalkyl; C2-8alkenyl; aryl; Het1; or R1 and R2 taken together may form a bivalent radical of formula... Agent: Philip S. Johnson Johnson & Johnson

20070105859 - 4-phenylamino-benzaldoxime derivatives and uses thereof as mitogen-activated protein kinase kinase (mek) inhibitors: e

20070105860 - Biphenylcarboxylic amide derivatives as p38 kinase inhibitors:

20070105862 - Heat-shock protein binders: Compounds which bind to and inhibit the activity of HSP90, compositions containing the compounds and methods of treating diseases that are caused or exascerbated by overexpression of HSP90 are disclosed.... Agent: Robert Deberardine Abbott Laboratories

20070105861 - Novel vanilloid receptor ligands and use thereof for the production of pharmaceutical preparations: The present invention relates to novel vanilloid receptor ligands, to a process for the production thereof, to pharmaceutical preparations containing these compounds and to the use of these compounds for the production of pharmaceutical preparations.... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070105864 - Methods for inhibiting protein kinases: The present invention provides methods for inhibiting protein kinases selected from the group consisting of AKT, Checkpoint kinase, Aurora kinase, Pim-1 kinase, and tyrosine kinase using imidazo[1,2-a]pyrazine compounds and methods of treatment, prevention, inhibition, or amelioration of one or more diseases associated with protein kinases using such compounds.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20070105863 - Novel opioid antagonists: Certain quinolizidine and octahydropyridopyrazine compounds, pharmaceutical compositions, and methods of their use, inter alia, as opioid receptor antagonists are disclosed.... Agent: Woodcock Washburn LLP

20070105865 - Substituted bicyclic quinazolin-4-ylamine derivatives: Substituted bicyclic quinazolin-4-ylamine derivatives are provided. Such compounds are ligands that may be used to modulate specific receptor activity in vivo or in vitro, and are particularly useful in the treatment of conditions associated with pathological receptor activation in humans, domesticated companion animals and livestock animals. Pharmaceutical compositions and methods... Agent: Edwards & Angell, LLP

20070105866 - 5-lipoxygenase-activating protein (flap) inhibitors: Described herein are compounds and pharmaceutical compositions containing such compounds, which modulate the activity of 5-lipoxygenase-activating protein (FLAP). Also described herein are methods of using such FLAP modulators, alone and in combination with other compounds, for treating respiratory, cardiovascular, and other leukotriene-dependent or leukotriene mediated conditions or diseases.... Agent: Wilson Sonsini Goodrich & Rosati

20070105867 - Oral administration of n-(2-chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyethyl)-1-piperazinyl]-2-methyl-4-pyrimidinyl]amino]-1,3-thiazole-5-carboxamide and salts thereof: Disclosed are a method of treating cancer and/or other proliferative diseases comprising orally administering N-(2-chloro-6-methylphenyl)-2-((6-(4-(2-hydroxyethyl)-1-piperazinyl)-2-methyl-4-pyrimidinyl)amino)-1,3 -thiazole-5-carboxamide or a salt thereof, and pharmaceutical compositions comprising N-(2-chloro-6-methylphenyl)-2-((6-(4-(2-hydroxyethyl)-1-piperazinyl)-2-methyl-4 -pyrimidinyl)amino)-1,3-thiazole-5-carboxamide or a salt thereof. Also disclosed are N-(2-chloro-6-methylphenyl)-2-((6-(4-(2-hydroxyethyl)-1-piperazinyl)-2-methyl-4-pyrimidinyl)amino)-1,3-thiazole-5-carboxamide salts, as well as crystalline forms thereof.... Agent: Louis J. Wille Bristol-myers Squibb Company

20070105868 - Phenylacetic acid derivative, process for producing the same, and use: (wherein R1 and R2 is hydrogen atom, C1-8 alkyl etc.; R3 is C1-8 alkyl which may be substituted with 1 to 3 halogen atom(s), phenyl; R4 is hydrogen atom etc.; R5 and R6 is hydrogen atom, C1-8 alkyl etc.; X is sulfur atom or oxygen atom etc.; ringA is cyclic... Agent: Sughrue Mion, PLLC

20070105869 - Use of flibanserin for the treatment of pre-menopausal sexual desire disorders: The invention relates to the use of flibanserin for the preparation of a medicament for the treatment of pre-menopausal Sexual Desire Disorders.... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070105870 - Piperazine derivatives which exhibit activity as serotonin and noradrenaline re-uptake inhibitors: A compound of formula (I), wherein R1 is H; R2 is aryl, het, C3-8cycloalkyl, C1-6alkyl, (CH2)2aryl or R4, wherein each of the cycloalkyl, aryl, het and R4 groups is optionally substituted by at least one substituent independently selected from C1-6alkyl, C1-6alkoxy, OH, halo, CF3, OCF3, OCHF2, O(CH2)yCF3, CN, CONH2, CON(H)C1-6alkyl,... Agent: Warner-lambert Company

20070105871 - 1,3,4-substituted pyrazoles as 5-ht receptor antagonists for the treatment of psychoses and neurological disorders: Compounds of the formula (I) and salts and solvates thereof, in which X, R1, R2, R5 and Q have the meanings indicated in claim 1, are suitable as ligands of 5 HT receptors; as well as intermediate compounds of the formula (IA).... Agent: Millen, White, Zelano & Branigan, P.C.

20070105872 - Pyrazine derivatives: m

20070105873 - 2-substituted pyrimidines:

20070105874 - Anti-tumor methods using multi drug resistance independent synthetic hsp90 inhibitors: The present invention provides a method of treating an individual having an HSP90 mediated disorder comprising administering to said individual a pharmaceutical composition comprising a pharmaceutically effective amount of a synthetic heterocyclic HSP90 inhibitor, wherein the activity of the HSP90 inhibitor is substantially independent of multi drug resistance. In one... Agent: Wilson Sonsini Goodrich & Rosati

20070105875 - Fungicidal mixtures: e

20070105876 - 6-cyclylmethyl- and 6-alkylmethyl-substituted pyrazolepyrimidines: The invention relates to novel 6-cyclylmethyl- and 6-alkylmethyl-substituted pyrazolopyrimidines, process for their preparation and their use for producing medicaments for improving perception, concentration, learning and/or memory.... Agent: Jeffrey M. Greenman

20070105877 - Pyrazolopyrimidines: This invention relates to compounds of formula (I).... Agent: Pharmacia Corporation Global Patent Department

20070105878 - Purine formulations and methods for managing disorders: The present invention relates to compounds and pharmaceutically acceptable salts thereof and formulations comprising the compounds or a pharmaceutically acceptable salt thereof that are useful for treating or preventing depression; multiple sclerosis; irritable bowel syndrome; low compliance bladder; urinary incontinence; constipation; gastrointestinal pain; and related disorders.... Agent: Pepper Hamilton LLP

20070105879 - Ready-for-use injectable solution of 9-((1,3-dihydroxypropan-2-iloxy)methyl)-2-amine-1h-purin-6(9h)-one, sterile, stable; closed system for packing the solution, process for eliminating alkaline residuals of 9-((1,3-dihydroxypropan-2-iloxy)methyl)-2-amine: The present invention describes a sterile, stable and ready-for-use injectable solution comprising 9-((1,3-dihydroxypropan-2-iloxy)methyl)-2-amino-1H-purin-6(9H)-one in glucose 5% aqueous solution or sodium chloride 0-9% aqueous solution. It also describes a closed system used for packing the solution, which consists of a flexible bag manufactured with a tri-laminated material. The present invention also... Agent: Birch Stewart Kolasch & Birch

20070105880 - Process for the preparation of alfuzosin: The present invention relates to a simple process for the preparation of alfuzosin, it's bases and its pharmaceutically acceptable salts thereof.... Agent: Mr. Dennis A. Bennett 1333 Red River Drive

20070105881 - 6-arylamino-5-cyano-4-pyrimidinones as pde9a inhibitors: e

20070105882 - Polymorphic forms of a known antihyperlipemic agent: Two new polymorphic forms of (E)-7-[4-(4-fluorophenyl)-6-isopropyl-2-[methyl(methylsulfonyl)amino]pyrimidin-5-yl](3R,5S)-3,5-dihydroxyhept-6-enoic acid tris(hydroxymethyl)methylammonium salt (1), processes for making them and their use in the production of a pharmaceutical useful in the treatment of, inter alia, hypercholesterolemia, hyperlipoproteinemia and atherosclerosis are described.... Agent: Morgan Lewis & Bockius LLP

20070105883 - Novel physiologically active substances pf127oa, b and c substances: This invention provides novel PF1270A substance, PF1270B substance and PF1270C substance represented by the following formula (1) or pharmaceutically acceptable salts thereof, a method for producing the same and a pharmaceutical composition which comprises at least one of the same as the active ingredient. Since a group of the PF1270... Agent: Sughrue Mion, PLLC

20070105884 - Opiate analogs selective for the delta-opioid receptor: Novel compounds which selectively bind to the δ-opioid receptor have been designed. These compounds have greater selectivity, improved water (blood) solubility, and enhanced therapeutic value as analgesics. Because agonists with selectivity for the δ-opioid receptor have shown promise in providing enhanced analgesis without the addictive properties, the compounds of the... Agent: Fulbright & Jaworski L.L.P.

20070105885 - Novel crystalline polymorphic form of a camptothecin analogue: The invention relates to a novel crystalline form of topotecan hydrochloride, and methods of making the same. The characteristic XRPD pattern and FT-IT patterns are shown in FIGS. 1 and 2.... Agent: Conley Rose, P.C.

20070105886 - Steroidal compounds for inhibiting steroid sulphatase: There is provided a compound having Formula (I) wherein G is H or a substituent, and wherein R1 is any one of a sulphamate group, a phosphonate group, a thiophosphonate group, a sulphonate group or a sulphonamide group, capable of inhibiting steroid sulphatase.... Agent: Frommer Lawrence & Haug

20070105888 - 41-methoxy isotope labeled rapamycin 42-ester: 41-methoxy-labeled rapamycin 42-ester with 3-hydroxy-2-(hydroxymethyl)-2-methylpropionic acid (CCI-779) compounds are provided, along with methods for the synthesis and use thereof.... Agent: Howson And Howson Cathy A. Kodroff

20070105887 - Antineoplastic combinations of temsirolimus and sunitinib malate: A combination of temsirolimus and sunitinib malate in the treatment of cancer is provided. Also provided are regimens and kits for treatment of renal cell carcinoma, containing temsirolium and sunitinib malate, optionally in combination with other anti-neoplastic or immune modulators.... Agent: Howson And Howson Cathy A. Kodroff

20070105889 - Condensed indoline derivatives and their use as 5ht , in particular 5hht2c, receptor ligands: A chemical compound of formula (I) wherein R1 and R2 are independently selected from hydrogen and alkyl; R3 is alkyl; R4 and R5 are selected from hydrogen and alkyl; R6 and R7 are independently selected from hydrogen, halogen, hydroxyl, alkyl, aryl, amino, alkylamino, dialkylamino, alkoxy, aryloxy, alkylthio, alkylsulfoxyl, nitro, carbonitrile,... Agent: Foley And Lardner LLP Suite 500

20070105890 - Novel condensed imidazole derivative: c

20070105891 - Thiazole[4,5-c]pyridine derivatives:

20070105892 - Amidino compounds as cysteine protease inhibitors: The present invention is directed to compounds that are inhibitors of cysteine proteases, in particular, cathepsins B, K, L, F, and S and are therefore useful in treating diseases mediated by these proteases. The present invention is directed to pharmaceutical compositions comprising these compounds and processes for preparing them.... Agent: Berlex Biosciences Patent Department

20070105894 - Combination of at least two compounds selected from an at1-receptorantagonist or an ace inhibitor or a hmg-co-a reductase inhibitor: (i) an AT1-receptor antagonist or an AT1 receptor antagonist combined with a diuretic or, in each case, a pharmaceutically acceptable salt thereof, (ii) a HMG-Co-A reductase inhibitor or a pharmaceutically acceptable salt thereof and (iii) an ACE inhibitor or a pharmaceutically acceptable salt thereof for use in the prevention of,... Agent: Novartis Corporate Intellectual Property

20070105893 - Novel compounds: Compounds of formula (I) wherein RF1, RF2, Z, R1, R2, Ar, X and Y are as dcfined in thc specification as wcll as salts and pharmaceutical compositions including the compounds were prepared. These compounds are useful in therapy, in particular in the management of pain.... Agent: Astra Zeneca Pharmaceuticals Lp Global Intellectual Property

20070105896 - 4-substituted imidazoles: m

20070105895 - Muscarinic acetycholine receptor antagonists: Muscarinic Acetylcholine Receptor Antagonists and methods of using them are provided.... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20070105897 - Novel quinuclidine derivatives and medicinal compositions containing the same: A compound of formula (I), wherein B is a phenyl ring, a 5 to 10 membered heteroaromatic group containing one or more heteroatoms, or a naphthalenyl, 5,6,7,8-tetrahydronaphthalenyl, benzo[1,3]dioxolyl, or biphenyl group; R1, R2 and R3 each independently represent a hydrogen or halogen atom, or a hydroxy group, a phenyl group,... Agent: Morrison & Foerster LLP

20070105899 - Benzene compounds: The present invention provides novel benzene compounds presented by the following formulas, and analogs thereof, that exert an ACC activity-inhibiting effect that is effective in the treatment of obesity, hyperlipemia, fatty liver, hyperglycemia, impaired glucose tolerance, diabetes, diabetic complications (diabetic peripheral neuropathy, diabetic nephropathy, diabetic retinopathy, and diabetic macroangiopathy, hypertension,... Agent: Ajinomoto Corporate Services LLC

20070105898 - Process for the production of cilostazol: wherein X is a halogen atom such as Cl, Br, and I, that includes combining compounds II, III, a water-miscible organic solvent, a water-soluble base and water. The cilostazol can then be separated from the reaction mixture and dissolved in a solvent A. The resulting cilostazol solution is mixed with... Agent: Ivor M. Hughes, Barrister & Solicitor, Patent & Trademark Agents

20070105900 - Pharmaceutical compounds: e

20070105901 - Novel piperidine derivative: Provided are a histamine-H3 receptor antagonist; and a preventive and/or a remedy for metabolic system diseases such as obesity, diabetes, hormone secretion disorder, hyperlipemia, gout, fatty liver, circulatory system diseases, for example, stenocardia, acute/congestive cardiac insufficiency, cardiac infarction, coronary arteriosclerosis, hypertension, nephropathy, sleep disorder and various diseases accompanied by sleep... Agent: Merck And Co., Inc

20070105902 - 4-phenyl piperdine sulfonyl glycine transporter inhibitors: The present invention is directed to compounds that inhibit the glycine transporter GlyT1 and which are useful in the treatment of neurological and psychiatric disorders associated with glycinergic or glutamatergic neurotransmission dysfunction and diseases in which the glycine transporter GlyT1 is involved.... Agent: Merck And Co., Inc

20070105903 - Synthesis and anti-tumor activity of nitrogen substituted thalidomide analogs: The present invention comprises a group of compounds that effectively inhibit angiogenesis. More specifically, nitrogen-substituted thalidomide analogs and di-substituted thalidomide analogs have been shown to inhibit angiogenesis. Importantly, these compounds can be administered orally.... Agent: Jones Day

20070105904 - Heterocycles substituted pyridine derivatives and antifungal agent containing thereof: wherein R1 represents a hydrogen atom, a halogen atom, an amino group, a C1-6 alkyl group, a C1-6 alkoxy group or a C1-6 alkoxy C1-6 alkyl group; R2 represents a hydrogen atom, a C1-6 alkyl group, an amino group or a di C1-6 alkylamino group; one of X and Y... Agent: Birch Stewart Kolasch & Birch

20070105906 - Indol-containing beta-agonists, methods for the preparation thereof and their use as pharmaceutical compositions: wherein the groups R1 and R2 have the meanings given in the claims and specification, the tautomers, racemates, enantiomers, diastereomers, solvates, hydrates, mixtures thereof, the prodrugs thereof and the salts thereof, particularly the physiologically acceptable salts thereof with inorganic or organic acids or bases, methods of preparing these compounds and... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070105907 - Novel ido inhibitors and methods of use thereof: Novel indoleamine 2,3-dioxygenase (IDO) inhibitors, compositions comprising the same, and methods of use thereof are disclosed.... Agent: Dann, Dorfman, Herrell & Skillman

20070105905 - Novel macrocycles for the treatment of cancer: The present invention relates to new macrocycles of the general formula (I) as well as their use for the treatment of cancer diseases.... Agent: Leydig Voit & Mayer, Ltd

20070105908 - Thiazolimine compound and oxazolimine compound: (wherein X represents sulfur or oxygen; R1 and R2 each represents a group represented by the formula —Y3-Z, etc.; Y3 represents a single bond or (un)substituted alkylene; Y1 and Y2 each represents (un)substituted alkylene; Z represents hydrogen, an (un)saturated monocyclic heterocyclic group, etc.; M represents carboxy, etc.; Q represents o-phenylene,... Agent: Sughrue Mion, PLLC

20070105909 - Compounds useful in therapy: or a pharmaceutically acceptable derivative thereof, wherein R1 and R3 independently represent H, C1-6alkyl, C3-8cycloalkyl, or halogen; R2 represents C1-6alkyl, CF3 or aryl; a represents 1 or 2; R4, R5, R7 and R8 independently represent H, C1-6alkyl, C1-6alkyloxy, CN or halogen, or R4 and R5, or R7 and R8, together... Agent: Pfizer Inc.

20070105911 - Agent for inhibition of cytokine production and agent for inhibition of cell adhesion:

20070105910 - Medicinal composition: A medicinal composition which comprises an insulin resistance-improving drug and vitamin B1 or derivative thereof. In this medicinal composition, the side effects of the insulin resistance-improving drug such as edema, heart enlargement, anemia, etc. are prevented by using vitamin B1 or its derivative together. It is usable as a remedy... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070105912 - Pharmaceutical compositions comprising lercanidipine: A controlled release pharmaceutical composition comprising lercanidipine dissolved or dispersed in a solid vehicle at ambient temperature, thus forming a solid dispersion, achieves delayed release of lercanidipine over an extended period of time, reduced food effect and increased bioavailability compared to commercially available lercanidipine containing products.... Agent: Cheryl H Agris Phd

20070105913 - Alkynyl aryl carboxamides: The present invention is related to alkynyl aryl carboxamides of Formula (I′) and use thereof for the treatment and/or prevention of an inflammatory disorder, obesity and/or metabolic disorders mediated by insulin resistance or hyperglycemia, comprising diabetes type I and/or II, inadequate glucose tolerance, insulin resistance, hyperlipidemia, hypertriglyceridemia-hypercholesterolemia, polycystic ovary syndrome... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070105915 - Fungicidal composition comprising a pyridylethylbenzamide derivative and a compound capable of inhibiting the transport of electrons of the respiratory chain in phytopathogenic fungal organisms: A composition comprising at least a pyridylethylbenzamide derivative of general formula (I) (a) and a compound capable of inhibiting the transport of electrons of the respiratory chain in phytopathogenic fungal organisms (b) in a (a)/(b) weight ratio of from 0.01 to 20. A composition further comprising an additional fungicidal compound.... Agent: Ostrolenk Faber Gerb & Soffen

20070105914 - Substituted sulfonamides: The substituted sulfonamides of the invention are antagonists and/or inverse agonists of the Cannabinoid-1 (CB1) receptor and are useful in the treatment, prevention and suppression of diseases mediated by the CB1 receptor. The compounds of the present invention are useful as centrally acting drugs in the treatment of psychosis, memory... Agent: Merck And Co., Inc

20070105916 - Amphiphilic pyridinium compounds, method of making and use thereof: The present invention is directed to the amphiphilic pyridinium compounds, such as for suppressing IL-8 secretion and production. The present invention further provides methods of making and using such compounds for the treatment of the IL-8 related diseases, such as cystic fibrosis.... Agent: Dla Piper US LLP Attn: Patent Group

20070105917 - Methods for preparing nonpeptidic oligomers from amino acids: The present invention relates to nonpeptidic oligomers. Methods for preparing nonpeptidic oligomers from amino acids by replacing the amide bond with heterocyclic rings are also disclosed.... Agent: Nixon Peabody LLP - Patent Group

20070105918 - Use of pramipexole to treat amyotrophic lateral sclerosis: The present invention is directed to compositions comprising pramipexole and the use of such compositions to treat neurodegenerative diseases such as amyotrophic lateral sclerosis (ALS). As shown in FIG. 6B the mean +/− SEM serum 2.3 DHBA levels for the 12 ALS participants decreased significantly after pramipexole treatment.... Agent: Patrea L. Pabst Pabst Patent Group LLP

20070105920 - 2-(benzimidazol-1-yl)-n-(4-phenylthiazol-2-yl) acetamide derivatives: wherein R1 is H, (C1-4)alkyl, (C1-4)alkyloxy or halogen; R2 represents 1-3 substituents selected from H, (C1-4)alkyl (optionally substituted with 1 or more halogens), (C1-4)alkyloxy (optionally substituted with 1 or more halogens), halogen, CF3 or cyano; or a pharmaceutically acceptable salt thereof; to pharmaceutical compositions comprising the same and to the... Agent: Akzo Nobel Inc.

20070105919 - Thiazole derivatives: e

20070105921 - Process for preparing oxazole intermediates:

20070105922 - 3-aryl-isoxazole-4-carbonyl-indole derivatives: R1, R2, and R3 are as defined in the specification and claims and with their pharmaceutically acceptable acid addition salts. These compounds have a high affinity and selectivity for GABA A α5 receptor binding sites and might be useful as cognitive enhancer or for the treatment of cognitive disorders like... Agent: Hoffmann-la Roche Inc. Patent Law Department

20070105925 - Methods for achieving a protective ace2 expression level to treat kidney disease and hypertension: The present invention provides a method for enhancing expression of angiotensin converting enzyme ACE2 in the vasculature of a mammal, particularly in the renal vasculature and podocytes. The method comprises administering to a mammal in need of such enhancement (e.g., a mammal suffering from, or at risk of developing renal... Agent: Olson & Hierl, Ltd.

20070105923 - Substantially pure olmesartan medoxomil and processes for its preparation: A process for purifying olmesartan medoxomil is provided comprising (a) dissolving olmesartan medoxomil in a solvent system comprising a ketone and at least one solvent selected from the group consisting of an alcohol-containing solvent, an ester-containing solvent and mixtures thereof to obtain a solution; and (b) recovering substantially pure olmesartan... Agent: M. Carmen & Associates, PLLC

20070105926 - Tetrazoyloxime derivative and agricultural chemical containing the same as active ingredient: X represents a hydrogen atom, a halogen atom, an alkyl group, an alkoxy group, a cyano group, a methanesulfonyl group, a nitro group, a trifluoromethyl group, or an aryl group; A represents a 1-alkyltetrazoyl-5-yl group or a 5-alkyltetrazoyl-1-yl group; and Het represents a pyridyl group having a substituent or a... Agent: Armstrong, Kratz, Quintos, Hanson & Brooks, LLP

20070105924 - Vigabatrin bioisoteres and related methods of use: Compounds bioisoteric to vigabatrin and related methods of use.... Agent: Reinhart Boerner Van Deuren S.c. Attn: Linda Kasulke, Docket Coordinator

20070105927 - Amorphous rizatriptan benzoate: Rizatriptan benzoate in an amorphous form is disclosed. Also disclosed is a process for preparing rizatriptan benzoate substantially in amorphous form comprising the steps of (a) preparing a solvent solution comprising non-amorphous rizatriptan benzoate and one or more solvents capable of dissolving the non-amorphous rizatriptan benzoate; and (b) recovering the... Agent: M. Carmen & Associates, PLLC

20070105928 - 6-pentafluorophenyl-triazolopyrimidines, method for their production and their use for combating pathogenic fungi, in addition to agents containing said substances: z

20070105929 - 2, 4, 5 - trisubstituted imidazoles and their use as anti-microbial agents: The present invention provides therapeutically effective 2,4,5-trisubstituted imidazole compounds, methods of preparing the same, and compositions comprising the compounds alone or in combination with other agents. The present invention further provides for the use of the compounds as anti-microbial agents. The anti-microbial properties of the compounds include anti-bacterial and/or anti-fungal... Agent: Mcandrews Held & Malloy, Ltd

20070105930 - Cyclic guanidines, compositions containing such compounds and methods of use: The present invention relates to cyclic guanidines, compositions containing such compounds and methods of treatment. The compounds are glucagon receptor antagonists and thus are useful for treating, preventing or delaying the onset of type 2 diabetes mellitus.... Agent: Merck And Co., Inc

20070105932 - 2h-or 3h-benzo[e]indazol-1-yl carbamate derivatives, the preparation and therapeutic use thereof: e

20070105931 - Methods and compositions for inhibiting the proliferation of prostate cancer cells: The invention provides for methods of monitoring the proliferation of cultured prostate cancer cells in the presence of celecoxib and/or nimesulide, methods of treating an individual with prostate cancer or at risk of developing prostate cancer, and methods of reducing the risk of recurrence of prostate cancer in an individual... Agent: Fish & Richardson P.C.

20070105933 - Amino alcohol compounds: wherein R1 and R2 are each hydrogen; R3 is hydrogen; R4 is C1-C2 alkyl; n is 2; X is=N-D, wherein D is hydrogen, C1-C4 alkyl or phenyl; Y is ethylene, ethynylene, —CO—CH2 or phenylene; Z is ethylene or trimethylene; R5 is an unsubstituted C3-C10 cycloalkyl, an unsubstituted C6-C10 aryl, or... Agent: Frishauf, Holtz, Goodman & Chick, PC

20070105934 - Pharmaceutical composition for treatment of tear and salivary fluid drying: [Problem]An agent for treating eye and mouth dryness, which does not accompanies undesirable actions is provided. [Means for Resolution]Administration of the compound A made it possible to accelerate tear and salivary fluid secretion without accompanying sweating and its sustained release administration enabled acceleration of lacrimal gland and salivary gland cell... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20070105936 - Cyclohexanecarboxylic acid compound: The present invention provides a VLA-4 inhibitor having high water-solubility and excellent long-term stability; i.e., sodium trans-4-[1-[2,5-dichloro-4-[(1-methyl-1H-3-indolylcarbonyl)amino]phenylacetyl]-(4S)-methoxy-(2S)-pyrrolidinylmethoxy]cyclohexanecarboxylate pentahydrate.... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070105935 - Process for producing pyrrolidine derivative: This invention provides an industrially useful process for producing 1,4-transcyclohexanecarboxylic acid derivative (1) which has excellent VLA-4 inhibitory action and safety, and an intermediate which is useful in such method. More particularly, this invention relates to a process for converting a compound of formula (I) into a compound of formula... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070105937 - Indole-3-propionamide and derivatives thereof: Indolepropionamide (IPAM) and related compounds, pharmaceutical or dietary compositions thereof and methods of using said compounds are disclosed for use as a preventative or therapeutic treatment for many conditions related to oxidative damage. Oxidative damage increases in aging and age related disorders and is widespread in many neurodegenerative conditions including... Agent: Jones, Walker, Waechter, Poitevent, Carrere & Denegre, L.L.P.

20070105939 - Mesylate salt of 5-(2-dimethylaminoethoxy)-1h-indole-2-carboxylic acid [3-(4-hydroxycarbamoylphenyl)prop-2-ynyl]amide: The present invention is directed to the mesylate salt of 5-(2-dimethylamino-ethoxy)-1H-indole-2-carboxylic acid [3-(4-hydroxycarbamoylphenyl)prop-2-ynyl]amide, pharmaceutical compositions and processes for preparing the same.... Agent: Townsend And Townsend And Crew, LLP

20070105940 - Method for treating pain: wherein n is an integer of from 1 to 10, m is an integer of from 1 to 4 and the total carbon atoms in the alkenyl amide chain is from about 11 to about 20 as an active ingredient together with one or more pharmaceutically-acceptable additives, excipients or diluents.... Agent: Allergan, Inc.

20070105938 - Products and methods for in vivo secretion of monatin: Products and methods for the in vivo production of monatin sweetener are provided. The products include microorganisms that are genetically modified to secrete or to improve secretion of monatin; microorganisms that are genetically modified to produce monatin; and microorganisms that are genetically modified to both secrete or improve secretion of... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070105941 - Substituted cyclohexylcarboxylic acid amide compounds: Substituted cyclohexylcarboxylic acid amide compounds, processes for their production, pharmaceutical compositions containing these compounds and the use of substituted cyclohexylcarboxylic acid compounds for producing pharmaceutical compositions for treating conditions or disease states associated with the opioid receptor system and/or with noradrenalin and/or serotonin re-uptake.... Agent: Crowell & Moring LLP Intellectual Property Group

20070105942 - Supplemental dietary composition for turning on anabolic switches in muscle, stimulating and/or optimizing protein synthesis, and/or potently signaling muscle building and/or growth via molecular pathways: Compositions and methods relating to the use of cationic and monobasic amino acids combined with ketoacids for the purposes of regulating molecular signals to control anabolic and anti-catabolic activity in skeletal muscular development are disclosed. The present invention is designed to influence the genetic control system for muscle protein synthesis... Agent: Kenyon & Kenyon LLP

20070105943 - Novel antifungal agent containing heterocyclic compound: [wherein A1 represents a 3-pyridyl group which may have a substituent, a quinolyl group which may have a substituent, or the like; X1 represents a group represented by the formula —NH—C(═O)—, a group represented by the formula —C(═O)—NH—, or the like; E represents a furyl group, a thienyl group, a... Agent: Birch Stewart Kolasch & Birch

20070105944 - Taxane metabolites: This invention relates to compounds of 3′-tert-butyl-3′-N-tert-butyloxycarbonyl-4-deacetyl-3′dephenyl-3′-N-debenzoyl-4-O-methoxycarbonyl-paclitaxel. The compounds of the invention are useful as therapeutic agents.... Agent: Louis J. Wille Bristol-myers Squibb Company

20070105945 - Antimalarial drug containing synergistic combination of curcumin and artemisinin: A pharmaceutical composition for the treatment of malaria in mammals is disclosed. The composition comprises of a synergistic combination of curcumin and artemisinin.... Agent: Ladas & Parry

20070105947 - External preparation for skin: The present invention relates to an external preparation for skin comprising a compound, such as centaureidin(5,7-dihydroxy-3,6-dimethoxy-2-(5-hydroxy-4-methoxyphenyl)-4H-1-benzopyran-4-one); 5,7-dihydroxy-3,6,8-trimethoxy-2-(3,4,5-trihydroxyphenyl)-4H-1-benzopyran-4-one; 3,5-diethoxy-6,7-dimethoxy-2-(5-ethoxy-4-methoxyphenyl)-4H-1-benzopyran-4-one; and 5,6-dihydroxy-3,7-dimethoxy-2-(5-hydroxy-2,4-dimethoxyphenyl)-4H-1-benzopyran-4-one; and/or salt thereof and 4-n-butyl resorcinol and/or a salt thereof. The present invention provides an external preparation for skin having a function as a substantial lightening cosmetic that exerts whitening... Agent: Knobbe Martens Olson & Bear LLP

20070105948 - Therapeutic or preventive agents for ischemic neuropathy: e

20070105946 - Tocopherol derivatives with a long hydroxylated chain, which can be used as neurotrophics: The invention relates to any isolated or synthetic compound and, in particular, to compounds having formula which can: modulate the cell specification of neural stem cells, promote the differentiation and subsequent survival of differentiating glial cells and neurones, and promote the differentiation of oligodendrocyte precursor cells into mature oligodendrocytes. In... Agent: Nath & Associates

20070105949 - Intermediates for the preparation of lipoxin a4 analogs: e

20070105950 - Treatment of ophthalmic disorders using urea and urea derivatives: Methods for treating disorders of the eye and/or disorders of a nerve in a human or veterinary patient by delivering to the patient a therapeutically effective amount of a compound selected from the group of; urea, urea derivatives, thiourea, thiourea derivatives, guanidine, guanidine derivatives and compounds having General Formula I... Agent: Robert D. Buyan Stout, Uxa, Buyan & Mullins, LLP

20070105951 - Phenyl-furan compounds as vitamin d receptor modulators: The present invention relates to novel, non-secosteroidal, phenyl-furan compounds with vitamin D receptor (VDR) modulating activity that are less hypercalcemic than 1α,25dihydroxy vitamin D3. These compounds are useful for treating bone disease and psoriasis.... Agent: Eli Lilly & Company

20070105952 - Pharmaceutical composition having a ruthenium oxalato compound and method of using the same: The present invention relates to a pharmaceutical composition comprising one or more of the following ruthenium oxalato compounds I, II, III and IV as an active ingredient. The pharmaceutical composition can be used for the treatment of viral-infected patients or prophylactic treatment of patients at risk from viral infection.... Agent: Dickstein Shapiro LLP

20070105953 - Pharmaceutical gallium compositions and methods: Novel pharmaceutical gallium compositions, including gallium complexes having increased oral bioavailability relative to uncomplexed gallium salts are disclosed. Such compositions are useful in the treatment of conditions and diseases in which inhibition of abnormally increased calcium resorption is desired, including cancer, hypercalcemia, osteoporosis, osteopenia and Paget's disease. Methods for preparation... Agent: Karen M. Whitney Diehl Servilla LLC

20070105954 - Formulation containing a carboxylic acid or an ester thereof: A formulation comprising eicosapentaenoic acid, or an ester thereof, and a triterpene, or an ester thereof, and the use of such a formulation.... Agent: Kaplan Gilman Gibson & Dernier L.L.P.

20070105955 - Compounds for the treatment of metabolic disorders: Agents useful for the treatment of various metabolic disorders, such as insulin resistance syndrome, diabetes, hyper-lipidemia, fatty liver disease, cachexia, obesity, atherosclerosis and arteriosclerosis are disclosed. Formula (I) wherein n is 1 or 2; m is 2 or 3; q is 0 or 1; t is 0 or 1; R2... Agent: Lewis J. Kreisler

20070105956 - Drug containing (2r)-2-propyloctanoic acid as the active ingredient: The present invention relates to a medicament which is useful for neurodegenerative diseases, which comprises about 1 to about 5 equivalents of a basic metal ion based on 1 equivalent of (2R)-2-propyloctanoic acid or a salt thereof, which is supplied from a metal salt of weak acid or a metal... Agent: Sughrue Mion, PLLC

20070105957 - Dietary control of arachidonic acid metabolism: Compositions for the treatment of symptoms of inflammatory disorders may include gamma-linolenic acid or dihomogammalinolenic acid, an inhibitor of Δ5 desaturase, and optionally stearidonic acid or ω-3 arachidonic acid. Preferred formulations may be in the form of a good tasting, preferably milk or fruit based drink, or a dried powder.... Agent: Myers Bigel Sibley & Sajovec

20070105958 - Compounds for the treatment of metabolic disorders: Compounds useful for the treatment of various metabolic disorders, such as insulin resistance syndrome, diabetes, hyperlipidemia, fatty liver disease, cachexia, obesity, atherosclerosis and arteriosclerosis, are disclosed.... Agent: Lewis J. Kreisler

20070105959 - Cynnamyl alcohol derivative compounds and drugs containing the compounds as active ingredient: (wherein all the symbols are as defined in the specification) or a salt thereof Since the compound represented by formula (I) or a salt thereof has a regulatory activity for peroxisome proliferator activated receptor, the compound represented by formula (I) is useful as a hypoglycemic agent, a hypolipidemic agent, a... Agent: Sughrue Mion, PLLC

20070105960 - Treatment of learning disabilities and motor skills disorder with norepinephrine reuptake inhibitors: Provided are methods and medicaments for treating a learning disability or a Motor Skills Disorder, comprising administering to a patient in need of such treatment an effective amount of a selective norepinephrine reuptake inhibitor.... Agent: Eli Lilly & Company

20070105961 - 1-amino-alkylcyclohexanes as 5-ht3 and neuronal nicotinic receptor antagonists: Certain 1-aminoalkylcyclohexanes are systematically-active 5HT3 and nicotinic receptor antagonists and are useful in the inhibition of progression of or alleviation of conditions resulting from disturbances of serotoninergic or nicotinergic transmission giving them a wide range of utility in the treatment of CNS-disorders. Pharmaceutical compositions thereof for such purpose and method... Agent: The Firm Of Hueschen And Sage

20070099819 - Methods and compositions for blocking platelet and cell adhesion, cell migration and inflammation: The present invention provides compositions of saratin and methods of use thereof. One aspect of the invention is a method of prevention or mitigation of the development of adhesions, keloids and scars. The adhesions, keloids and scars can be due to surgery, such as plastic surgery or orthopedic surgery, or... Agent: Wilson Sonsini Goodrich & Rosati

20070099821 - method of activating insulin receptor substrate-2 to stimulate insulin production: The invention relates to new methods and compositions for treating diabetics, pre-diabetics, and patients at risk of becoming diabetic or with impaired glucose tolerance. The invention, in one embodiment, involves activating insulin receptor substrate-2 to protect against loss of beta cell mass, protect against loss of beta cell function, rejuvenate... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC

20070099820 - Polymer-drug conjugates: A conjugate that includes a drug covalently linked to a polymer. Upon administration, the conjugate is digested by an enzyme that is present at the site of administration thereby releasing a therapeutic agent. The conjugate may demonstrate substantially the same pharmacokinetic and pharmacodynamic behavior as the drug itself. A material... Agent: Choate, Hall & Stewart LLP

20070099822 - Regulation of tissue mineralization and phosphate metabolism by asarm peptides: Disclosed are methods and compositions for treating diseases and conditions involving abnormal serum phosphorus levels and diseases and conditions involving abnormal mineralization levels of bone, teeth, and soft tissues. Also disclosed are methods and compositions for treating cancer and cancer metastasis.... Agent: Needle & Rosenberg, P.C.

20070099823 - Inhibitors of sporeforming pathogens and applications of the same: An inhibitor of sporeforming pathogens or agents. In one embodiment, the inhibitor has at least one glycoconjugate that is bondable to a sporeforming pathogen or agent. The glycoconjugate is a molecule containing a carbohydrate moiety that is glycosylated. The glycosylated carbohydrate moiety may comprise a glycoprotein or a glycolipid. In... Agent: Morris Manning Martin LLP

20070099824 - Treatments which alleviate functional glycosylated leptin transport factor, for controlling weight and obesity: Methods and compounds for treating obesity and inducing weight loss use a functional, glycosylated leptin transport factor (LTF) polypeptide, referred to as fn/glyLTF. An unstable defective version of the LTF protein, referred to herein as def/LTF, is present in freshly-drawn blood from obese animals or people; it is degraded rapidly... Agent: Senniger Powers

20070099825 - Hepatitis c virus inhibitors: t

20070099833 - Albumin fusion proteins: The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20070099828 - Biomarkers for the efficacy of calcitonin and parathyroid hormone treatment: A mufti-organ gene profiling analysis of the results of an administration to a subject of salmon calcitonin or a parathyroid hormone analogue provides biomarkers of calcitonin treatment efficacy and parathyroid hormone or parathyroid hormone analogue treatment efficacy. Among the biomarkers are the expression profiles of the genes for Y-box binding... Agent: Novartis Corporate Intellectual Property

20070099832 - Combination therapy with p38 map kinase inhibitors and their pharmaceutical compositions: The present invention relates to pharmaceutical combinations therapies based on p38 kinase inhibitors and another active ingredient, pharmaceutical compositions comprising such combinations, processes for preparing them and their use in the treatment of cytokine mediated diseases.... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070099834 - Compositions and methods related to anti-fgf agents: The invention relates to an isolated amino acid that can act as an antagonist to FGF signaling, comprising at least a portion of the FGF protein amino acid sequence, and including a mutation in either a) the integrin αvβ3 binding region of FGF-1; or b) the FGFR binding region of... Agent: Mcdonough, Holland & Allen

20070099829 - Method to prevent accelerated atherosclerosis using (srage) soluble receptor for advanced glycation endproducts: The present invention provides for a method to prevent accelerated atherosclerosis in a subject predisposed thereto which comprises administering to the subject a polypeptide derived from soluble receptor for advanced glycation endproduct in an amount effective to prevent accelerated atherosclerosis in the subject. The present invention also provides for a... Agent: Cooper & Dunham LLP

20070099837 - Methods of increasing cartilage deposition using fgf homologs: The present invention relates to methods of using zFGF5 compositions to proliferate chondrocytes and their progenitors, and to induce deposition of cartilage. zFGF5 compositions are disclosed for treating disorders associated with chondrocytes, such as cartilage injuries and defects. In addition, methods for treating neurological disorders, such as stroke, are disclosed,... Agent: Zymogenetics, Inc. Intellectual Property Department

20070099831 - Parathyroid hormone analogues and methods of use: The present invention is directed to novel methods of treating a subject with a bone deficit disorder. The methods generally include administering to a subject in need thereof a pharmaceutically acceptable formulation comprising a parathyroid hormone (PTH) peptide analogue in a daily dose of 2 μg to 60 μg, wherein... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.C.

20070099827 - Sialogogue, oral composition and fool product containing the same: A sialogogue characterized by comprising polyglutamic acid or its salt. This sialogogue is blended into an oral composition and a food product. This sialogogue is capable of rendering the oral mucosa pleasant even in the case of severe xerostomia.... Agent: Birch Stewart Kolasch & Birch

20070099830 - Sirt4 activities: It has been discovered that Sirt4 possesses an ADP-ribosyltransferase activity. Sirt4 is localized to mitochondria, where it binds to and regulates the activity of proteins such as glutamate dehydrogenase. The ADP-ribosyltransferase activity of Sirt4 is important for the regulation of biological functions such as insulin secretion. Methods of screening for... Agent: Fish & Richardson PC

20070099835 - Sustained release glp-1 receptor modulators: The present invention provides novel pharmaceutical compositions comprising a human glucagon-like peptide-1 (GLP-1)-receptor modulator as an active ingredient in a sustained release formulation.... Agent: Louis J. Wille Bristol-myers Squibb Company

20070099826 - Treatment of diseases associated with the egr-1 enhancer element: Compounds and methods are provided for treating patients suffering from health condition associated with an expression state of a gene such as fertility disorders, cancer, proliferative diseases, vascular diseases, wounds requiring therapeutic intervention, inflammation, and pulmonary disorders by administering to said patient a compound capable of modulating egr-1 and/or an... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20070099836 - Use of leptin for treating human lipoatrophy and method of determining predisposition to said treatment: Leptin, leptin analogs, and leptin derivatives are used to treat patients with lipoatrophy. Leptin is effective against conditions of lipoatrophy for both genetic and acquired forms of the disease. A therapeutically effective amount of leptin can be administered in a variety of ways, including subcutaneously and using gene therapy methods.... Agent: Intellectual Property Department Amylin Pharmaceuticals, Inc.

20070099838 - Plant-derived peptides harboring water-cleaning and antimicrobial activities: Protein family derived from the protein defined by the amino acid sequence of QGPGRQPDFQRCGQQLRNISPPQRCPSLRQAVQLTHQQQGQVGPQQVRQMYRVAS NIPST (SEQ ID NO:6) is described.... Agent: Nixon & Vanderhye, PC

20070099840 - Hydrogel compositions: Hydrogel compositions comprise an aqueous dispersion phase and a plurality of peptides, or derivatives, or analogues thereof. Each peptide comprises at least two amino acid residues and an aromatic stacking ligand and the hydrogel is formed by self-assembly of said peptides in said aqueous dispersion medium. The aqueous dispersion phase... Agent: Davis Wright Tremaine LLP

20070099839 - Inhibitors of cell migration: The present invention concerns peptide compounds, which were found to bind to the αM integrin I-domain and inhibit its complex formation with proMMP-9, thereby preventing neutrophil migration. The compounds comprise the hexapeptide motif HFDDDE. The compounds can be used in prophylaxis and treatment of inflammatory conditions.... Agent: Birch Stewart Kolasch & Birch

20070099841 - Prodrugs of t3 and t4 with enhanced bioavailability: The invention relates to compositions of amino acid and peptide conjugates comprising T3 and/or T4. The T3 or T4 is covalently attached to at least one amino acid via the N-terminus, the C-terminus, a side chain of the peptide carrier, and/or interspersed within the peptide chain. Also discussed are methods... Agent: Hunton & Williams LLP Intellectual Property Department

20070099843 - Nutritional supplement for the enhancement of the health of the liver: Compositions, systems, and methods of enhancing the health of the liver are disclosed. The synergistic effect of N-acetylcysteine, glutathione, vitamin C and vitamin E is to counteract the toxic effects of analgesics such as acetaminophen on the liver. Also disclosed is an enteric coating material which may be used with... Agent: Knobbe Martens Olson & Bear LLP

20070099842 - Tripeptides and derivatives thereof for cosmetic application in order to improve skin structure: The invention relates to compounds and to the cosmetically acceptable salts thereof, which correspond to general formula (I), wherein: R1 represents H, —C(O)—R6, —SO2—R6 or —C(O)—XR6; R2 and R4, independent of one another, represent (CH2)n—NH2 or (CH2)3—NHC(NH)NH2; n equals 1 4; R3 represents linear or branched C1-C4 alkyl that is... Agent: Hoffmann & Baron, LLP

20070099846 - Composition containing dipeptide of histidine and alanine for reducing uric acid and method for reducing uric acid using the dipeptide: The present invention relates to a composition comprising an effective amount or an effective amount of one or more dipeptides consisting of histidine or the functional equivalent thereof and alanine or the functional equivalent thereof for reducing uric acid in a subject. The invention also provides a method for the... Agent: Ladas & Parry

20070099845 - Compounds for delivering amino acids or peptides with antioxidant activity into mitochondria and use thereof: Disclosed are compounds containing single amino adds, peptides, or derivatives thereof which have the potential to express anti-oxidant activity capable of reducing reactive oxygen species in cells. These compounds may be used to inhibit oxidative stress-induced cell injury or death both in vivo and ex vivo. In addition, methods for... Agent: Licata & Tyrrell P.C.

20070099844 - Novel methods for the treatment of cancer: Compositions and methods for the treatment of malignancy and chronic viral infection are disclosed.... Agent: Dann, Dorfman, Herrell & Skillman

20070099849 - Co-therapy for the treatment of migraine comprising anticonvulsant derivatives and anti-migraine agents: The present invention describes a method for the treatment and/or prevention of migraine and associated symptoms (nausea, vomiting, photophobia, phonophobia, etc.) comprising co-therapy with a therapeutically effective amount of one or more anti-migraine agents and one or more anticonvulsant derivatives.... Agent: Philip S. Johnson Johnson & Johnson

20070099848 - Rapamycin carbohydrate derivatives: This invention provides modified rapamycins that have specific monosaccharide(s), oligosaccharide(s), pseudosugar(s) or derivatives thereof attached through a linker to create rapamycin carbohydrate derivatives having enhanced pharmacokinetic and/or pharmacodynamic profiles. For example, administration of the rapamycin carbohydrate derivative results in altered pharmacokinetic profiles and reduced toxicities. Thus, the present invention provides... Agent: Isotechnika Inc.

20070099847 - Tyrosine kinase receptor antagonists and methods of treatment for pancreatic and breast cancer: A method of treatment is disclosed whereby cancer cells are brought into contact with a formulation comprising an inhibitor of tyrosine kinase receptors. The formulation may be comprised of an injectable carrier and two or more tyrosine kinase receptor inhibitors which may be nordihydrogluaiaretic acid (NDGA) and doxyrubicine.... Agent: Bozicevic, Field & Francis LLP

20070099850 - Combination of acetylsalicylic acid and alpha-glucosidase inhibitors: The invention relates to a combination of acetylsalicylic acid (component A) with an alpha-glucosidase inhibitor (component B) for the prevention of cardiovascular disorders.... Agent: Jeffrey M. Greenman

20070099851 - Stable analogues of ribose-1-phosphate and methods for treating diabetes and other metabolic disorders: Novel D-ribose-1-phosphate analogue compounds of formula I, pharmaceutically acceptable prodrugs and salts thereof, and their use as hypoglycemic agents and anticancer agents and regulators of carbohydrate metabolism are useful for the treatment of diabetes in humans and for the treatment of various metabolic disorders that involve the regulation of cellular... Agent: Gregory Linn

20070099852 - Cucurbitacin compounds: Cucurbitacins, cucurbitacin derivatives, and methods for making and using the same are provided.... Agent: Crompton, Seager & Tufte, LLC

20070099853 - Agent for improving physiological motor functions: The present invention provides an agent for improving physiological motor functions which is characterized in containing proanthocyanidin as an effective ingredient. It is useful as an agent for preventing and improving the fatigue in which rise in lactic cid value upon physical exercise is suppressed whereby muscular fatigue is reduced... Agent: Drinker Biddle & Reath (dc)

20070099854 - Use of pentadienoic acid derivatives for the treatment of hyperuricemia: The use of a pentadienoic acid derivative of formula (I) for the preparation of a medicament for the prevention or treatment of hyperuricemia and/or one or several associated disorders or diseases, and/or for reducing the serum uric acid level of a subject. Medical compositions for these prevention and/or treatment, comprising... Agent: Millen, White, Zelano & Branigan, P.C.

20070099855 - Glycyrrhizin or derivatives thereof for for treating or preventing severe acute respiratory syndrome (sars): The invention provides methods for preventing, treating, managing or ameliorating viral infections, in particular, Severe Acute Respiratory Syndrome (SARS). More specifically, the invention provides methods for preventing, treating, managing or ameliorating a SARS-associated coronavirus or one or more symptoms thereof by administering Glycyrrhizin and/or derivatives thereof The invention also provides... Agent: Fulbright & Jaworski L.L.P.

20070099856 - Combined treatment with docetaxel and an epidermal growth factor receptor kinase inhibitor using an intermittent dosing regimen: The present invention provides a method for treating tumors or tumor metastases in a patient, comprising administering to the patient a therapeutically effective amount of an EGFR kinase inhibitor and docetaxel combination, with or without additional agents or treatments, such as other anti-cancer drugs or radiation therapy, wherein the EGFR... Agent: Osi Pharmaceuticals, Inc.

20070099860 - Compositions and methods for inhibiting expression of huntingtin gene: The invention relates to a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of the Huntingtin gene (HD gene), comprising an antisense strand having a nucleotide sequence which is less than 25 nucleotides in length and which is substantially complementary to at least a part of the HD gene. The... Agent: Fish & Richardson PC

20070099857 - Methods and means for inhibiting fever: Microsomal prostaglandin E synthase-1 (m PGES-1) catalyses the terminal step in the synthesis of prostaglandin E2 (PGE2) in the brain. In the absence of mPGES-1, animals do not develop immune-induced fever, but retain a normal pyretic response to central administration of PGE2. Inhibitors of PGES-1 can be used for treating... Agent: Nixon & Vanderhye, PC

20070099861 - Nucleic acid and amino acid sequences relating to streptococcus pneumoniae for diagnostics and therapeutics: The invention provides isolated polypeptide and nucleic acid sequences derived from Streptococcus pneumoniae that are useful in diagnosis and therapy of pathological conditions; antibodies against the polypeptides; and methods for the production of the polypeptides. The invention also provides methods for the detection, prevention and treatment of pathological conditions resulting... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20070099859 - Phosphorus protecting groups: In certain embodiments of the invention, novel compositions having a phosphorus group and a phosphorus protecting group bound to the phosphorus group are provided, and methods of deprotecting the phosphorus group are provided.... Agent: Agilent Technologies Inc.

20070099858 - Rna interference mediated of inhibition of influenza virus gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating influenza virus gene expression using short interfering nucleic acid (siNA) molecules. In particular, the instant invention features small nucleic acid molecules, such as short interfering nucleic acid (siNA), short interfering RNA (siRNA), double-stranded RNA (dsRNA), micro-RNA (miRNA), and short... Agent: Mcdonnell Boehnen Hulbert & Berghoff LLP

20070099862 - Sirna targeting carbonic anhydrase ii: Efficient sequence specific gene silencing is possible through the use of siRNA technology. By selecting particular siRNAs by rationale design, one can maximize the generation of an effective gene silencing reagent, as well as methods for silencing genes.... Agent: Kalow & Springut LLP

20070099863 - Compounds for the treatment of demyelinating and autoimmune diseases: The present invention is related to the treatment of demyelinating and autoimmune diseases, more particularly with the treatment of multiple sclerosis. The treatment consists of the administration of P2X purinergic receptors antagonist substances which cause a remission of the symptoms common to these types of diseases. This is demonstrated in... Agent: Ostrolenk Faber Gerb & Soffen

20070099865 - Treatment of dry eye conditions: The present invention provides a method for treating dry eye condition in an individual comprising administrating to said individual an amount of A3 adenosine receptor (A3AR) agonist, the amount being effective to ameliorate symptoms of dry eye in the individual. In accordance with one embodiment, the dry eye condition is... Agent: Nath & Associates

20070099864 - Use of o-atp for the treatment of diseases involving angiogenesis: The use of o-ATP as a pharmacological agent useful for the treatment of diseases in whose onset or progression angiogenesis is involved, such as ocular diseases, atherosclerotic processes or tumors.... Agent: Young & Thompson

20070099866 - Stable pharmaceutical compositions of 5,10-methylene tetrahydrofolate: This invention relates to stable pharmaceutical compositions of 5,10-methylene-(6R)-, -(65)- or -(6R,S)-tetrahydrofolate by adjusting to a basic pH and the simultaneous use of citrate. Stabilisation is effected even in the absence of a reducing agent. The present invention is particularly suitable for producing lyophilisation solutions and lyophilisates or dry powders... Agent: Millen, White, Zelano & Branigan, P.C.

20070099868 - Oxidized lipids and uses thereof in the treatment of inflammatory diseases and disorders: Novel synthetic oxidized lipids and methods utilizing oxidized lipids for treating and preventing an inflammation associated with an endogenous oxidized lipid are provided.... Agent: Martin D. Moynihan Prtsi, Inc.

20070099867 - Pharmaceutical agent containing hyaluronan as an active ingredient: A pharmaceutical composition containing hyaluronan as an active ingredient is provided. A preferred hyaluronan is a tetrasaccharide (HA4) containing 2 units, with a single unit being -D-glucuronic acid-β-1,3-D-N-acetylglucosamine-β-1,4-.... Agent: Tarolli, Sundheim, Covell & Tummino L.L.P.

20070099869 - Association product of α-glycosyl α,α-trehalose with ionic metal compound: The present invention has an object to provide a composition of metal ion compound whose inherent and unsatisfactory properties for its industrial application such as deliquescence, reducing power, oxidizing power, low solubility in water, etc., have been improved; and their preparations and uses. The present invention solves the above object... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20070099870 - Lipid analogs for combating tumors: The invention relates to methods of treating viral infections, and in particular hepatitis B virus. The method comprises administering to a subject in need of such treatment an infection-controlling amount of a phospholipid or phospholipid derivative to inhibit the activity of the viral infection.... Agent: Morgan Lewis & Bockius LLP

20070099871 - Bioreductively-activated prodrugs: The present invention relates to a compound of formula (1), or a pharmaceutically acceptable salt thereof, wherein: Ar is a substituted aryl or heteroaryl group bearing at least one nitro or azido group or is a group of formula (2) or (3) wherein R1, and R2, which may be the... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20070099872 - Functionally selective alpha2c adrenoreceptor agonists: In its many embodiments, the present invention provides a novel class of indolines as inhibitors of α2C adrenergic receptor agonists, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment, prevention, inhibition,... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20070099873 - Quinolines useful as modulators of ion channels: The present invention relates to compounds useful as inhibitors of ion channels. The invention also provides pharmaceutically acceptable compositions comprising the compounds of the invention and methods of using the compositions in the treatment of various disorders.... Agent: Vertex Pharmaceuticals Inc.

20070099874 - Methods and compositions of novel triazine compounds: The present invention relates to methods and compositions comprising compounds that treat pathophysiological conditions arising from inflammatory responses. In particular, the present invention is directed to compounds that inhibit or block glycated protein produced induction of the signaling-associated inflammatory response in endothelial cells. The present invention relates to compounds that... Agent: Dr. Reddy's Laboratories, Inc.

20070099875 - Aspartyl protease inhibitors: Also disclosed is the method of inhibiting aspartyl protease, and in particular, the methods of treating cardiovascular diseases, cognitive and neurodegenerative diseases, and the methods of inhibiting of Human Immunodeficiency Virus, plasmepins, cathepsin D and protozoal enzymes. Also disclosed are methods of treating cognitive or neurodegenerative diseases using the compounds... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20070099876 - Target directed chemotherapy of tumours of the sexual organs: The invention relates to dialkyltriazene-bearing estrogens and anti-estrogens that are suited for use as chemotherapeutic drugs for treating carcinomas of the sexual organs of humans and animals.... Agent: J C Patents

20070099877 - N-aryl-thienopyrimidin-4-amines and analogs as activators of caspases and inducers of apoptosis and the use thereof: wherein Ar and R1-R4 are defined herein. The present invention relates to the discovery that compounds having Formulae I-II are activators of caspases and inducers of apoptosis. Therefore, the activators of caspases and inducers of apoptosis of this invention may be used to induce cell death in a variety of... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070099878 - Use of porphyrin synthesis substances for carrying out phototherapy and for curing skin and articulation diseases: The invention relates to the use of porphyrin synthesis substances, in particular 5-amonolevulinic acid, if necessary in combination with salicylates in the form of acetylsalicyc acid and with antioxydising agents in the form of ascorbic acid when a phototherapy is carried out with a light emission whose wavelength ranges from... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070099879 - Method of using calcitriol for treating intraocular diseases associated with angiogenesis: The present invention provides a method of treating pathologies resulting from neovascular growth in the eye such as those manifested as retinopathy of prematurity, diabetic retinopathy and macular degeneration. The invention comprises the administration of an effective amount of calcitriol that is administered at doses less than toxicity and results... Agent: Godfrey & Kahn, S.c.

20070099880 - Estrogen receptor modulators: The present invention relates to compounds and derivatives thereof, their synthesis, and their use as estrogen receptor modulators. The compounds of the instant invention are ligands for estrogen receptors and as such may be useful for treatment or prevention of a variety of conditions related to estrogen functioning including: bone... Agent: Merck And Co., Inc

20070099881 - Method of treating wounds by enhancing expression of procollagen: The present invention provides methods for identifying compounds useful for the treatment of wounds by determining whether the compound increases the expression of type I procollagen and/or type III procollagen by human fibroblasts cultured in the presence of collagen. The present invention also provides methods for treating wounds by applying... Agent: Kenyon & Kenyon LLP

20070099882 - Methods and compositions for prolonged alleviation of articular joint pain: The methods and compositions for prolonged alleviation of articular, synovia, and connective tissue joint pain include treatment solutions that are prepared and administered into the joint space or cavity of a painful (arthritic) or connective tissue target of the patient. The compositions include Procaine and at least two corticosteroids for... Agent: Patton Boggs, L.L.P.

20070099883 - Anhydrous mometasone furoate formulation: A stable pharmaceutical composition of anhydrous mometasone furoate, and methods for its preparation, are described.... Agent: Pearne & Gordon LLP

20070099885 - Antibacterial macrocycles with substituted biphenyl: The invention relates to antibacterial macrocycles with substituted biphenyl and processes for their preparation, their use for the treatment and/or prophylaxis of diseases, and their use for the production of medicaments for the treatment and/or prophylaxis of diseases, especially of bacterial infections.... Agent: Morrison & Foerster LLP

20070099884 - Combination therapy for the treatment of diabetes: The present invention relates to compositions comprising an anti-obesity agent and an anti-diabetic agent useful for the treatment of diabetes, diabetes associated with obesity and diabetes-related disorders. The present invention further relates to methods of treating or preventing obesity, and obesity-related disorders, in a subject in need thereof by administering... Agent: Merck And Co., Inc

20070099886 - Multifunction \"crown complexes\" from amino acids and peptides for skin and hair restoration: This invention relates to Schiff's bases derived from amino acids and hydroxyaryl alkyl ketones, or a plant extract containing the same, having general chemical structure in FIG. 1 for topical application. This invention also relates to certain metal complex of said Schiff's bases, which have a crown-like appearance in their... Agent: Shyam K. Gupta Bioderm Research

20070099888 - Inflammation inhibitor comprising zinc salt of acylamino acid: An inflammation inhibitor for the skin is provided containing a zinc salt of an acylamino acid and further, a cosmetic containing the inflammation inhibitor.... Agent: Cermak & Kenealy LLP Acs LLC

20070099887 - Photodynamic therapy for the treatment of prostatic conditions: The present invention relates to a photodynamic method of treating prostatic disorders such as BPH. The method comprises: (i) delivering photosensitizer directly into prostatic tissue of a patient suffering from or suspected of suffering from a prostatic disorder; and (ii) irradiating the prostatic tissue with a light at a wavelength... Agent: Morrison & Foerster LLP

20070099889 - Use of pseudan and pseudan inclusion bodies: The present invention provides compositions and methods for reducing and/or inhibiting biofilm formation using a pseudan inclusion body.... Agent: Millen, White, Zelano & Branigan, P.C.

20070099890 - Novel cephalosporin derivatives, its pharmaceutically acceptable salts and manufacturing process thereof: Disclosed herein are novel cephalosporin compounds, pharmaceutically acceptable salts thereof, and a method for preparing the compounds. The compounds show superior antibacterial activity against a wide variety of gram-positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA) strain. Accordingly, the compounds can be effectively used as antibiotics.... Agent: Nath & Associates

20070099891 - Medicinal compositions and combinations: or a salt thereof etc.; or a combination of (A) and (B), which is effective for a therapy of a patient who are not remedied by the current therapeutic agent, i.e. being not decreased to the desired level, in particular a patient having already suffered from a coronary heart disease... Agent: Birch Stewart Kolasch & Birch

20070099893 - Cathepsin cysteine protease inhibitors: This invention relates to a novel class of compounds which are cysteine protease inhibitors, including but not limited to, inhibitors of cathepsins K, L, S and B. These compounds are useful for treating diseases in which inhibition of bone resorption is indicated, such as osteoporosis.... Agent: Merck And Co., Inc

20070099892 - Cyanomethyl substituted thiazoliums and imidazoliums and treatments of disorders associated with protein aging: Provided, among other things, is a compound of the formula:... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.C.

20070099895 - 1-amino-phthalazine derivatives, the preparation and the therapeutic use thereof: o

20070099896 - Substituted imidazo[1,2-a]pyridine compounds and pharmaceutical preparations containing substituted imidazo[1,2-a]pyridine compounds: Substituted imidazo[1,2-a]pyridine compounds, a process for the production thereof, pharmaceutical preparations containing such compounds and methods of using such substituted imidazo[1,2-a]pyridine compounds to treat and/or inhibit various diseases or pathological conditions.... Agent: Crowell & Moring LLP Intellectual Property Group

20070099897 - Therapeutic compounds: b

20070099894 - Thienopyridone derivatives as kinase inhibitors: A series of thieno[2,3-b]pyridin-6(7H)-one derivatives, substituted in the 2-position by a carbonyl- or sulfonyl-linked pyrrolidin-1-yl or related moiety, being inhibitors of p38 MAP kinase, are accordingly of use in medicine, for example in the treatment and/or prevention of immune or inflammatory disorders.... Agent: Woodcock Washburn LLP

20070099898 - Heterocyclic aspartyl protease inhibitors: Also disclosed is the method of inhibiting aspartyl protease, and in particular, the methods of treating cardiovascular diseases, cognitive and neurodegenerative diseases. Also disclosed are methods of treating cognitive or neurodegenerative diseases using the compounds of formula I in combination with a cholinesterase inhibitor or a muscarinic m1 agonist or... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20070099899 - Heterocyclic dihydropyrimidine compounds: Novel heterocyclic dihydropyrimidine compounds useful as inhibitors of potassium channel function (especially inhibitors of the Kv1 subfamily of voltage gated K+ channels, especially inhibitors Kv1.5 which has been linked to the ultra-rapidly activating delayed rectifier K+ current IKur), methods of using such compounds in the prevention and treatment of arrhythmia... Agent: Louis J. Wille Bristol-myers Squibb Company

20070099900 - Methods of modulating neurotrophin-mediated activity: Disclosed are compositions which modulate the interaction with nerve growth factor and precursors thereof with neurotrophic receptors. Also disclosed are methods of using the compositions of the invention, including methods of administration.... Agent: Lahive & Cockfield, LLP

20070099901 - Hydroxylamine and oxime substituted imidazoquinolines, imidazopyridines, and imidazonaphthyridines: Imidazo-quinoline, -pyridine, and -naphthyridine ring systems substituted at the 1-position, pharmaceutical compositions containing the compounds, intermediates, and methods of use of these compounds as immunomodulators, for inducing cytokine biosynthesis in animals and in the treatment of diseases including viral and neoplastic diseases are disclosed.... Agent: 3m Innovative Properties Company

20070099905 - Combinations of drugs for the treatment of neoplasms: The invention features a method for treating a patient having a cancer or other neoplasm by administering to the patient two compounds simultaneously or within 14 days of each other in amounts sufficient to treat the patient.... Agent: Clark & Elbing LLP

20070099904 - Pharmaceutical composition for the treatment of cns and other disorders: e

20070099903 - Selected cgrp antagonists, processes for preparing them and their use as pharmaceutical compositions: wherein R1, R2, R3 and R4 are defined as in claim 1, the tautomers, the isomers, the diastereomers, the enantiomers, the hydrates thereof, the mixtures thereof and the salts thereof and the hydrates of the salts thereof, particularly the physiologically acceptable salts thereof with inorganic or organic acids or bases,... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070099902 - Unitary pharmaceutical dosage form: In accordance with this invention a novel pharmaceutical product containing efavirenz, emtricitabine and tenofovir DF are provided as a multicomponent unitary oral dosage form, component 1 comprising tenofovir DF (and, optionally, emtricitabine) and component 2 comprising efavirenz, wherein components 1 and 2 are in a stabilizing configuration. In preferred embodiments... Agent: Intellectual Property Department Gilead Sciences, Inc.

20070099906 - Combinations for the treatment of noeplastic disorders: The invention features a method for treating a patient having a cancer or other neoplasm by administering to the patient two compounds simultaneously or within 14 days of each other in amounts sufficient to treat the patient.... Agent: Clark & Elbing LLP

20070099907 - Use of meloxicam in combination with an antiplatelet agent for treatment of acute coronary syndrome and related conditions: The invention relates to a method of treatment or prevention of acute coronary syndrome or related conditions or reducing the risk of cardiovascular events comprising the administration of a therapeutically or prophylactically effective amount of meloxicam in combination with a therapeutically or prophylactically effective amount of an antiplatelet agent to... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070099908 - Arylsulfonyl chromans as 5-ht6 inhibitors: e

20070099909 - N-(2-arylethyl)benzylamines as antagonists of the 5-ht6 receptor: The present invention provides compounds of formula (I), which are antagonists of the 5-HT6 receptor.... Agent: Eli Lilly & Company

20070099910 - Pyridopyrimidinones: The invention relates to compounds of formula (I) wherein R1, R2, R3, R4, R5, R6, R7, R8, R9, X and X′ have the designations cited in patent claim 1. Said compounds are inhibitors of tyrosine kinases, especially TIE-2, and Raf kinases, and can, inter alia, be used for the treatment... Agent: Ronald J. Kamis Baker & Daniels

20070099911 - Pyrroloquinolinone derivatives as 5-hydroxytryptamine-6 ligands: The present invention provides a compound of formula I and the use thereof in the therapeutic treatment of a central nervous system disorder related to or affected by the 5-HT6 receptor.... Agent: Wyeth Patent Law Group

20070099912 - Pyrrolo[2,3-f] and [3,2-f]isoquinolinone derivatives as 5-hydroxytryptamine-6 ligands: The present invention provides a compound of formula I or II and the use thereof in the therapeutic treatment of a central nervous system disorder related to or affected by the 5-HT6 receptor.... Agent: Wyeth Patent Law Group

20070099914 - Piperidine derivatives: The present invention relates to methods for treatment of inflammatory diseases of the bladder.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475

20070099913 - Pyrrolidinyl beta-amino amide-based inhibitors of dipeptidyl peptidase iv and methods: e

20070099916 - Indolyl derivatives as liver-x-receptor (lxr) modulators:

20070099915 - Inhibitors of the hiv integrase enzyme:

20070099917 - Novel inhibitors and methods for their preparation: The present invention relates to novel tyrosine kinase (TK) inhibitors in the form of prodrugs.... Agent: Scully Scott Murphy & Presser, PC

20070099918 - Use of inhibitors of the egfr-mediated signal transduction for the treatment of benign prostatic hyperplasia (bph) / prostatic hypertrophy: The present invention relates to the use of specific EGF-receptor antagonists for preparing a pharmaceutical composition for the prevention and/or treatment of benign prostatic hyperplasia and/or prostatic hypertrophy, a method for the treatment or prevention of benign prostatic hyperplasia/prostatic hypertrophy comprising administering an EGF-receptor antagonist of groups (A), (B) or... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070099919 - Composition and synthesis of new reagents for inhibition of hiv replication: The present invention provides compounds and compositions for inhibiting Vif and methods for treating viral infection, e.g., HIV infection.... Agent: Fish & Richardson PC

20070099920 - Benzimidazoles useful as inhibitors of protein kinases: The present invention relates to compounds useful as inhibitors of Aurora, FLT-3, or PDK1 protein kinase. The invention also provides pharmaceutically acceptable compositions comprising said compounds and methods of using the compositions in the treatment of various disease, conditions, or disorders. The invention also provides processes for preparing compounds of... Agent: Vertex Pharmaceuticals Inc.

20070099921 - Heteroaryl, heterocyclic and aryl compounds which inhibit leukocyte adhesion mediated by vla-4: Disclosed are compounds which bind VLA-4. Certain of these compounds also inhibit leukocyte adhesion and, in particular, leukocyte adhesion mediated by VLA-4. Such compounds are useful in the treatment of inflammatory diseases in a mammalian patient, e.g., human, such as asthma, Alzheimer's disease, atherosclerosis, AIDS dementia, diabetes, inflammatory bowel disease,... Agent: Foley & Lardner LLP

20070099922 - Sulfonylaminovalerolactams and derivatives thereof as factor xa inhibitors: s

20070099924 - Aminobenzimidazoles and benzimidazoles as inhibitors of respiratory syncytial virus replication: the prodrugs, N-oxides, addition salts, quaternary amines, metal complexes and stereochemically isomeric forms thereof, wherein G is a direct bond or C1-10alkanediyl optionally substituted with one or more hydroxy, C1-6alkyloxy, Ar1C1-6alkyloxy, C1-6alkylthio, Ar1C1-6alkylthio, HO(—CH2—CH2—O)n—, C1-6alkyloxy(—CH2—CH2—O)n— or Ar1C1-6alkyloxy(—CH2—CH2—O)n—; R1 is Ar1 or a monocyclic or bicyclic heterocycle; Q is hydrogen, amino... Agent: Philip S. Johnson Johnson & Johnson

20070099925 - Novel imidazo based heterocycles: e

20070099923 - Therapeutic agents: The present invention relates to compounds of formula (I); and pharmaceutically acceptable salts thereof, in which R1 and R2 independently represent phenyl, thienyl, pyridyl, C1-10alkyl, C1-10alkoxy or C3-15cycloalkyl; R3 represents a C1-15alkyl group, C3-15cycloalkyl, a phenylC1-4alkyl group, a heteroaryl group, a heteroarylC1-4alkyl group, or a group R4(CH2)n— in which R4... Agent: Morgan Lewis & Bockius LLP

20070099926 - Combination therapy for treating chronic inflammatory diseases: The present inventions is directed to a novel DMARD sparing method for treating chronic inflammatory diseases or conditions, such as rheumatoid arthritis, comprising the short-term administration of a disease modifying anti-rheumatic drug (DMARD) followed by reduction of the DMARD and co-administration of a cyclooxygenase-2 selective inhibitor or cessation of the... Agent: Merck And Co., Inc

20070099927 - Aminoalkyl-pyrazinones and-pyridones as thrombin inhibitors: e

20070099928 - Amine salts of (-)-2-{2-(4-hydroxyphenyl) ethyl]thio} -3-4-(2-{4-(methylsulfonyl) oxy phenyl propanoic acid and their use in medicine: A tert-butylamine salt, a piperazine salt, a choline salt, a tris(hydroxymethyl)methylamine salt, a lysine salt or an adamantylamine salt of (−)-2-{[2-(4-hydroxyphenyl)ethyl]thio}-3-[4(2-{4-[(methylsulfonyl)oxy]phenoxy}ethyl)phenyl]propanoic acid processes for their preparation, their use in treating clinical conditions including lipid disorders (dyslipidemias) whether or not associated with insulin resistance and other manifestations of the metabolic syndrome,... Agent: Morgan Lewis & Bockius LLP

20070099929 - Substituted thiophenes: The invention relates to substituted thiophenes and processes for their preparation, their use for the treatment and/or prophylaxis of diseases, and their use for the production of medicaments for the treatment and/or prophylaxis of diseases, especially for use as antiviral agents, in particular for hepatitis C viruses.... Agent: Morrison & Foerster LLP

20070099930 - Substituted dihydroisoindolones as allosteric modulators of glucokinase: e

20070099931 - Pharmaceutical dosage forms and compositions: The invention relates to, for example, novel formulations and methods for the delivery of 4-cyano-N-{(2R)—2-[4-(2,3-dihydro-benzo[1,4]dioxin-5-yl)-piperazin-1-yl]-propyl}-N-pyridin-2-yl-benzamide, pharmaceutically acceptable salts thereof, structurally related compounds and/or metabolites; as well as to use of these formulations and methods for treating disease.... Agent: Woodcock Washburn LLP

20070099932 - External preparation for athlete's foot treatment: External preparations for athlete's foot treatment capable of enhancing patient's compliance and capable of reducing the symptom of rube faction, comprising an anti-trichophton drug mixed with at least one compound selected from among 1-menthol, menthol analogue compounds and bactericidal compounds.... Agent: Licata & Tyrrell

20070099933 - Indole derivatives as serotonin reuptake inhibitors: Compounds of the formula (I), the use thereof for the preparation of a medicament for the treatment of diseases associated with the serotonin receptor and/or serotonin reuptake, in particular for the preparation of a medicament as anxiolytic, antidepressant, neuroleptic and/or antihypertonic and/or for positively influencing obsessive-compulsive disorder (OCD), sleeping disorders,... Agent: Millen, White, Zelano & Branigan, P.C.

20070099935 - Azole-based kinase inhibitors: A compound of general formula (I) or pharmaceutically acceptable prodrugs, salts, hydrates, solvates, crystal forms or diastereomers thereof is described. A method of treating kinase-associated disease states using the compound of formula (I) is also described.... Agent: Morrison & Foerster LLP

20070099936 - Dihydroisoindolones as allosteric modulators of glucokinase: c

20070099934 - N-aryl piperidine substituted biphenylcarboxamides as inhibitors of apolipoprotein b:

20070099937 - Substituted pyrrolones as allosteric modulators of glucokinase:

20070099938 - Antistress drug and medical use thereof: (wherein ringA is cyclic group which may have a substituent(s), Q is alkyl which may have a substituent(s) or cyclic ring which may have a substituent(s), ringD is cyclic ring which may have a substituent(s), W is a single bond or a spacer of which main chain has an atom... Agent: Sughrue Mion, PLLC

20070099939 - Fungicidal mixtures for controlling rice pathogens: h

20070099941 - N-arylalkyl-thienopyrimidin-4-amines and analogs as activators of caspases and inducers of apoptosis and the use thereof: wherein Ar, R1, R3, R4, R10-R12 and n are defined herein. The present invention relates to the discovery that compounds having Formula I are activators of caspases and inducers of apoptosis. Therefore, the activators of caspases and inducers of apoptosis of this invention may be used to induce cell death... Agent: Sterne, Kessler, Goldstein & Fox P.l.l.c.

20070099940 - Pth agonists: R6 is hydrogen, alkyl, aryl, alkylaryl, heterocycloalkyl, or heteroaryl and is unsubstituted or substituted by one or more groups selected from the group consisting of alkyl, C1-8alkoxy, aryl, heteroaryl, halogen, NO2, CN, N3, SCF3, and CF3, or when R1 and/or R2 contains S(O)2NR5R6, CONR5R6, or C(S)NR5R6, then R5R6 together with... Agent: Smithkline Beecham Corporation Corporate Intellectual Property-us, Uw2220

20070099942 - Aza nucleosides, preparation thereof and use as inhibitors of rna viral polymerases: R8 and R9 independently is H, NH2, OH, SH, F, Cl, Br, I, aryl, heterocycle, alkyl, alkene, alkyne, S-alkyl, S-aryl, S(O)-alkyl, SO2-alkyl, SO2NH2, SO2NH-alkyl, SO2NH-aryl, NH-alkyl, NH-aryl, N(alkyl)2, N(aryl)2, O-alkyl, O-aryl, O-heterocycle, NH-(CH2)n-aryl, NH—C(O)-alkyl, NH—C(O)-aryl are useful for inhibiting viral RNA polymerases and treating patients suffering from diseases caused by... Agent: Connolly Bove Lodge & Hutz LLP

20070099943 - Quinazoline derivatives: wherein R1 and R2 have any of the meanings defined in the description; processes for their preparation, pharmaceutical compositions containing them and their use in the manufacture of a medicament for use as an antiproliferative agent in the prevention or treatment of tumours which are sensitive to inhibition of erbB,... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20070099944 - Chemical compounds: The present invention relates to indazolo-tetrahydropyrimidine-carboxamide derivatives, compositions and medicaments containing the same, as well as processes for the preparation and use of such compounds, compositions and medicaments. Such indazolo-tetrahydropyrimidine-carboxamide derivatives are useful in the treatment of diseases associated with inappropriate ROCK-1 kinase.... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475

20070099945 - Novel tricyclic spiroderivatives as modulators of chemokine receptor acitivity: The invention provides compounds of formula (I) wherein m, R1, n, R2, q, p, X, Y, R3, R4, t and, R5 are as defined in the specification, processes for their preparation, pharmaceutical compositions containing them and their use in therapy.... Agent: Fish & Richardson P.C.

20070099947 - Methods and compositions for the treatment of brain reward system disorders by combination therapy: The present invention is directed to a combination treatment of an opioid antagonist e.g., naltrexone and a second compound selected from the group consisting of a GABA B agonist, an NMDA antagonist, a serotonin antagonist, and a cannabinoid antagonist is the key to the successful treatment of a brain reward... Agent: Elmore Patent Law Group, PC

20070099946 - Synthesis of r-n-methylnaltrexone: This invention relates to stereoselective synthesis of R-MNTX and intermediates thereof, pharmaceutical preparations comprising R-MNTX or intermediates thereof and methods for their use.... Agent: Wolf Greenfield & Sacks, PC

20070099948 - Camptothecin derivatives and improved synthetic methods: The present invention relates to compositions and methods for preparing pharmaceutical compositions. In some embodiments, the invention includes compounds and methods of resolving chiral compounds. In some embodiments, the invention includes chiral and crystalline compositions and hydrates. In some embodiments, the invention contemplates compositions comprising camptothecin derivatives and synthetic intermediates... Agent: Peter G. Carroll Medlen & Carroll, LLP

20070099949 - Method for improving the ability of patients suffering from lung diseases to participate in and benefit from pulmonary rehabilitation programs: A method for improving the ability of a patient suffering from a lung disease to participate in and benefit from a pulmonary rehabilitation program, the method comprising administering to the patient a therapeutically effective amount of a tiotropium salt.... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070099950 - Pyridin-4-ylamine compounds useful in the treatment of neuropathic pain: The present invention is directed to a method of use of triazolo-pyridazine compounds in the treatment of neuropathic pain. The present invention is also directed to the use of triazolo-pyridazine compounds in the treatment of psychiatric and mood disorders such as, for example, schizophrenia, anxiety, depression, bipolar disorders, and panic,... Agent: Merck And Co., Inc

20070099951 - 4-oxo-1-(3-substituted phenyl)-1,4-dihydro-1,8-naphthyridine-3-carboxamide phosphodiesterase-4 inhibitor and a method of preparing same: e

20070099952 - Hif-1 inhibitors: HIF-1 inhibitors and methods of their use are provided. In particular, 2,2-dimethylbenzopyran based compounds and methods of their use, for example in the treatment or prevention of hypoxia-related pathologies are provided.... Agent: Thomas, Kayden, Horstemeyer & Risley, LLP

20070099953 - Novel quinuclidine derivatives and medicinal compositions containing the same: F

20070099954 - Prodrugs of compounds that inhibit trpv1 receptor:

20070099955 - 3-piperidinylisochroman-5-ols as dopamine agonists: a stereoisomer or a pharmaceutically acceptable salt thereof, wherein the variables R1, R2, R3, R4, X and n are defined as defined herein. Additionally, a method for treating dopamine-related neurological disorders selected form the group consisting of neurological, psychological, cardiovascular, cognitive or attention disorders, substance abuse and addictive behavior, or... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC

20070099956 - Nitrogen-containing heterocyclic derivatives having 2, 6-disubstituted styryl: The invention provides a novel nitrogen-containing heterocyclic derivative having 2,6-disubstituted styryl and a pharmaceutically acceptable salt thereof, and a pharmaceutical composition comprising the nitrogen-containing heterocyclic derivative and a pharmaceutically acceptable salt thereof, in particular, a pharmaceutical composition effective as a sodium channel inhibitor, having an excellent analgesic action especially on... Agent: Sughrue Mion, PLLC

20070099957 - Diarylmethylidene piperidine derivatives, preparations thereof and uses thereof: Compounds of formula: (I) wherein R1, R2, R3, R4 and R7 are as defined in the specification, as well as salts, enantiomers thereof and pharmaceutical compositions including the compounds are prepared. They are useful in therapy, in particular in the management of pain.... Agent: Astra Zeneca Pharmaceuticals Lp Global Intellectual Property

20070099960 - Lxr receptor modulators: m

20070099959 - O-aminophenol derivatives and colorants containing these compounds:

20070099958 - Protease inhibitors: A peptidyl nitrile of the general formula (I) or a pharmaceutically acceptable salt or prodrug thereof, is capable of selectively inhibiting dipeptidyl-peptidase (DPP-I), also known as cathepsin C. A compound of the invention is useful as an active substance for the treatment of inflammation, type 2 diabetes, asthma, severe influenza,... Agent: Birch Stewart Kolasch & Birch

20070099961 - Method for producing bactericidal pyridine compound and bactericidal pyridine compound: wherein R1 and R4 may be the same or different and are each a linear or branched alkyl group having 1 to 4 carbon atoms; R2 and R5 are hydrogen atoms, or may be the same or different and are each a halogen atom, lower alkyl group or lower alkoxy... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070099962 - 5,6-dihydropyrin-2-one compounds useful as inhibitors of thrombin: There is provided a compound of formula (I) wherein R1, R2a, R2b, R3a, R3b, R4, R5, R6, A, G and L have meanings given in the description, which compounds are useful as, or are useful as prodrugs of, competitive inhibitors of trypsin-like proteases, such as trombin, and thus, in particular,... Agent: Astra Zeneca Pharmaceuticals Lp Global Intellectual Property

20070099963 - Nematicidal compositions and methods: A nematicidal composition includes (a) at least one carbamate and (b) at least one neonicotinoid and/or chloronicotinyle. In one exemplary embodiment, the carbamate can be an oxime carbamate, such as thiodicarb and the neonicotinoid can be a nitroguanidine. In one specific embodiment, the nitroguanidine includes imidacloprid and/or clothianidin. An exemplary... Agent: Bayer Cropscience Lp Patent Department

20070099964 - 1, 3, 4-oxadiazol-2-ones as peroxisome-proliferator activated receptor delta modulators and their use in the treatment of neurological and metabolic disease: n

20070099965 - 2-pyridinylethylbenzamide derivatives:

20070099966 - Device and method for inhibiting age complex formation: Various methods of administering medication(s) that inhibit the nonenzymatic formation of glycation and dehydration condensation complexes known as advanced glycation end-products (AGEs) or modulate the advanced glycation end-product receptor (RAGE) are provided. Also, a medication releasing medical devices, wherein at least a portion of the medical device releasably includes at... Agent: Kirkpatrick & Lockhart Preston Gates Ellis LLP

20070099967 - N-(2-((4-hydroxyphenyl)amino)pyridin-3-yl)-4-methoxybenzenesulfonamide crystalline form 1: N-(2-((4-Hydroxyphenyl)amino)pyridin-3-yl)-4-methoxybenzenesulfonamide Crystalline Form 1, ways to make it, compositions containing it and methods of treatment of diseases using it are disclosed.... Agent: Robert Deberardine Abbott Laboratories

20070099968 - Antiviral compounds and methods: The invention relates to compounds having antiviral activity and methods utilising the compounds to treat viral infections.... Agent: Edwards & Angell, LLP

20070099969 - Design and synthesis of optimized ligands for ppar: This invention provides new chemical entities useful for treating a variety of clinical disorders including those that are influenced by the activity of peroxisome proliferator activated receptors (PPAR). The structures of the compounds and methods to design, make and use the compounds are provided. Compounds and methods for administering therapeutic... Agent: Hunton & Williams/new York Intellectual Property Dept.

20070099970 - Immunomodulatory compounds that target and inhibit the py'binding site of tyrosene kinase p56 lck sh2 domain: Small molecular-weight non-peptidic compounds block Lck SH2 domain-dependent interactions. The inhibitors omit phosphotyrosine (pY) or related moieties.... Agent: Millen, White, Zelano & Branigan, P.C.

20070099971 - Neuroprotective agents: Novel stereoisomers of GS-164 are provided. The compounds, such as (3R,5S,7as)-(3,5-bis(4-fluorophenyl)tetrahydro-1H-oxazolo[3,4-c]oxazol-7a-yl)methanol (TH-237A) and (3R,5S,7as)-(3,5-bis(4-fluorophenyl)tetrahydro-1H-oxazolo[3,4-c]oxazol-7a-yl)methanol (TH-242A) exhibit neuroprotective effects via a mechanism that does not involve microtubule stabilization.... Agent: Stinson Morrison Hecker LLP Attn: Patent Group

20070099972 - Polymorphic forms of (s)-1-cyanobutan-2-yl (s)-1-(3-(3-(3-methoxy-4- (oxazol-5-yl)phenyl) ureido)phenyl) ethylcarbamate: The present invention relates to polymorphic forms of (S)-1-cyanobutan-2-yl (S)-1-(3-(3-(3-methoxy-4-(oxazol-5-yl)phenyl)ureido)phenyl)ethylcarbamate, pharmaceutical compositions thereof, processes to prepare therein, and uses therewith.... Agent: Vertex Pharmaceuticals Inc.

20070099973 - Process for preparation of irbesartan: e

20070099974 - (r)-2-(4-amidinophenylaminomethyl)-1-methyl-5-[1-(carboxymethylamino)-1(pyrrolidinocarbonyl)-ethyl]-benzimidazole, the monohydrochloride thereof, preparation thereof and the use as pharmaceutical composition: Crystalline forms of the compounds (R)-2-(4-amidinophenylaminomethyl)-1-methyl-5-[1 -(carboxymethylamino)-1-(pyrrolidinocarbonyl)-ethyl]-benzimidazole and the monohydrochloride thereof, processes for the preparation thereof and the use thereof as pharmaceutical compositions.... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20070099975 - Imidazole derivatives modulating the sodium channels: y

20070099976 - 3-3-di-substituted-oxindoles as inhibitors of translation initiation: Compositions and methods for inhibiting translation using 3-(5-tert-Butyl-2-Hydroxy-phenyl)-3-phenyl-1,3-dihydro-indol-2-one and/or its derivatives are provided. Compositions, methods and kits for treating (1) cellular proliferative disorders, (2) non-proliferative, degenerative disorders, (3) viral infections, and/or (4) disorders associated with viral infections, using 3-(5-tert-butyl-2-hydroxy-phenyl)-3-phenyl-1,3-dihydro-indol-2-one and/or its derivatives are described.... Agent: Banner & Witcoff, Ltd.

20070099977 - Conjugated psychotropic drugs and uses thereof: Novel chemical conjugates of psychotropic drugs and organic acids, uses thereof in the treatment of psychotic and/or proliferative disorders and diseases and as chemosensitizing agents, and their syntheses are disclosed. The organic acids are selected to reduce side effects induced by the psychotropic drugs and/or to exert an anti-proliferative activity.... Agent: Martin D. Moynihan Prtsi, Inc.

20070099979 - New pyrazole derivatives and diabetic medicine containing them: The present invention provides pyrazole-O-glycoside derivatives represented by the following formulae, used as a diabetic medicine.... Agent: Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20070099978 - Process for the preparation of 1,5 - carboxylic acid derivatives: e

20070099980 - Condensed indoline derivatives and their use as 5ht, in particular 5ht2c, receptor ligands: A chemical compound of formula (I) wherein R1 and R2 are independently selected from hydrogen and alkyl; R3 is alkyl; R4 and R5 are selected from hydrogen and alkyl; R6 and R7 are independently selected from hydrogen, halogen, hydroxyl, alkyl, aryl, amino, alkylamino, dialkylamino, alkoxy, aryloxy, alkylthio, alkylsulfoxyl, nitro, carbonitrile,... Agent: Foley And Lardner LLP Suite 500

20070099981 - Condensed indoline derivatives and their use as 5ht, in particular 5ht2c, receptor ligands: A chemical compound of formula (I) wherein R1 and R2 are independently selected from hydrogen and alkyl; R3 is alkyl; R4 and R5 are selected from hydrogen and alkyl; R6 and R7 are independently selected from hydrogen, halogen, hydroxyl, alkyl, aryl, amino, alkylamino, dialkylamino, alkoxy, aryloxy, alkylthio, alkylsulfoxyl, nitro, carbonitrile,... Agent: Foley And Lardner LLP Suite 500

20070099982 - Use of chp as an inhibitor of glutathione s-transferases and collagen iv: The invention relates to the use of cis-hydroxy proline for the inhibition of glutathione s-transferases and/or collagen IV, in addition to a method which is used to lower the concentration of glutathione s-transferase and/or collagen IV in vitro or in vivo, in addition to anti-collagen IV/collagen IV-lowerers or glutathione s-transferase... Agent: Joyce Von Natzmer Hvp LLP

20070099983 - Aminocyclohexyl ether compounds and uses thereof: Aminocyclohexyl ether compounds are disclosed. The compounds of the present invention may be incorporated in compositions and kits. The present invention also discloses uses for the compounds and compositions, including the treatment of arrhythmia.... Agent: Seed Intellectual Property Law Group PLLC

20070099984 - Prostaglandins and analogues as agents for lowering intraocular pressure: The present invention relates to cyclopentane heptenoic acid-5-cis-2-(3α-hydroxy or lower alkyloxy-5-thienylpentyl)-3, 5-dihydroxy, [1α, 2β, 3α, 5α] compounds, lower alkyl, hydroxyl lower alkyl and indole lower alkyl amides and esters thereof as potent ocular hypotensives that are particularly suited for the management of glaucoma.... Agent: Robert J. Baran (t2-7h) Allergan, Inc.

20070099985 - Heteroaromate osc inhibitors: The present invention relates to heteroaromate OSC inhibitors. The compounds are useful for the treatment and/or prophylaxis of diseases which are associated with 2,3-oxidosqualene-lanosterol cyclase such as hypercholesterolemia, hyperlipemia, arteriosclerosis, vascular diseases, mycoses, gallstones, tumors and/or hyperproliferative disorders, and treatment and/or prophylaxis of impaired glucose tolerance and diabetes.... Agent: Hoffmann-la Roche Inc. Patent Law Department

20070099986 - Preventives/remedies for urinary disturbance: (wherein Y represents methylene or an oxygen atom, R1 represents aminosulfonyl, C1-6 alkylaminosulfonyl, C1-6 alkylcarbonylamino or C1-6 alkylsulfonylamino, R2 represents a hydrogen atom or C1-6 alkyl, R3 represents C1-6 alkyl, and R4 represents a hydrogen atom or C1-6 alkyl); X represents a carbonyl group, or a methylene group which may... Agent: Wenderoth, Lind & Ponack, L.L.P.

20070099988 - Anti-emetic uses of (3r, 4r)-delta8-tetrahydrocannabinol-11-oic acids: The present invention relates to non-psychoactive derivatives of tetrahydrocannabinol, (3R,4R)-Δ8-THC-11-oic acids, for treating or preventing nausea and relieving symptoms thereof.... Agent: Foley And Lardner LLP Suite 500

20070099987 - Treating or preventing diabetes with cannabidiol: Use of a cannabidiol for the manufacture of a medicament identified for the treatment or prevention of diabetes and/or insulitis.... Agent: Martin D. Moynihan Prtsi, Inc.

20070099989 - Dronabinol treatment for migraines: In various embodiments, the present invention provides pharmaceutical compositions comprising delta-9-tetrahydrocannabinol and methods of administering such compositions to treat migraines.... Agent: Mayer, Brown, Rowe & Maw LLP

20070099990 - Cannabinoid receptor modulator:

20070099991 - Selective rxr ligands: The present invention includes novel retinoid compounds that have selectivity as RXR agonists on one or more isoforms of RXR, currently, RXRα, RXRβ, or RXRγ. The present compounds, and pharmaceutical compositions incorporating these compounds, therefore, are effective in treating conditions mediated by RXRs. Among other physiological responses, the compounds of... Agent: Glaxosmithkline Corporate Intellectual Property, Mai B475

20070099992 - Direct application of vitamin c to the lung tissue and respiratory passages by use of an asthma medication-type inhaler or similar inhaler: An asthma medication—type inhaler or any other type inhaler filled with an aqueous or any other type solution of sodium ascorbate or any other form of vitamin C.... Agent: Lynn Carol Nocella Kane

20070099993 - Antimicrobial and anticancer properties of methyl-beta-orcinolcarboxylate from lichen (everniastrum cirrhatum): The present invention relates to the new use of an already known biomolecule methyl-β-orcinol carboxylate of formula I isolated from a lichen (Everniastrum cirrhatum), for treating pathogenic fungal infections of humans that are resistant to polyene and azole antibiotics such as amphotericin B, nystatin, clotrimazole etc.... Agent: Ladas & Parry

20070099994 - Rosuvastatin calcium with a low salt content: Provided is rosuvastatin calcium with a low salt by product content and processes for preparing such rosuvastatin calcium.... Agent: Kenyon & Kenyon LLP

20070099995 - Use of hydroxyoleic acid and related compounds as functional food additives: Use of hydroxyoleic acid and its analogous compounds as functional food additives. It describes the use of hydroxyoleic acid and its analogs of general formula I: COOH—CHR—(CH?2#191)?m#191-CH═CH—(CH?2#191)?n#191-CH ?3#191, in which m and n have, independently, a valur of 0-15 and R can be any residue with molecular weight below 200... Agent: Ladas & Parry

20070099996 - Pharmaceutical compositions of acitretin: The present invention relates to stable pharmaceutical compositions of acitretin with significantly enhanced bioavailability characteristics. The pharmaceutical compositions include a micronized solid dispersion of acitretin with one or more surface modifiers. Also provided are processes of preparing the compositions by aqueous grinding or milling of acitretin in presence of a... Agent: Jayadeep R. Deshmukh

20070099997 - Potassium or sodium salt of (-)-2-{'2-(4-hydroxyphenyl) ethyl!-thio-3-'4-(2-{4-'(methylsulfonyl) oxy! phenoxy}ethyl) phenyl! propanoic acid and their use in medicine: A potassium salt or a sodium salt of (−)-2-{[2-(4-hydroxyphenyl)ethyl]thio}-3-[4-(2-{4-[(methylsulfonyl)oxy]phenoxy}ethyl)phenyl]propanoic acid, processes for their preparation, their use in treating clinical conditions including lipid disorders (dyslipidemias) whether or not associated with insulin resistance and other manifestations of the metabolic syndrome, and pharmaceutical compositions containing them.... Agent: Morgan Lewis & Bockius LLP

20070100000 - Methods of providing neuroprotection: Cognitive impairments are treated and cognition is improved with an amphetamine compound. In one embodiment, the method includes administering an 1-amphetamine compound. In another embodiment, the method includes administering an 1-methamphetamine compound.... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20070099999 - Methods of treating depression: Cognitive impairments are treated and cognition is improved with an amphetamine compound. In one embodiment, the method includes administering an 1-amphetamine compound. In another embodiment, the method includes administering an 1-methamphetamine compound.... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20070099998 - Processes for preparing cinacalcet hydrochloride crystal form i: The invention provides processes for the preparation of cinacalcet hydrochloride crystalline Form I.... Agent: Kenyon & Kenyon LLP

20070100001 - Use of r-enantiomer of n-propargyl-1-aminoindan, salts, compositions and uses thereof: The subject invention provides methods of treating a subject afflicted with Parkinson's disease, memory disorder, depression, hyperactive syndrome, Attention Deficit Disorder, dementia, brain ischemia, stroke, head trauma injury, spinal trauma injury, neurotrauma, neurodegenerative disease, neurotoxic injury, multiple sclerosis, nerve damage, affective illness, schizophrenia or symptoms of withdrawal from an addictive... Agent: Cooper & Dunham, LLP