Drug, bio-affecting and body treating compositions inventions 12/06

20060292072 - Agents for neutron capture therapy: Compounds, pharmaceutical formulations and methods for use in neutron capture therapy are provided, useful for treating diseases characterized by neoplastic tissue and arteriosclerosis.... Agent: Wilson Sonsini Goodrich & Rosati

20060292073 - Stereoselective synthesis of amino acid analogs for tumor imaging: The radiolabeled non-natural amino acid 1-amino-3-cyclobutane-1-carboxylic acid (ACBC) and its analogs are candidate tumor imaging agents useful for positron emission tomography and single photon emission computed tomography due to their selective affinity for tumor cells. The present invention provides methods for stereo-selective synthesis of syn-ACBC analogs. The disclosed synthetic strategy... Agent: Greenlee Winner And Sullivan P C

20060292074 - Tomoregulin antibodies and uses thereof: The present invention relates to antibodies, and antigen-binding antibody fragments, directed against a Tomoregulin (TR) polypeptide. The invention further relates to methods for utilizing the antibodies, and antibody fragments, for diagnostic and therapeutic applications.... Agent: Berlex Biosciences Patent Department

20060292075 - Labelled glutamine and lysine analogues: Synthetic analogues of lysine and glutamine are provided which function as substrates for the fibrin-stabilising enzyme Factor XIIIa even when labelled with a detectable moiety. The use of suitable protecting groups provides compounds which possess reduced susceptibility to in vivo metabolism especially by peptidases, and are hence useful agents for... Agent: Ge Healthcare, Inc.

20060292076 - Antimicrobial mediated ozone generation: The invention provides methods of detecting antibodies and neutrophils that can generate reactive oxygen species.... Agent: Schwegman, Lundberg, Woessner & Kluth, P.A.

20060292079 - Conjugates of hydroxypyridinone derivative metal complexes with biomolecules and their use for mri diagnosis: The invention relates to conjugates of hydroxypyridinone derivative metal complexes and to their preparation. The conjugates are suitable as contrast agents in NMR diagnosis. A high relaxivity is achieved and the NMRD maximum is raised through a specific design of the ligands.... Agent: Fish & Richardson P.C.

20060292077 - Dendritic and star-shaped contrast agents for medical devices and bioabsorbable radiopaque bulk material and method for producing same: In accordance with the present invention, a high intensity radiopaque contrast agent is disclosed. The agent may be coated on or incorporated within bulk material which may then be subsequently utilized to fabricate a radiopaque medical device. Primary effects through chemistry include higher radiopaque concentrations per unit weight of the... Agent: Philip S. Johnson Johnson & Johnson

20060292078 - Optical imaging of colorectal cancer: The invention provides contrast agents for optical imaging of colorectal cancer (CRC) in patients. The contrast agents may be used in diagnosis of CRC, for follow up of progress in disease development, and for follow up of treatment of CRC. Further, the invention provides methods for optical imaging of CRC... Agent: Ge Healthcare, Inc.

20060292080 - Vitamin formulation: A pharmaceutical aerosol foam composition, comprising: an effective amount of a pharmaceutically active ingredient, wherein said pharmaceutically active ingredient is a vitamin or analogue thereof; an occlusive agent; an aqueous solvent; an organic cosolvent; wherein the pharmaceutically active ingredient is insoluble in both water and the occlusive agent; and the... Agent: Townsend And Townsend And Crew, LLP

20060292082 - Dry powder inhaler: A dry powder inhaler for delivering a dose of medicament for inhalation by a user, including a drug entrainment device and a valve actuable by a user to cause pressurised gas to flow through a dose of medicament disposed in the drug entrainment device to entrain said dose in the... Agent: Davidson, Davidson & Kappel, LLC

20060292083 - Inhalation compositions with high drug ratios: The invention provides a dry powder inhalation composition comprising, at least 0.25% by weight of the composition of an active ingredient with a particle size of less than 10 microns in diameter and a pharmaceutically acceptable particulate carrier with a particle size of less than 250 microns in diameter. Also... Agent: Ivax Corporation

20060292085 - Medicaments: There is described a bimodal pharmaceutical composition comprising effective amounts of a first active ingredient which substantially comprises a coarse fraction and a second active ingredient which substantially comprise a fine fraction characterized in that the coarse fraction possesses a greater mass median aerodynamic diameter than the fine fraction. There... Agent: Nixon Peabody LLP - Patent Group

20060292081 - Methods for preparing pharmaceutical compositions: The present invention relates to improvements in dry powder formulations comprising a pharmaceutically active agent for administration by inhalation, and in particular to methods of preparing dry powder compositions with improved properties. In particular, spray drying processes are adapted and adjusted to obtain active particles with higher fine particle fractions... Agent: Davidson, Davidson & Kappel, LLC

20060292084 - Process for cleaning hard gelatine capsules: A process which can be used in the laboratory or on an industrial scale for cleaning the inner wall of hard gelatine capsules, in which the sealed capsules are cleaned with a powder formulation.... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20060292086 - Antimicrobial composition: An antimicrobial composition is provided. The antimicrobial composition has broad antimicrobial efficacy in a format convenient for no-rinse application to the skin. The composition dries quickly, leaves the skin smooth, comfortable and adequately moisturized. A method of making the antimicrobial composition, a method of sanitizing skin using the antimicrobial composition,... Agent: Foley And Lardner LLP Suite 500

20060292088 - Compositions and methods for altering the color of teeth: Compositions for altering the color of teeth, including tooth-coating compositions comprising a colorant and an acrylate polymer. Colorants among those useful herein include whiteness-imparting particulate materials, such as hydroxyapatite.... Agent: Colgate-palmolive Company

20060292087 - Dentrifrice and method of making the same: A dentifrice includes a carrier material and a plurality of particles in the carrier material. The plurality of particles includes multiple regions of different colored materials and an outer region which at least partially encapsulates the multiple regions of different colored materials. The multiple regions of different colored materials dissolve... Agent: Michael Winfield Goltry

20060292089 - Periodontal regeneration composition and method of using same: A periodontal structure regeneration composition for treatment of periodontal disease is a mixture of particles of a bone growth material and free collagen. All particles are sized to be less than 1 mm in diameter. The periodontal regeneration composition is injected into the periodontal pocket through an 18 gauge needle.... Agent: Buchanan Ingersoll & Rooney PC

20060292090 - Oral care compositions, devices, and methods of using the same: Oral care compositions, devices and methods are disclosed that employ an amorphous calcium phosphate or a precursor or derivative thereof, and a tooth whitening agent.... Agent: Fish & Richardson P.C.

20060292092 - Oral care compositions, devices, and methods of using the same: Oral care compositions, devices and methods are disclosed that employ an amorphous calcium phosphate or a precursor or derivative thereof, and a tooth whitening agent.... Agent: Philip S. Johnson Johnson & Johnson

20060292091 - Tooth whitening compositions: (a) 10% to 75% of a complex which is (i) a mixture of 78 to 90% of water soluble polyvinylpyrrolidone (PVP) having K-values of K-12 to K-120 and (ii) 10 to 22% of H2O2; releasing 1 to 20% of active H2O2 from said complex onto a tooth surface; (b) 0... Agent: William J. Davis, Esq. International Specialty Products

20060292093 - Chromen-4-one derivatives: The invention relates to compounds that are selected from the compounds of formulas (Ia)-(Ic) and to their production and use in cosmetic and dermatological products.... Agent: Millen, White, Zelano & Branigan, P.C.

20060292094 - Composition and method of protection against uv irradiation: The present invention relates to a composition for use in a nutritional product, dietary supplement, or pharmaceutical compound wherein such composition is used to protect the skin against the effects of ultraviolet (UV) irradiation from the sun or other sources, including but not limited to sunburn, skin redness, swelling, immune... Agent: Amin Law, LLC

20060292095 - Gelled oil particles comprising at least one hydrophobic sunscreen: The present invention relates to calibrated oily particles comprising at least one hydrophobic sunscreen and comprising at least one oily phase structured with at least one gelling polymer, characterized in that it has a mean size of less than or equal to 20 μm, in that the said structured oily... Agent: Oliff & Berridge, PLC

20060292096 - Cosmetic compositions having enhanced wear properties: A cosmetic composition and process which provides enhanced wear and transfer resistance containing: (a) at least one polypropylsilsesquioxane film forming resin; (b) at least one solvent; and (c) optionally, at least one colorant.... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20060292097 - Fragrance compositions comprising benzo[4,5]thieno{3,2-b]pyran-2-one: The present case discloses compositions of benzo[4,5]thieno[3,2-b]pyran-2-one which are employed as aroma chemicals.... Agent: Miles & Stockbridge PC

20060292098 - Consumer noticeable improvement in wetness protection: Antiperspirant compositions comprising: (a) from about 0.1% to about 30% by weight of the composition, of a high-efficacy antiperspirant active; (b) from about 0.05% to about 15% by weight of the composition, of a malodor reducing agent; (c) from about 0.1% to about 35% by weight of the composition, of... Agent: The Procter & Gamble Company Intellectual Property Division

20060292099 - Treatment of eye disorders with sirtuin modulators: Sirtuin modulators, particularly sirtuin activators, are useful in treating vision impairment. In general, the sirtuin modulators inhibit the progression of vision impairment resulting from various eye disorders. The invention also includes pharmaceutically acceptable formulations of sirtuin modulators, particular ophthalmically acceptable formulations.... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20060292100 - Aqueous phospholipid-containing carrier systems for water-insoluble materials: The present invention is drawn to a carrier composition containing: (a) at least one phospholipid; (b) at least one nonionic surfactant; (c) at least one anionic silicone; and (d) at least one water-insoluble material, and wherein the composition, when combined with an aqueous phase, forms an aqueous delivery system which... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20060292101 - In-eye method of cleaning and/or disinfecting silicone hydrogel contact lenses: A method of treating a contact lens, and in some instances, a silicone hydrogel contact lens, in the eye of a wearer comprising i) applying to said contact lens and/or eye an ophthalmically compatible contact lens cleaning and/or hydrating and/or disinfecting solution; and ii) rubbing the eyelid associated with said... Agent: Bausch & Lomb Incorporated

20060292102 - Thixotropic personal lubricant: A thixotropic personal lubricant includes a high molecular weight, thixotropic, gel-forming, naturally occurring polysaccharide extracted from algae and comprised of repeating sulfated and non-sulfated galactose and 3,6 anhydrogalactose (3,6-AG) units, and includes water.... Agent: Tod R Nissle

20060292103 - Composition for skin use: A composition for skin use is disclosed. The composition for skin use comprises a high concentration of protein fiber dispersed in an emulsifier system that is consisted of at least one non-silicone surfactant. The emulsifier system has no silicone-containing component, so as to improve the disadvantages of the prior emulsifier... Agent: Thomas, Kayden, Horstemeyer & Risley, LLP

20060292104 - Transparent or translucent conditioning composition packed into transparent and/or translucent container: Disclosed are hair or skin conditioning compositions wherein the composition is a rinse-off conditioning composition having a transparent or translucent appearance and comprising from about 0.1% to about 10% of a polymer and an aqueous carrier, wherein the composition is packed in a container having a transparent and/or translucent appearance,... Agent: The Procter & Gamble Company Intellectual Property Division

20060292105 - Topical preservative compositions: The use of one or more compositions of one or more preserving agents at a relatively high osmolality to disinfect contact lenses and preserve topical agents and ophthalmic lens compositions is described. Ophthalmic lens solutions containing one or more compositions of one or more preserving agents at a relatively high... Agent: Bausch & Lomb Incorporated

20060292106 - Shaving preparation: The present invention is directed to a composition and process for shaving a surface, such as human skin having hair projecting therefrom. The process involves the steps of: (a) providing a surface to be shaved; (b) providing a composition containing: (i) at least one non-aqueous polar organic compound having at... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20060292107 - Solid shaving composition and packaging system: A method of packaging and distributing substantially dehydrated shaving strips, wherein a solid strip of substantially dehydrated shaving lotion is provided. The shaving strips are cut or pressed into discreet units. Alternatively, the dehydrated shaving composition can be deposed onto a water soluble carrier strip. A plurality of shaving strips... Agent: Dougherty Clements

20060292109 - Enzyme inhibiting sprayable compositions: A skin barrier composition including a barrier component and an enzyme inhibiting component that is sprayable for use in ostomy and wound care, infant diapers, and fecal incontinence applications. The barrier component is based on petrolatum or other acceptable carriers, and the enzyme inhibitor component is derived from tubers, such... Agent: Bristol-myers Squibb Company

20060292108 - Topical skin mask for oily and acneic skin: A very efficient topical skin mask to reduce sebum, redness and inflammation of oily and acneic skin. The composition is produced by blending specific quantities of Zinc oxide, Kaolin, Lupini powder, Ascorbic acid and Sulfur, with Glycerin, Rose water and Distilled Water at room temperature and mixing with a high... Agent: Hanna Ibrahim 1st Floor

20060292110 - Coffee aroma vehicle air freshener: A car freshener comprising of a pre-formed material constructed to absorb a scent and a coffee flavored scent affixed to the pre-formed material.... Agent: NationalIPRights Center, LLC Scott J. Fields, Esq.

20060292111 - Composition and its physical requirements for eliminating odors in air: An air treating composition for eliminating odors from air in combination with specific spray valve and actuator requirements and spray performance parameters providing maximum dispersion of the active component in the composition into the air is disclosed. The particles of the composition are small so that the active component is... Agent: S.c. Johnson & Son, Inc.

20060292112 - Dendrimer-photosensitizer complexes for medical applications: A method for enhanced Photodynamic Therapy (PDT) treatments by applying dendrimer-photosensitizer complexes to bring multiple photosensitizer moieties to a treatment site is provided. The most benefit is derived for treatments using systemic introduction of the photosensitizer formulation. Photosensitizers are covalently coupled to the peripheral bonding places of dendrimers, using labile... Agent: Bolesh J. Skutnik Phd, Jd

20060292114 - Neurturin receptor: NTNRα, NTNRα extracellular domain (ECD), NTNRα variants, chimeric NTNRα (e.g., NTNRα immunoadhesion), and antibodies which bind thereto (including agonist and neutralizing antibodies) are disclosed. Various uses for these molecules are described, including methods to modulate cell activity and survival by response to NTNRα-ligands, for example NTN, by providing NTNRα to... Agent: Heller Ehrman LLP

20060292113 - Prophylactic and therapeutic treatment of the ductal epithelium of a mammary gland for cancer: The present invention provides prophylactic and therapeutic methods of treating the ductal epithelium of an exocrine gland, in particular a mammary gland, for disease, in particular cancer. The methods comprise contacting the ductal epithelium of the exocrine gland with an epithelium destroying agent, preferably by ductal cannulation, so as to... Agent: Barnes & Thornburg LLP

20060292116 - Interleukin-2 mutants with reduced toxicity: Interleukin-2 (IL-2) mutants having reduced toxicity, which include full-length IL-2, truncated forms of IL-2 and forms of IL-2 that are linked to another molecule are disclosed herein. Particular substitutions within IL-2, particularly within the permeability enhancing peptide region of IL-2 achieve substantial reduction of vasopermeability activity as compared to a... Agent: Foley & Lardner LLP

20060292115 - Methods and compositions for treating and preventing inflammatory conditions: Methods of treating eosinophilia by down regulating eotaxin and at least one other Th-2 related cytokine are dislosed as are multivalent immunogenic compositions that generate an active immune response in a subjet comprising autoantibodies to eotaxin-1, eotaxin-2, IL-4, IL-5, IL-9, and IL-13 and treatment methods using such compositions.... Agent: Hoxie & Tso LLP

20060292123 - Adeno-associated virus-mediated delivery of gdnf to skeletal muscles: Compositions and methods for delivering GDNF to skeletal muscles to result in a therapeutic effect are disclosed. The compositions and methods use adeno-associated virus (AAV)-based gene delivery systems. The methods are useful for treating motoneuron diseases, such as amyotrophic lateral sclerosis (ALS).... Agent: Robins & Pasternak

20060292122 - Adenoviral vectors for treating diseases: Adenoviral vectors, including mutant adenoviruses, that have restriction sites in the E3 region, that facilitate its partial or total deletion, or select genes contained therein, and optionally compositions and methods for substituting heterologous gene(s) in the partially or totally deleted E3 region(s), which heterologous gene(s) being operably linked to endogenous... Agent: Onyx Pharmaceuiticals, Inc.

20060292120 - Compositions and methods for sirna inhibition of angiogenesis: RNA interference using small interfering RNAs which are specific for the vascular endothelial growth factor (VEGF) gene and the VEGF receptor genes Flt-1 and Flk-1/KDR inhibit expression of these genes. Diseases which involve angiogenesis stimulated by overexpression of VEGF, such as diabetic retinopathy, age related macular degeneration and many types... Agent: Pepper Hamilton LLP One Mellon Center

20060292118 - Hollow nanoparticles of protein and drug using the same: The subject invention is hollow nanoparticles that comprise particle-forming first proteins (e.g. hepatitis B virus surface-antigen protein), containing a bio-recognizing molecule for recognizing a specific cell, wherein at least one of the first proteins interacts with a second protein (e.g. hepatitis B virus core-antigen protein) forming a capsid structure. With... Agent: Nixon & Vanderhye, PC

20060292117 - Improved raav vectors: Disclosed are methods for the use of therapeutic polypeptide-encoding polynucleotides in the creation of transformed host cells and transgenic animals. In particular, the use of recombinant adeno-associated viral (rAAV) vector compositions that specifically target mammalian cells, such as pancreatic islets cells, that express low-density lipoprotein receptors on their cell surface.... Agent: Haynes And Boone, LLP

20060292119 - Modulation of negative immune regulators and applications for immunotherapy: The invention includes compositions and methods for enhancing immunopotency of an immune cell by way of inhibiting a negative immune regulator in the cell. The present invention provides vaccines and therapies in which antigen presentation is enhanced through inhibition of negative immune regulators. The present invention also provides a mechanism... Agent: Drinker Biddle & Reath Attn: Intellectual Property Group

20060292121 - Retroviral vectors including modified envelope escort protein: A retroviral vector comprising a first retroviral envelope protein and at least one modified retroviral envelope protein, wherein said first retroviral envelope protein includes a surface protein comprising (i) a receptor binding region; (ii) a hypervariable polyproline region; and (iii) a body portion, and said modified retroviral envelope protein, prior... Agent: Wilson Sonsini Goodrich & Rosati

20060292130 - 2-o sulfatase nucleic acid compositions: The invention relates to 2-O sulfatase and uses thereof. In particular, the invention relates to recombinantly produced 2-O sulfatase, functional variants and nucleic acid molecules that encode these molecules. The invention also provides methods of using 2-O sulfatase for a variety of purposes, including degrading and analyzing glycosaminoglycans (GAGs) present... Agent: Wolf Greenfield & Sacks, PC

20060292131 - Chondrocyte therapeutic delivery system: Methods and compositions for producing therapeutic agents using chondrocytes are provided. The genetically engineered chondrocytes can be used to express the therapeutic agent in a subject, including in an environment typically associated with chondrocytes and in an environment not typically associated with chondrocytes.... Agent: Nutter Mcclennen & Fish LLP

20060292132 - Neuroprotective effective compound: The present application discloses a method of preventing degeneration of nerve, which includes: a) generating a recombinant viral or plasmid vector comprising a DNA sequence encoding a member of a transforming growth factor superfamily or neurotrophic factor proteins operatively linked to a promoter; b) transfecting in vitro a population of... Agent: Jhk Law

20060292129 - Tumour cell lines nm-f9 (dsm acc2606) and nm-d4 (dsm acc2605), uses thereof: The present invention relates to a cell line selected from the group consisting of (a) a cell line denominated NM-F9 having the DSMZ accession number DSM ACC2606; (b) a cell line denominated NM-D4 having the DSMZ accession number DSM ACC2605; and subclones of (a) or (b). Additionally, the present invention... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060292124 - Novel process for commercial production of biopesticides: The invention relates to a process for producing biopesticides based on Trichoderma harzianum, Pochonia chlamydosporia and Pseudomonas fluorescens comprising preparing mass or stock culture of biocontrol fungi and bacteria on sawdust, soil and molasses mixture, and then immobilizing the bioagents in a flyable based carrier.... Agent: The Webb Law Firm, P.C.

20060292133 - Use of lactobacillus salivarius: Lactobacillus salivarius is useful in the prophylaxis or treatment of undesirable inflammatory activity, especially gastrointestinal inflammatory activity such as inflammatory bowel disease or irritable bowel syndrome. The inflammatory activity may also be due to cancer. The Lactobacillus salivarius is of human origin isolated from resected and washed human gastrointestinal tract.... Agent: Jacobson Holman PLLC

20060292127 - Beta cell growth and differentiation: The invention includes methods that can be used to increase β cell populations in vivo and in vitro, useful in the treatment of diabetes and related disorders.... Agent: Fish & Richardson PC

20060292126 - Epidermal and dermal equivalents: The present invention relates to the treatment of skin defects by organotypically-cultured autologous keratinocytes isolated from the outer root sheath of anagen or growing hair. Methods for primary, as well as subsequent organotypic cultures (i.e., epidermal equivalents) in fully-defined media supplemented by autologous human serum and substances isolated form blood... Agent: Fulbright & Jaworski L.L.P.

20060292125 - Methods for treating ischemic tissue: Compositions and methods for treating ischemic tissue are provided herein.... Agent: Dechert LLP

20060292128 - Methods of treating schizophrenia: The invention provides methods for the treatment of abnormal psychiatric states, particularly the negative symptoms of schizophrenia and extrapyramidal side effects (EPS) of antipsychotic drugs. The inventive methods relate to the administration of therapeutic cells (which produce dopamine or dopamine precursors) adhered to support matrices to subjects suffering from the... Agent: Morrison & Foerster LLP

20060292134 - Composition for enhancing cellular energy: A composition for enhancing cellular energy that includes creatine, L-arginine-α-ketoglutarate, D-ribose, L-carnitine, L-citrulline, and pyruvate. The composition is administering to a subject to enhance cellular energy, to increase relative intensity of physical activity performed by the subject, to increase endurance of the subject during the physical activity and to increase... Agent: Kramer & Amado, P.C.

20060292135 - Use of bacterial phage-associated lysing proteins for preventing and treating bacterial infections in humans, animals and fowl: A composition and method for treating bacterial infections by the use of an effective amount of at least one lytic specific for the bacteria causing specific. The lytic enzyme is genetically coded for by a bacteriophage which may be specific for said bacteria. The enzyme may be at least one... Agent: Jonathan E. Grant

20060292136 - Cytotoxic factors for modulating cell death: Cytotoxic factors having use in modulating cell death, and their use in methods of treating necrosis or apoptosis-related conditions are disclosed. The invention also relates to methods for identifying active agents useful in treating conditions related to cell death or uncontrolled growth. The present inventors have found that different microorganisms... Agent: Preston Gates Ellis & Rouvelas Meeds LLP

20060292137 - Cytotoxic ribonuclease variants: This invention relates to cytotoxic variants of human ribonuclease 1 (RNase 1) identified through analysis of the interaction between RNase 1 and the human ribonuclease inhibitor (hRI) as defined by the three dimensional (3-D) atomic structure of the RNase 1 hRI complex. Also disclosed is the 3-D structure of the... Agent: Quarles & Brady LLP

20060292138 - Allergen vaccine proteins for the treatment and prevention of allergic diseases: The present invention provides fusion proteins comprising an allergen sequence linked via an IgG hinge region to another polypeptide sequence capable of specifically binding to a native IgG inhibitory receptor containing an immune receptor tyrosine based inhibitory motif (ITIM). They are designed to cross-link an Fc receptor for IgE (e.g.,... Agent: Seed Intellectual Property Law Group PLLC

20060292139 - Fusion proteins for prodrug activation: The invention relates to compounds which contain an antigen binding region which is bound to at least one enzyme which is able to metabolize a compound (prodrug) which has little or no cytotoxicity to a cytotoxic compound (drug), where the antigen binding region is composed of a single polypeptide chain.... Agent: Ross J. Oehler Sanofi-aventis U.s. LLC

20060292140 - Humanized immunoglobulin reactive with alpha4beta7 integrin: The present invention relates to humanized immunoglobulins having binding specificity for α4β7 integrin, comprising an antigen binding region of nonhuman origin (e.g., rodent) and at least a portion of an immunoglobulin of human origin (e.g., a human framework region, a human constant region). In one embodiment, the humanized immunoglobulin can... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20060292144 - Human disintegrin protein: Provided is a new disintegrin polypeptide, methods of making such polypeptides, and methods of using them to treat disintegrin-associated disorders and conditions and to identify agents that modulate Metalloproteinase-Disintegrin polypeptide activities.... Agent: Immunex Corporation Law Department

20060292141 - Inhibition of factor b and the alternative complement pathway for treatment of traumatic brain injury and related conditions: Disclosed is the use of agents and compositions that selectively inhibit the alternative complement pathway for the inhibiting or treating physiological damage resulting from traumatic brain injury (TBI), spinal cord injury (SCI), or related conditions. Preferred reagents for use in inhibition of damage resulting from TBI or SCI include those... Agent: Sheridan Ross PC

20060292142 - Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies: The binding specificity of the murine OKT3 has been transferred into a human antibody framework in order to reduce its immunogenicity. “Humanized” anti-CD3 mAbs, such as gOKT3-5 and gOKT3-7, have been shown to retain, in vitro, all the properties of native OKT3, including T cell activation which has been correlated,... Agent: Jones Day

20060292143 - Novel t-cell membrane protein (tirc7), peptides and antibodies derived therefrom and uses thereof: Described are generally a T cell immune response cDNA 7 (TIRC7) encoding a novel T-cell transmembrane protein as well as peptides und polypeptides derived therefrom and antibodies recognizing said (poly)peptides. More particularly, peptide and polypeptide as well as antibodies being capable of inhibiting T-cell stimulation through the T-cell membrane protein... Agent: Cooper & Dunham, LLP

20060292148 - Antihuman tnf-alpha antibody activity lowering inhibitor: The present invention provides an antihuman TNF-α antibody activity lowering inhibitor comprising a protein source(s) and/or carbohydrate source(s), in the treatment of inflammatory bowel syndrome with repeated administration of anti-TNF-α antibody; and a kit preparation wherein a freeze-dried antihuman TNF-α antibody and the activity lowering inhibitor in the above repeated... Agent: C. Irvin Mcclelland Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20060292147 - Blood mmp-3 level-lowering agent comprising il-6 antagonist as active ingredient: A blood matrix metalloprotease-3 (MMP-3) level-lowering agent comprising an interleukin-6 (IL-6) antagonist as an active ingredient.... Agent: Foley And Lardner LLP Suite 500

20060292145 - Human antihuman interleukin-18 antibody, fragment thereof and method for using same: A human-derived human anti-human IL-18 antibody of the present invention is an antibody against human IL-18, the antibody including: an H-chain complementarity determining region consisting of (a) a polypeptide consisting of amino-acid sequences represented by SEQ ID NOS: 4 to 6, or (b) a polypeptide which is a mutant of... Agent: Edwards & Angell, LLP

20060292146 - Isolated ptpmt1 protein which mediates insulin production and uses thereof: The invention identifies a novel protein tyrosine phosphatase, PTPMT1. The complete nucleic acid and amino acid sequence encoding PTPMT1 is provided. Methods are provided for preventing and/or treating type II diabetes by regulating PTPMT1 levels, which in turn regulates insulin levels.... Agent: Mandel & Adriano

20060292152 - Antibodies directed against amyloid-beta peptide and methods using same: Antibodies directed to the C-terminal side of β-amyloid peptide and methods of using these antibodies for diagnosing and treatment of Alzheimer's disease and Aβ peptide associated diseases are described.... Agent: Morrison & Foerster LLP

20060292151 - L-sign polymorphisms and methods involving use of same: This invention concerns methods for determining whether an agent preferentially binds to at least one allelic variant of L-SIGN. The invention is also directed to agents that preferentially bind to at least one allelic variant of L-SIGN. The invention also provides methods and agents for treating and preventing disorders associated... Agent: Cooper & Dunham, LLP

20060292150 - Methods of using wisp antagonists: Methods and compositions for use in blocking or inhibiting the activity(s) of WISP-1 polypeptide on chondrocytes are provided. WISP-1 antagonists include anti-WISP-1 antibodies, WISP-1 immunoadhesins and WISP-1 variants (and fusion proteins thereof) which inhibit or neutralize the effects of WISP-1 on mammalian chondrocytes.... Agent: Genentech, Inc.

20060292153 - Polypeptides, polynucleotides encoding same, antibodies thereagainst and methods of using same for diagnosing and treating cancer and skeletal disorders: An isolated polypeptide is provided, comprising an amino acid sequence being at least 88% homologous to SEQ ID NO: 15 as determined by BlastP using default parameters, the isolated polypeptide being capable of promoting cell adhesion and/or cell homing.... Agent: Martin D. Moynihan Prtsi, Inc.

20060292149 - Variable antibodies: The present invention discloses inhibitory antibodies against Factor VIII with modified glycosylation, either by enzymatic deglycosylation or by site directed mutagenesis. Said antibodies with modified glycosylation have equal affinity for FVIII but show different inhibiting properties. The use of one or a mixture of said antibodies allow modulation of the... Agent: Clark & Elbing LLP

20060292154 - A34 and a33-like 3dna, proteins, antibodies thereto and methods of treatment using same: Polynucleotide molecules and polypeptide molecules A34 and A33-like 3 are described, as well as antibodies to polypeptide molecules A34 and A33like 3. Also described are methods of detecting cancers expressing these polypeptides, and methods and kits for diagnosing said cancers, and methods of inhibiting effects of a cancer in a... Agent: Crowell & Moring LLP Intellectual Property Group

20060292155 - Diagnostics and therapeutics for diseases associated with mosaic serine protease (msp): The invention provides a human MSP which is associated with the cardiovascular diseases, endocrinological diseases, metabolic diseases, cancer, inflammation, gastroenterological diseases, hematological diseases, respiratory diseases, neurological diseases, urological diseases and reproduction disorders. The invention also provides assays for the identification of compounds useful in the treatment or prevention of cardiovascular... Agent: Banner & Witcoff

20060292156 - Genetically modified human natural killer cell lines: The invention provides a natural killer cell, NK-92, modified to express an Fc receptor on the surface of the cell, such as CD 16 (FcγRIII-A), or other Fcγ or Fc receptors. The modified NK-92 cell can be further modified to concurrently express an associated accessory signaling protein, such as FcεRI-γ,TCR-ζ,... Agent: Dykema Gossett PLLC

20060292157 - Mda-7 protein variants having antiproliferative activity: The invention relates to the mda-7 gene, its encoded protein and fragments of the protein. Several of these fragments of the MDA-7 protein exhibit antiproliferative activity and/or inhibited the activity of intact MDA-7. Accordingly, the invention provides, among other things, for methods and compositions that may be used in the... Agent: Wilmer Cutler Pickering Hale And Dorr LLP Columbia University

20060292158 - Method for the treatment of cancer using a novel pharmaceutical composition containing at least one dolastatin 10 derivative: e

20060292159 - Methods for the inhibition of neovascularization and cancer metastasis: Methods for diagnosing a neoplasia of epithelial tissues are provided. The methods comprise quantifiably detecting T-cadherin expression on tissue samples and comparing the detected T-cadherin levels with reference values for the level of expression of T-cadherin in healthy or disease states. Methods for diagnosing the stage of a neoplasia are... Agent: Woodcock Washburn LLP

20060292160 - Human igm antibody inducing apotosis in hiv-infected cells and remedy for hiv-infection: A monoclonal antibody falling within the category of human IgM which specifically recognizes HIV-infected cells and induces apoptosis is obtained. Using the obtained antibody, it is intended to provide a remedy for patients suffering from HIV-infection, which contains as the active ingredient a human IgM antibody capable of specifically reacting... Agent: Adams Evans P.A.

20060292162 - Plasma or serum fraction for the treatment or prevention of bacterial infections: The present invention relates to a plasma or serum fraction derived from a mammal exposed to an inoculant (e.g., a bacteria-bearing inoculant), which fraction has been depleted of one or more high molecular weight proteins or biological agents present in the unprocessed plasma or serum, as well as to a... Agent: King & Spalding LLP

20060292161 - Protective epitopes of adenyl cyclase-haemolysin (ac-hly), their application to the treatment or to the prevention of bordetella infections: Purified nucleic acids comprising a nucleotide sequence encoding an immunogenic polypeptide of adenyl cyclase-haemolysin (AC-Hly), which induces formation of protective antibodies against an infection by a bacteria selected from the group consisting of B. pertussis, B. parapertussis, and B. bronchiseptica when the nucleic acid or polypeptide is administered to a... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060292163 - Phytol derived immunoadjuvants and their use in vaccine formulations: This invention relates to a novel immunoadjuvant, an adjuvant component, and vaccines containing the adjuvant component. The adjuvant includes phytol or a phytol derivative. The adjuvant component, when combined with a soluble or particulate antigen, provides a vaccine with an enhanced ability to induce both humoral and cytotoxic immune responses... Agent: Woodard, Emhardt, Moriarty, Mcnett & Henry LLP

20060292165 - Compositions and methods for enhancement of major histocompatibility complex class i restricted antigen presentation: Compositions and methods for eliciting an in vivo cytotoxic lymphocyte (CTL) response against a modified soluble protein antigen are disclosed. The modified soluble protein antigen comprises an added peptidic sequence which facilitates entry of the modified antigen into antigen presenting cells (APC).... Agent: Perkins Coie LLP

20060292164 - Method for preventing rejection of transplanted tissue: Methods of preventing rejection of transplanted tissue. Recipient alloactivated regulatory T cells generated ex vivo are introduced into the recipient before transplantation. Donor antigen is introduced into the recipient after transplantation to boost recipient regulatory T cells.... Agent: Richard F. Trecartin Dorsey & Whitney LLP

20060292166 - Vaccine composition comprising flt3-ligand: Flt3-ligand can be used to generate large numbers of dendritic cells from hematopoietic progenitor and stem cells. Flt3-ligand can be used to augment immune responses in vivo, and expand dendritic cells ex vivo. Such dendritic cells can then be used to present tumor, viral or other antigens to naive T... Agent: Sughrue Mion, PLLC

20060292167 - Therapeutic peptides and vaccines: Compositions are disclosed that induce broadly HIV theraputic and vaccine inducing antibodies against diverse HIV clades and relate to the ability to identify HIV gp120-derived short peptide sequence immunogens and various therapeutic compositions made from the identified peptides which compose CCR5 binding sites. Also disclosed are methods of selecting peptide... Agent: Kile Goekjian Reed & Mcmanus

20060292169 - Fusion proteins of mycobacterium tuberculosis antigens and their uses: The present invention relates to fusion proteins containing at least two Mycobacterium tuberculosis antigens. In particular, it relates to bi-fusion proteins which contain two individual M. tuberculosis antigens, tri-fusion proteins which contain three M. tuberculosis antigens, tetra-fusion proteins which contain four M. tuberculosis antigens, and penta-fusion proteins which contain five... Agent: Townsend And Townsend And Crew, LLP

20060292168 - Methylated heparin-binding hemagglutinin recombinant mycobacterial antigen, preparation method and immunogenic compositions comprising same: The invention concerns a methylated immunogenic recombinant peptide sequence comprising mycobacterial heparin-binding hemagglutinin. The invention also concerns chemical and enzymatic methods for preparing such a sequence, the sequence being previously produced in a non-methylated recombinant form then methylated by post-translational modification. The invention further concerns recombinant tools, vectors and host... Agent: Birch Stewart Kolasch & Birch

20060292170 - Vaccine composition against malaria: A vaccine composition useful in the prevention or treatment of malaria comprises a plurality of malaria-derived antigens in combination with an adjuvant which is a preferential stimulator of TH1 cell response.... Agent: Glaxosmithkline Corporate Intellectual Property - Uw2220

20060292171 - Moderating the effect of endotoxins: The present invention relates to the use of an oral composition comprising yeast extract, in the manufacture of an oral composition to treat the effects of infection by pathogenic bacteria such as Clostridium difficile. Such effects may include the failure of the integrity of the gut epithelial cells and diarrhoea... Agent: Bell, Boyd & Lloyd LLC

20060292172 - Dengue serotype 1 attenuated strain: The invention relates to live attenuated VDV1 (VERO-Derived Dengue serotype 1 viruse) strains which have been derived from the wild-type dengue-1 strain 16007 by passaging on PDK and sanitization on Vero cells. The invention further relates to a vaccine composition which comprises a VDV1 strain.... Agent: Stites & Harbison PLLC

20060292173 - Multibacterial vaccines and uses thereof: The present invention provides methods for establishing standards for Gram-negative, Gram-positive, and mixed bacterial cultures. The present invention also provides methods for reproducing Gram-negative, Gram-positive, and mixed bacterial cultures. The present invention further provides methods for preparing multibacterial vaccines. Also provided are multibacterial vaccines prepared in accordance with these methods,... Agent: Mccarthy Tetrault LLP

20060292175 - Chimeric alphavirus replicon particles: Chimeric alphaviruses and alphavirus replicon particles are provided including methods of making and using same. Specifically, alphavirus particles are provided having nucleic acid molecules derived from one or more alphaviruses and structural proteins (capsid and/or envelope) from at least two or more alphaviruses. Methods of making, using, and therapeutic preparations... Agent: Novartis Vaccines And Diagnostics Inc.

20060292176 - In ovo vaccine against infectious bursal disease: The present invention relates to a non pathogenic vaccine comprising a recombinant Infectious Bursal Disease virus that includes a recombinant Segment A, designated as rD78GLSNSΔ, that includes sequences from D78 and GLS strains and wherein the NS protein is not expressed.... Agent: Intellectual Property / Technology Law

20060292177 - Postweaning multisystemic wasting syndrome and porcine circovirus from pigs: The cloning of a novel PCVII viral genome is described as is expression of proteins derived from the PCVII genome. These proteins can be used in vaccine compositions for the prevention and treatment of PCVII infections, as well as in diagnostic methods for determining the presence of PCVII infections in... Agent: Frommer Lawrence & Haug

20060292174 - Self-assembling nanoparticle drug delivery system: A self-assembling nanoparticle drug delivery system for the delivery of drugs including peptides, proteins, nucleic acids or synthetic chemical drugs is provided. The self-assembling nanoparticle drug delivery system described herein includes viral capsid proteins, such as Hepatitis B Virus core protein, encapsulating the drug, a lipid bi-layer envelope and targeting... Agent: Preston Gates & Ellis LLP

20060292178 - Proteins encoded by the severe acute respiratory syndrome (sars) coronavirus and a role in apoptosis: Compositions related to expressed severe acute respiratory syndrome (SARS) coronavirus group-specific polypeptides are provided. Further provided are methods and compositions related to the use of these polypeptides, in particular use for inducing apoptosis in cells, diagnosing SARS infection and screening for modulator and inhibitor compounds of such polypeptides and in... Agent: Alston & Bird LLP

20060292179 - Vaccines for immunization against helicobacter: The invention relates to the immunisation of pigs against Candidatus Helicobacter suis using antigens of species related to Candidatus Helicobacter suis.... Agent: Clark & Elbing LLP

20060292180 - Pathogenic escherichia coli associated protein: The present invention provides a polypeptide, called EspA, which is secreted by pathogenic E. coli, such as the enteropathogenic (SPEC) and enterohemorrhagic (EHEC) E. coli. The invention also provides isolated nucleic acid sequences encoding EspA polypeptide, EspA peptides, a recombinant method for producing recombinant EspA, antibodies which bind to EspA,... Agent: Woodcock Washburn LLP

20060292181 - Method for inducing a cell-mediated immune response and improved parenteral vaccine formulations thereof: A method of inducing either a TH1 polarised immune response, a TH2 polarised immune response or a combined TH1 and TH2 response to an antigen and associated vaccine formulations are disclosed. A method is provided for inducing a polarised TH1 response by parenteral administration of microparticles sized such that at... Agent: Synnestvedt & Lechner, LLP

20060292182 - Photoadjuvant immunotherapy: A photoadjuvant immunotherapeutical method includes the steps of providing a phototherapeutical apparatus, comprising a light source, an optical guidance system, and a patient interface; determining a minimal erythema dose; performing phototherapy by irradiating a target surface with the phototherapeutical apparatus; and performing immunotherapy by exposing the irradiated target surface to... Agent: Gergely T. Zimanyi Sidley Austin Brown & Wood LLP

20060292190 - Amelioration of vitrectomy-induced cataracts: Methods to prevent, inhibit, or slow the development of vitrectomy-induced cataracts are disclosed. The methods comprise administering to the eye of a subject a composition comprising an ophthalmologically acceptable carrier or diluent and at least one hydroxylamine compound in a therapeutically sufficient amount to prevent, inhibit, or slow the development... Agent: Woodcock Washburn LLP

20060292184 - Bioadhesive liquid composition which is substantially free of water: A liquid composition for adherence to a bodily surface, notably to a bodily surface, especially a mucosal surface, comprises water-swellable polymer particles suspended in a water-miscible liquid diluent, wherein the liquid diluent is substantially free of water or includes an amount of water insufficient to fully swell the polymer particles.... Agent: Fish & Richardson PC

20060292183 - Microemulsions as precursors to solid nanoparticles: The preparation of novel microemulsions to be used as precursors for solid nanoparticles is described. The microemulsion precursors consist of either alcohol-in-fluorocarbon microemulsions, liquid hydrocarbon-in-fluorocarbon microemulsions, or liquid hydrocarbon-in-water microemulsions. The formed solid nanoparticles have diameters below 200 nanometers and can be made to entrap various materials including drugs, magnets,... Agent: Fulbright & Jaworski L.L.P.

20060292187 - Nerve construct containing living stretch-grown nervous tissue: The present invention relates to mechanically elongated neurons and provides useful compositions, devices and methods for treating a nerve lesion using such mechanically elongated neurons.... Agent: Drinker Biddle & Reath Attn: Intellectual Property Group

20060292188 - Ophthalmic solution with a flavoring agent: The invention provides an ophthalmic solution with at least one flavoring agent to mask flavors in the solution or add flavor to the solution. The flavoring agent can be a sweet flavoring agent (sweetener), or combinations of a sweetener with a sour flavoring agent or a bitter flavoring agent or... Agent: Bausch & Lomb Incorporated

20060292189 - Ophthalmic solution with a flavoring agent as a dosing indicator and method for indicating dosage of an ophthalmic solution: The invention provides an ophthalmic solution with a flavoring agent as a dosing indicator and a method for indicating dosage of an ophthalmic solution. To indicate dosage, a flavoring agent is added to an ophthalmic solution in an amount correlated to the dosage of the ophthalmic solution to be used.... Agent: Bausch & Lomb Incorporated

20060292186 - Self-nanoemulsifying oily formulation for the administration of poorly water-soluble drugs: A pharmaceutical composition in a form of an anhydrous self-nanoemulsifying oily formulation comprising: one or more therapeutic agent(s) which have low solubility in water or are water-insoluble, vitamin E, one co-solvent selected from propylene glycol and ethanol and mixture thereof one surfactant selected from tyloxapol and from mixture of tyloxapol... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20060292185 - Topical skin preparations for treatment of skin aging comprising a testosterone ester: The present invention concerns Topical skin preparations for the use in the prevention of atrophy and aging of the skin, comprising a testosterone ester with an esterifying acid having between six to eleven carbon atoms.... Agent: Nath & Associates

20060292191 - Use of nanodispersions in pharmaceutical end formulations: A nanodispersion comprises (a) a membrane-forming molecule, (b) a coemulsifier and (c) a lipophilic component, in pharmaceutical end formulations, the nanodispersion being obtainable by (α) mixing the components (a), (b) and (c) until a homogeneous clear liquid is obtained, and (β) adding the liquid obtained in step (α) to the... Agent: Ciba Specialty Chemicals Corporation Patent Department

20060292193 - Encapsulated cosmetic composition: The present invention relates to encapsulated cosmetic compositions that are topically applied. The compositions contain at least one frangible capsule that has a seamless shell of a thermo-softening material. The shell is solid at about room temperature and melts upon application to the skin. The shell holds a core cosmetic... Agent: The Estee Lauder Cos, Inc

20060292192 - Pharmaceutical and cosmetic formulations: Pharmaceutical and cosmetic formulations comprising hydrophobic highly disperse silicon dioxide with a tamped density of 70-400 g/l.... Agent: Venable LLP

20060292195 - Tooth drops: Tooth cleaning drops with an outer shell defining an inner chamber filled with a tooth cleaning substance. The outer shell may be made of the same material as the tooth cleaning substance. The drops are placed in a user's mouth and punctured to release the tooth cleaning substance held inside... Agent: Michael Ries

20060292194 - Treatment for burns and adipose deposits using thyroid hormone compound in a human: A topical preparation for treating first and second degree burns includes TriAc. The topical preparation preferably includes less than 10 mg of TriAc per 100 ml of pharmaceutical excipient base. In another embodiment, a topical preparation includes TriAc for decreasing cellulite. In this embodiment, the topical preparation is preferably applied... Agent: Brown & Michaels, PC 400 M & T Bank Building

20060292196 - Formulation for obtaining a pharmaceutical composition, method for obtaining and use thereof: Invention relates to the field of medicine and may be used in medicine, veterinary, biology, biotechnological, chemical-pharmaceutical and food industry, as well as for domestic purposes, etc. as a reagent providing antimicrobial, antiviral and fungicidal capability. Objective of the proposed invention is a creation of pharmaceutical composition that is innocuous... Agent: Ladas & Parry

20060292197 - Manufactured articles comprising a pest-combating composition: An article including a pest-combating composition applied to or incorporated in such article, wherein the pest-combating composition includes capsicum and/or a cruciferous agent selected from among mustard and horseradish, as active ingredients of the composition. The active ingredients may be micro-encapsulated or otherwise formulated for application to the manufactured article... Agent: Intellectual Property / Technology Law

20060292199 - Pmma bone cement containing antibiotic/antibiotics: A PMMA bone cement containing an antibiotic/antibiotics is described which is characterized in that, in the powder component, 0.1-5.0% by weight of water soluble, glasstype antibiotic/antibiotics granules with a particle diameter in the region of 50-1000 μm are contained which are built up of glass-type antibiotic/antibiotics primary particles bonded to... Agent: Kurt G. Briscoe Norris, Mclaughlin & Marcus P.A.

20060292198 - Porous beta-tricalcium phosphate granules for regeneration of bone tissue: A porous β-tricalcium phosphate material for bone implantation is provided. The multiple pores in the porous TCP body are separate discrete voids and are not interconnected. The pore size diameter is in the range of 20-500 μm, preferably 50-125 μm. The porous β-TCP material provides a carrier matrix for bioactive... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20060292200 - Porous beta-tricalcium phosphate and methods for producing the same: Methods are provided for producing porous β-Tricalcium Phosphate (β-TCP). In the subject methods, β-TCP is combined with graphite to produce an intermediate greenware product. The intermediate greenware product is then sintered to produce porous β-TCP. The subject methods and compositions produced thereby find use in a variety of applications.... Agent: Bozicevic, Field & Francis LLP

20060292201 - Methods for the in situ treatment of bone cancer: The present invention relates to methods for in situ treatment of malignant cells from a cancer associated with bone. In one method, the treatment is for a primary cancer and entails positioning an implant containing and/or coated with at least one active agent for treating malignant cells directly in/on or... Agent: Morgan, Lewis & Bockius LLP

20060292202 - Drug delivery device: Drug delivery devices include a beta-carboline active agent for treatment of ophthalmic disorders.... Agent: Bausch & Lomb Incorporated

20060292203 - Methods and compositions for the treatment of ocular disorders: The invention provides methods and compositions for the delivery of lipophilic drugs that are useful for the treatment of various ophthalmological diseases, disorders, and pathologies, including the treatment of age-related macular degeneration, diabetic retinopathy, diabetic macular edema, cancer, and glaucoma.... Agent: Dla Piper US LLP

20060292204 - Flavanone compound and uses thereof: e

20060292205 - Substitute for animal protein in cattle feed: A combination one or more species of lactobacillus bacteria and one or more types of fibrolytic enzymes can be used to replace animal protein in cattle feed. The combination results in a better amino acid balance in the digestive tract of cattle resulting in a better utilization of nitrogen. Less... Agent: Donavon Lee Favre

20060292206 - Devices and methods for treatment of vascular aneurysms: The present invention relates to devices and methods for the treatment of diseases in the vasculature, and more specifically, devices and methods for treatment of aneurysms found in blood vessels. In a first embodiment of the present invention, a two part prostheses, where one part is an expandable sponge structure... Agent: Levine Bagade Han LLP

20060292207 - Chitosan based dressing: The present invention is a dressing capable of hydrotaxis and temperature-sensitivity for a wound or for antisepsis, containing layers of acrylic acid, N-isopropyl acrylamide and chitosan by a grafting through an ionizing radiation, a UV radiation, a peracid process and a freeze-drying process.... Agent: Troxell Law Office PLLC

20060292209 - Reactive hydrophilic oligomers: Hydrophilic compositions are described, which are prepared from a first oligomer containing pendent polymerizable groups and pendent hydrophilic groups, crosslinked with a co-reactive second component oligomer possessing photoinitiator groups. The compositions may be used as in preparation of hydrophilic gel coatings or layers for medical devices.... Agent: 3m Innovative Properties Company

20060292208 - Sulfonated styrene polymers for medical articles and barrier web constructs: Sulfonated styrene copolymer compositions and salts thereof, and their use in drug delivery devices, such as wound dressings, as well as their use for controlling chemical agents and for controlling biological organisms are presented.... Agent: Heslin Rothenberg Farley & Mesiti PC

20060292210 - Percutaneous absorption-type pharmaceutical preparation: A stable percutaneous absorption-type pharmaceutical preparation for percutaneous administration of selegiline or selegiline hydrochloride, which does not suffer a decrease in the cohesive force of the adhesive layer therein even in the presence of sweat components due to perspiration during wear and which is free from cohesive failure and resultant... Agent: Sughrue Mion, PLLC

20060292211 - Ultrasound enhancement of drug release across non-ionic surfactant membranes: A method of targeted drug delivery and imaging using nonionic surfactant vesicles (niosomes) in combination with ultrasound. Niosomes have potential applications in targeted drug delivery and imaging because of their ability to encapsulate therapeutic agents and their enhanced uptake by physiological membranes. Ultrasound may be used to mediate delivery non-invasively... Agent: Smith Hopen, Pa

20060292215 - Abscisic acid against cancer: Abscisic acid (ABA) a naturally ocurring plant hormone has been identified in this invention with potent properties to fight cancer. ABA is able to produce a hyperpolarization condition on plasma membrane through a decrease of intracellular Na+ and K+. Such phenomenon is produced in cancer cells by mediation of ion... Agent: Gonzalo Romero M

20060292213 - Enoximone formulations and their use in the treatment of pde-iii mediated diseases: The present invention provides pharmaceutical formulations of the drug enoximone for use in treatment of disease states in which inhibition of PDE-III may be beneficial.... Agent: Fulbright & Jaworski L.L.P.

20060292214 - Nanoparticulate acetaminophen formulations: The invention is directed to compositions comprising a nanoparticulate acetaminophen composition, or a salt or derivative thereof, having improved bioavailability. The nanoparticulate acetaminophen particles of the composition have an effective average particle size of less than about 2000 nm and are useful in the treatment of aches and pain, and... Agent: Elan Drug Delivery, Inc. C/o Foley & Lardner LLP

20060292212 - Use of thickening agents for producing soft capsules and film production method: The invention concerns the gelatinization of viscous aqueous or hydroalcoholic liquid components, buffered or not, intended for the production of films for the manufacture of soft capsules. These compositions are notable in particular in that gelatinization thereof is obtained extemporaneously starting with thickening agents that exhibit the unique property of... Agent: Paul And Paul

20060292216 - Enteric delivery of (-)-hydroxycitric acid: The present invention provides stable encapsulated (−)-hydroxycitric acid (“HCA”) dosage unit forms, uses thereof, as well as and methods of making the same. In particular, HCA and the salts, esters and amides of HCA according to the invention are delivered via enteric vehicles, such as enteric-coated tablets, and also enteric... Agent: Foley & Lardner LLP

20060292217 - Nutritional supplement and soft gelatin capsule delivery system: A nutritional composition and method of introducing the composition into a soft gelatin capsule. The composition includes effective amounts of omega-3 fatty acid, vitamin D and selenium. The method includes forming each component into a unitary form, forming a soft gelatin capsule and introducing the unitary composition into the capsule.... Agent: Blakely Sokoloff Taylor & Zafman

20060292218 - Agent having a destructive effect on malignant tumors and method for the production thereof: Disclosed is an agent which has a destructive effect on malignant tumors and contains alpha-ketoglutaric acid, N-acetyl-seleno-L-methionine, N-acetyl-L-methionine, and a compound that is capable of forming azomethine and is selected among the group 5-hydroxymethylfurfural, dehydroascorbic acid, maltol, and vanillin as an active substance, 5-hydroxymethylfurfural being preferred. The inventive agent can... Agent: The Firm Of Karl F Ross

20060292220 - Compositions and methods for nutrition supplementation: The present invention relates to compositions that may be swallowable, chewable or dissolvable, comprising various vitamins and minerals, and in a specific embodiment comprising vitamin A, beta carotene, B-complex vitamins, vitamin C, vitamin D3, vitamin E, iron, magnesium and zinc, and methods for using these compositions for nutritional supplementation in... Agent: Preston Gates Ellis & Rouvelas Meeds LLP

20060292219 - Sublingual buccal effervescent: A pharmaceutical dosage form adapted to supply a medicament to the oral cavity for buccal, sublingual or gingival absorption of the medicament which contains an orally administrable medicament in combination with an effervescent for use in promoting absorption of the medicament in the oral cavity. The use of an additional... Agent: Cima Lerner, David Et Al

20060292222 - Drug delivery device having zero or near zero-order release kinetics: The present invention is directed to an improved sustained release drug delivery device comprising a drug core, a cup, and a prefabricated crystalline or semi-crystalline polymeric permeable plug.... Agent: Bausch & Lomb Incorporated

20060292221 - Timed-release compression-coated solid composition for oral administration: The present invention was completed based on these discoveries and relates to in a hydrogel-forming compression-coated solid pharmaceutical preparation comprising a core tablet containing drug and outer layer made from hydrogel-forming polymer substance and hydrophilic base, the improvement, a timed-release compression-coated solid composition for oral administration, said composition comprising (1)... Agent: Townsend And Townsend And Crew, LLP

20060292223 - Gel compositions for topical administration: Pharmaceutical gel compositions containing pharmacologically active agent for topical administration, as well as a method of making the same, are disclosed.... Agent: Fitzpatrick Cella Harper & Scinto

20060292224 - Pharmaceutical composition: This invention relates to pharmaceutical formulations comprising particles with a substantially non-hygroscopic inner crystalline core and an outer coating comprising at least one bioactive molecule. The invention also relates to methods of forming particles comprising a substantially non-hygroscopic inner crystalline core and an outer coating comprising at least one bioactive... Agent: Alston & Bird LLP

20060292225 - Water soluble analgesic formulations and methods for production: A water soluble analgesic composition includes a plurality of granules. Each of the granules includes a substrate core and a coating disposed on the substrate core forming an agglomerated product, the coating including a salt of an analgesic, but substantially no particles of a non-salt form of the analgesic. The... Agent: Notaro And Michalos

20060292226 - Fatty emulsion injection of seal oil, method for preparation and the use in manufacturing intravenous injection: The present invention relates to a seal oil based lipid emulsion injection, and the main ingredients of which contains 190-210 g/l of refined OMEGA3 seal oil, 11-13 g/l of refined lecithin, 24-26 g/l of glycerol for injection, and balance amount of water. The preparation of the seal oil based lipid... Agent: Wallenstein & Wagner, Ltd.

20060292227 - Extracellular matrix material particles and methods of preparation: A method for preparing a powdered extracellular matrix material is described. A particulate extracellular matrix material wherein at least 90% of the particles detectable by laser diffraction are about 420 microns or less. A particulate extracellular matrix material is also provided wherein at least 50% of the particles detectable by... Agent: Barnes & Thornburg LLP

20060292228 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a density greater than that of double distilled water is used. The composition may further include microstructured water having a cluster factor of at least 10, and may have dissolved oxygen. The physiologically ingestible composition may be administered to heal a wound... Agent: Fleshner & Kim, LLP

20060292229 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a negative oxidation reduction potential of at least −40, and uses thereof are provided. The composition may further included dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to... Agent: Fleshner & Kim, LLP

20060292230 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a negative oxidation reduction potential of at least −40, and uses thereof are provided. The composition may further included dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to... Agent: Fleshner & Kim, LLP

20060292231 - Composition and therapeutic uses thereof: A physiologically ingestible with microstructured water having an increased pH compared to unstructured water is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to address pulmonary deficiencies of a mammal.... Agent: Fleshner & Kim, LLP

20060292232 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a melting point lower than double distilled water is used. The physiologically ingestible composition may be administered to treat infection in a mammal.... Agent: Fleshner & Kim, LLP

20060292233 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a density greater than that of double distilled water is used. The composition may further include microstructured water having a cluster factor of at least 10, and may have dissolved oxygen. The physiologically ingestible composition may be administered to treat infection in... Agent: Fleshner & Kim, LLP

20060292234 - Composition and therapeutic uses thereof: A physiologically ingestible with microstructured water having an increased pH compared to unstructured water is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to heal a wound or increase a... Agent: Fleshner & Kim, LLP

20060292235 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water with an ultraviolet spectrophotometric pattern is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to treat infection in a mammal.... Agent: Fleshner & Kim, LLP

20060292238 - Composition and therapeutic uses thereof: A physiologically ingestible with microstructured water having an increased pH compared to unstructured water is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to treat infection in a mammal.... Agent: Fleshner & Kim, LLP

20060292239 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a negative oxidation reduction potential of at least −40, and uses thereof are provided. The composition may further included dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to... Agent: Fleshner & Kim, LLP

20060292240 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water essentially of hydrogen and oxygen atoms, and dissolved oxygen is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The composition may further include microstructured water having a pH of at... Agent: Fleshner & Kim, LLP

20060292236 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using tuned super-oxygenated and structured water having multiple attributes, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil... Agent: Fleshner & Kim, LLP

20060292237 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by water preconditioned for electrolysis and the uses thereof are provided. The matter is obtained by using water obtained by adding ozone to the water, and passing the water through a magnetic flux. The processing of water may further include filtering water received... Agent: Fleshner & Kim, LLP

20060292241 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The super-oxygenated and structured water is produced by receiving water from a source, preconditioning the water for electrolysis, performing electrolysis on the preconditioned water to produce alkaline water, combining the alkaline water... Agent: Fleshner & Kim, LLP

20060292242 - Use of zeolithes for reducing the proportion of lactates and ammonium in human and animal organisms: The invention relates to lowering the lactate values or the ammonium values in the blood of mammals, including humans. According to the invention, ground zeolites are administered orally in the form of a consumption product or a drug. In particular, the zeolite is chosen from the group of natural zeolites... Agent: John P White Cooper & Dunham

20060292243 - Arsenic compounds for the treatment of the arsenic-sensitive blast-cell related diseases: A method of treatments for arsenic-sensitive blast-cell related diseases comprising administering a therapeutically effective amount of arsenic compounds to a human or an animal.... Agent: Hershkovitz & Associates

20060292244 - Use of pvp-iodine liposomes for treatment of acne: The invention concerns a method for the production of a pharmaceutical preparation for the treatment of acne forms that is characterized in, that the preparation comprises at least one antiseptic compound associated with a particular carrier.... Agent: Sterne, Kessler, Goldstein & Fox PLLC

20060292245 - Pain relief compositions: A pain relieving composition for topical application is provided that includes magnesium sulfate (Epsom salts). The composition provides magnesium sulfate in an amount effective for providing pain relief. The composition has a viscosity effective for allowing topical application of the composition to an afflicted area where the magnesium sulfate is... Agent: Fitch Even Tabin And Flannery

20060292246 - Characteristic mass spectral fingerprint setting method and rapid identification method for chinese herbal medicines and prescriptions: A characteristic mass spectral fingerprint setting method and a rapid identification method for Chinese herbal medicines or prescriptions are provided, which comprise directly injecting extracts of Chinese herbal medicines or prescriptions into a mass spectrometer with an electrospray ionization interface via an autosampler of a liquid chromatograph without going through... Agent: Ladas & Parry

20060292247 - Neutralizing agent for toxin of clostridium microorganisms: As a safe and easy-to-use neutralizing agent for toxins of Clostridium microorganisms, a neutralizing agent comprising Thearubigin as its effective component is provided.... Agent: Wenderoth, Lind & Ponack, L.L.P.

20060292248 - Biological attack protection kit and method: A portable kit includes one or more different forms of bio-attack protection agents that are effective in killing or disabling harmful biological substances. The kit is easy to transport and is practical for normal, every day use. It contains one or more vessels holding bio-attack protection agents thereby providing personal... Agent: Connors Associates

20060292249 - Oral compositions for the treatment of cellulite: The present invention relates to oral pharmaceutical and cosmetic compositions for the treatment of cellulite containing Vitis vinifera extracts, Centella asiatica triterpenes and dimeric Ginkgo biloba flavonoids, in the free form or complexed with phospholipids.... Agent: Mathews, Shepherd, Mckay, & Bruneau, P.A.

20060292250 - Supplement composition and method of use for enhancement of anti-inflammation process: A supplement composition for enhancement of anti-inflammation process is provided, which contains nettle leaf extract, hops extract, and turmeric rhizome extract. The supplement composition further includes hyaluronic acid, sodium salt, glucosamine sulfate, and chondroitin sulfate. Further provided is a method of using the supplement composition for enhancement of anti-inflammation process.... Agent: Melvin K. Silverman

20060292253 - Active substance combination of licochalcone a and phenoxyethanol: A cosmetic or pharmaceutical preparation comprising licochalcone A and phenoxyethanol. This Abstract is not intended to define the invention disclosed in the specification, nor intended to limit the scope of the invention in any way.... Agent: Greenblum & Bernstein, P.L.C

20060292251 - Method for enhancing nutrient absorption with astragalosides: There is provided a method for enhancing the absorption of a nutrient in a subject, including administering to the subject an effective amount of a astragaloside compound purified from Astragalus membranaceus var. mongholicus for facilitating transportation of the nutrient across gut cells of the subject.... Agent: Akin Gump Strauss Hauer & Feld L.L.P.

20060292252 - Synergistic composition for the treatment of diabetes mellitus: The present invention relates to a synergistic composition for the treatment of diabetes in a subject in need thereof, said composition-comprising Trigonelline of concentration ranging between 20 to 30%, amino acids of concentration ranging between 20 to 60%, and soluble fiber of concentration ranging between 10 to 60%, optionally along... Agent: Merchant & Gould PC

20060292254 - Orally and nasally administered appetite suppressant: Methods are described for suppressing appetite through the nasal and oral administration of a vanillylamide, thereby desensitizing gustatory or olfactory nerves and reducing the appeal of food. Long term desensitization is particularly contemplated.... Agent: Knobbe Martens Olson & Bear LLP

20060292255 - Pharmaceutical and therapeutic compositions derived from garcinia mangostana l plant: The present invention relates to pharmaceutical, therapeutic, nutritional, cosmetic, and dermatological compositions derived from the preicarp (rind) of the Garcinia mangostana L plant and the novel extraction processes used to produce those compositions. Specifically, the present invention relates, in part, to an approximately 0.01% to about 80% mixture of a... Agent: Greenberg Traurig, LLP

20060286030 - Anti-cd71 monoclonal antibodies and uses thereof for treating malignant tumor cells: The present invention provides novel anti-CD71 monoclonal antibodies, in particular mouse-human chimeric anti-CD71 monoclonal antibodies, advantageously associated to effector cells for triggering ADCC mechanisms. Anti-CD71 antibodies, as well as pharmaceutical compositions containing them, are useful for inhibiting proliferation and/or killing malignant tumor cells, especially metastatic cutaneous and uveal melanoma cells.... Agent: Lahive & Cockfield

20060286031 - Modulators of tissue regeneration: Proteins which are upregulated in injured or regenerating tissues, as well as the DNA encoding these proteins, are disclosed, as well as therapeutic compositions and methods of treatment encompassing these compounds.... Agent: Fish & Richardson PC

20060286032 - A radiosotope-chitosan complex for treatment of prostate cancer: Disclosed is a composition for treating prostate cancer. The composition for treating prostate cancer comprises as an effective ingredient a radioisotope-chitosan complex that includes a therapeutic radioisotope emitting beta radiation and chitosan. Also, the present invention discloses a kit for preparing the composition. When directly administered to a prostate cancer... Agent: Lucas & Mercanti, LLP

20060286033 - Targeting pulmonary epithelium using adrp: This invention provides novel compositions and methods for the specific and/or preferential delivery of an effector (e.g. a drug or label) to an epithelial cell (e.g. a pulmonary epithelium). The compositions comprise an adipocyte differentiation-related protein (ADRP) attached to an effector thereby forming a chimeric moiety. The chimeric moiety is... Agent: Beyer Weaver & Thomas, LLP

20060286036 - Methods and compositions for inhibiting hiv infection: This invention provides novel methods for identifying agents that inhibit HIV infection. The anti-HIV agents are identified by screening test compounds for ability to modulate a biological activity of isopeptidase T (IsoT), e.g., its isopeptidase activity or its binding to another molecule such as viral protein R (Vpr). Such IsoT... Agent: Genomics Institute Of The Novartis Research Foundation

20060286035 - Methods and compositions for modulating the interaction between adiponectin and its receptor: The invention is directed to methods for identifying agents that mimic or modulate the interaction between adiponectin and its receptor. In particular, the invention is directed to methods for mimicking or modulating the adiponectin-T-cadherin interaction in order to treat diseases and disorders associated with a deficiency or overabundance of adiponectin.... Agent: Sterne, Kessler, Goldstein & Fox PLLC

20060286034 - Oligosaccharide biomarkers for mucopolysaccharidoses and other related disorders: The present invention is related to methods for diagnosing mucopolysaccharidoses (“MPS”) and related diseases. This invention pertains to methods for identifying and quantitating biochemical markers (“biomarkers”) that are present in biological fluids or tissues of a patient having a MPS or related disorder. One aspect of the method comprises determining... Agent: T Ling Chwang Jackson Walker

20060286037 - Heart-slowing drug containing short-acting ß blocker as the active ingredient: The present invention relates to an agent which slows down the heart rate which has an excellent controlling ability in diagnostic imaging comprising a short-acting β-blocker (e.g. landiolol hydrochloride or esmolol hydrochloride). The short-acting β-blocker has a property of slowing down the heart rate and it can temporarily suppress the... Agent: Sughrue Mion, PLLC

20060286039 - Novel treatment for pathological aggression: The use of compounds belonging to the class of substituted pentanedioic acids to control aggressive behavior provides new means of treatment for this syndrome.... Agent: Glenna Hendricks

20060286038 - Pulmonary surfactant formulations: Synthetic pulmonary surfactant compositions comprising dipalmitoyl phosphatidylcholine, phosphatidylglycerol, and essentially neutral lipid, and having essentially no 1-palmitoyl 2-oleoyl phosphatidylglycerol and essentially no palmitic acid are provided. Methods for treating respiratory disease are also provided comprising administering a therapeutically effective amount of a synthetic pulmonary surfactant comprising dipalmitoyl phosphatidylcholine, phosphatidylglycerol, and... Agent: Woodcock Washburn LLP

20060286043 - Delivery of antihistamines through an inhalation route: The present invention relates to the delivery of antihistamines through an inhalation route. Specifically, it relates to aerosols containing antihistamines that are used in inhalation therapy. In a method aspect of the present invention, an antihistamine is delivered to a patient through an inhalation route. The method comprises: a) heating... Agent: Swanson & Bratschun, L.l.c

20060286042 - Delivery of sedative-hypnotics through an inhalation route: The present invention relates to the delivery of sedative-hypnotics through an inhalation route. Specifically, it relates to aerosols containing sedative-hypnotics that are used in inhalation therapy. In a method aspect of the present invention, a sedative-hypnotic drug is administered to a patient through an inhalation route. The method comprises: a)... Agent: Swanson & Bratschun, L.l.c

20060286040 - Medicament compositions comprising a heterocyclic compound and an anticholinergic: The present invention relates to novel pharmaceutical compositions based on anticholinergics of the formula 1; wherein X−, R1 ? and Ar are defined as in claim 1, and a heterocyclic compound of the formula 2. Furthermore, the invention relates to processes for preparing them and their use in the treatment... Agent: Darby & Darby P.C.

20060286041 - Mrp iv inhibitors for the treatment of respiratory diseases: The present invention relates to the use of MRP4 inhibitors for the treatment of respiratory diseases, pharmaceutical compositions containing them and processes for the preparation thereof.... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20060286044 - Anti-caries oral care composition with xylitol: An oral care composition comprises xylitol and a water-soluble calcium salt for caries prevention. Methods of treating and preventing dental caries are also provided.... Agent: Colgate-palmolive Company

20060286045 - Consumer product comprising a natural preservative system and a method for making the same: Consumer products comprising a natural preservative system are described. The preservative system has a mixture of aliphatic and aromatic isothiocyanates and is suitable for use in a variety of consumer products.... Agent: Unilever Intellectual Property Group

20060286046 - Skin care compositions: A skin care composition is provided which preferably comprises a mixture of N-acetylcysteine and L-carnosine in combination with a cosmetic, dermatological or pharmaceutically acceptable carrier therefor. The composition may optionally be provided as a sunscreen formulation, and provides a method for the prevention, amelioration or treatment of pathological conditions of... Agent: Gowan Intellectual Property

20060286047 - Methods for determining the sequence of a peptide motif having affinity for a substrate: Disclosed herein are methods for determining peptide motifs having binding affinity for a specified substrate. The method proceeds through the analysis of a population of peptides having some affinity for a substrate for the identification of the presence of subsequences that occur statistically more frequently than by random chance. These... Agent: E I Du Pont De Nemours And Company Legal Patent Records Center

20060286049 - Cosmetic composition comprising a tribochromic compound, process using this composition and uses: The present disclosure relates to a cosmetic composition comprising, in an appropriate cosmetic medium, at least one tribochromic compound. The present disclosure also relates to a process for making up the lips, skin, or integuments using the compostions disclosed herein, wherein the at least one tribochromatic compound has the property... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060286048 - Dustless powder materials: This invention relates to a coated powder material containing a powder material having a surface layer that has been chemically immobilized with one or more surface-active agents and coated with an oil. The surface-active agents are present in an amount of at least about 0.1% by weight, based on the... Agent: Pillsbury Winthrop Shaw Pittman, LLP

20060286050 - Moisturizing lipstick compositions: A moisturizing cosmetic composition containing at least one oil gelling agent; at least one wax component; at least one polar oil; at least one active ingredient; and optionally, at least one colorant; and wherein the at least one wax component and at least one polar oil are present in a... Agent: L'oreal Usa/ Patent Department

20060286051 - Antibacterial deodorant and method for producing the same: Present invention provides an antibacterial deodorant with antibacterial characteristics and high deodorizing capability. The antibacterial deodorant is inorganic oxide particles comprising a metal component and an inorganic oxide other than the metal component, the inorganic oxide includes titanium oxide and silica and/or zirconia, and the titanium oxide is crystalline titanium... Agent: Kanesaka Berner And Partners LLP

20060286052 - Esterification product and cosmetic: An oily raw material which is usable as an oily raw material for cosmetics and has water-holding properties; and a cosmetic containing this material. The water-holding oily raw material is an esterification product obtained by esterifying polyglycerol having an average degree of polymerization of 6 to 15 with a C8-22... Agent: Birch Stewart Kolasch & Birch

20060286053 - Non-irritating compositions: The present invention provides a base composition that allows for the formulation of non-irritating cosmetic and/or dermatological compositions. The base composition includes one or more of electrolyte, buffer, mild preservative, lubricant, or any combinations thereof. It is preferred that one or more of the above components are eye-safe and/or eye-compatible.... Agent: Charles N.j. Ruggiero, Esq. Ohlandt, Greeley, Ruggiero & Perle, L.L.P.

20060286054 - Pharmaceutical compositions for the treatment of psoriasis: Pharmaceutical compositions for the treatment of skin disorders such as psoriasis, acne and eczema, methods of making the compositions and methods of use thereof are described herein. The composition comprises psorberine, an alcohol-water extract isolated from the Mahonia aquifolium plant, and one or more additional active agents. In a preferred... Agent: Patrea L. Pabst Pabst Patent Group LLP

20060286055 - Aqueous fatty monoamine-containing carrier systems for water-insoluble materials: The present invention is drawn to a carrier composition containing: (a) at least one fatty monoamine compound; (b) at least one nonionic surfactant; (c) at least one anionic silicone; and (d) at least one water-insoluble material, and wherein the composition, when combined with an aqueous phase, forms an aqueous delivery... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20060286056 - Aqueous fatty quaternary amine-containing carrier systems for water-insoluble materials: The present invention is drawn to a carrier composition containing: (a) at least one fatty quaternary amine compound; (b) at least one nonionic surfactant; (c) at least one anionic silicone; and (d) at least one water-insoluble material, and wherein the composition, when combined with an aqueous phase, forms an aqueous... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20060286057 - Aqueous polyamine-containing carrier systems for water-insoluble materials: The present invention is drawn to a carrier composition containing: (a) at least one polyamine compound comprising at least two amino groups; (b) at least one nonionic surfactant; (c) at least one anionic silicone; and (d) at least one water-insoluble material, and wherein the composition, when combined with an aqueous... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20060286058 - System for cleaning and conditioning hair: A system for cleaning and conditioning hair, in particular, fine, thin hair is provided. The system comprises, as individually packaged compositions: (A) an aqueous pre-shampoo conditioner comprising: i) a cationic conditioning polymer having a charge density of at least 1.8 meq/g, ii) cationic conditioning surfactant, iii) a fatty alcohol material;... Agent: Unilever Intellectual Property Group

20060286059 - Hair conditioning composition comprising gel matrix and high molecular weight water-soluble cationic polymer: Disclosed is a hair conditioning composition comprising by weight: (a) from about 0.01% to about 10% of a high molecular weight water-soluble cationic polymer having a molecular weight of about 5,000,000 or more; (b) a gel matrix comprising: from about 0.1% to about 10% by weight of the composition of... Agent: The Procter & Gamble Company Intellectual Property Division

20060286060 - Hair conditioning composition comprising cationic surfactant comprising mono-long alkyl quaternized ammonium and alkyl sulfate anion: Disclosed is a hair conditioning composition comprising: a cationic surfactant comprising a mono-long alkyl quatemized ammonium and C1-C4 alkyl sulfate; a high melting point fatty compound; and an aqueous carrier; wherein the cationic surfactant, the high melting point fatty compound, and the aqueous carrier from a lamellar gel matrix. The... Agent: The Procter & Gamble Company Intellectual Property Division

20060286061 - Amide esters as hydrocarbon gellants: The invention relates to gelling agents, and in particular to gellants for low polarity liquids such as hydrocarbons, and the use thereof in commercial products, e.g., personal care products.... Agent: Anthony J O'lenick Jr

20060286062 - Completely natural plant based shampoo and body wash devoid of synthetic ingredients: Completely natural hair shampoo or body wash made from all plant and agricultural materials containing anti-oxidants from plant materials, and mild natural surfactants from plant materials. Surfactants, oils, conditioners, preservatives, fragrance and color are all derived from plants and clays. As the surfactants are predominantly from unrefined pant materials, cleansing... Agent: Raymond A. Schep C/o Colonial Dames

20060286065 - Releasable polymeric conjugates based on aliphatic biodegradable linkers: m

20060286064 - Therapeutic polymers and methods: The present invention provides biodegradable therapeutic polymer compositions based on poly(ester amide) (PEA), poly(ester urethane) (PEUR), and poly(ester urea) (PEU) polymers useful for in vivo delivery of at least one therapeutic diol or di-acid incorporated into the backbone of the biodegradable polymer. The therapeutic polymer compositions biodegrade in vivo by... Agent: Dla Piper US LLP

20060286063 - Combination drug therapy for reducing scar tissue formation: The present invention describes various devices and methods wherein a cytostatic antiproliferative drug, either alone or in combination with other drugs, is placed between internal body tissues to prevent the formation of scar tissue and/or adhesions during healing of a wound or surgical site. Specific devices to achieve this administration... Agent: Peter G. Carroll Medlen & Carroll, LLP

20060286068 - G-csf conjugates: Polypeptide conjugates with G-CSF activity comprising a polypeptide having at least one introduced lysine residue and at least one removed lysine residue compared to the sequence of human G-CSF, and which are conjugated to 2-6 polyethylene glycol moieties. The conjugates have a low in vitro bioactivity, a long in vivo... Agent: Maxygen, Inc. Intellectual Property Department

20060286069 - G-csf conjugates: Polypeptide conjugates with G-CSF activity comprising a polypeptide having at least one introduced lysine residue and at least one removed lysine residue compared to the sequence of human G-CSF, and which are conjugated to 2-6 polyethylene glycol moieties. The conjugates have a low in vitro bioactivity, a long in vivo... Agent: Maxygen, Inc. Intellectual Property Department

20060286067 - Methods for making and using regulatory t cells: The invention is generally related to methods of making regulatory T cells and treating autoimmune diseases, including both antibody-mediated and cell-mediated disorders.... Agent: Richard F. Trecartin Dorsey & Whitney LLP

20060286066 - Pegylated immunoglobulin variable region polypeptides: The present invention encompasses a naturally occurring, or synthetic polymer-linked polypeptide comprising one or more antibody domains.... Agent: Palmer & Dodge, LLP Kathleen M. Williams

20060286070 - Methods related to immunostimulatory nucleic acid-induced interferon: Methods and compositions are provided for extending the clinical utility of IFN-α in the treatment of a variety of viral and proliferative disorders. Among other aspects, the invention provides methods which increase the efficacy of IFN-α treatment and reduce IFN-α treatment-related side effects. In addition, methods are provided for supporting... Agent: Wolf Greenfield & Sacks, PC

20060286072 - techniques and compositions for treating cardiovascular disease by in vivo gene delivery: Methods are provided for treating patients with cardiovascular disease, including heart disease and peripheral vascular disease. The preferred methods of the present invention involve in vivo delivery of genes, encoding angiogenic proteins or peptides, to the myocardium or to peripheral ischemic tissue, by introduction of a vector containing the gene... Agent: Morrison & Foerster LLP

20060286073 - Compositions and methods for sirna inhibition of angiogenesis: RNA interference using small interfering RNAs which are specific for the vascular endothelial growth factor (VEGF) gene and the VEGF receptor genes Flt-1 and Flk-1/KDR inhibit expression of these genes. Diseases which involved angiogenesis stimulated by overexpression of VEGF, such as diabetic retinopathy, age related macular degeneration and many types... Agent: Pepper Hamilton LLP 500 Grant Street

20060286075 - Method and compositions for treating hepatocellular cancer: A method for preventing or for treating cancer in a mammal, where the cancer cells express at least a part of an alpha fetoprotein molecule at the cell surface. The method comprises creating an immune response in the mammal to at least part of the amino acid sequence of an... Agent: Sheldon Mak Rose & Anderson PC

20060286074 - Methods for immunotherapy of cancer: Provided are methods of generating an immune response to an antigen specifically associated with tumor vascular endothelial cells (TVECA). The method comprises administering to an individual an expression vector encoding the TVECA. The vector comprises a transcription unit encoding a secretable fusion protein, the fusion protein containing a TVECA and... Agent: Foley & Lardner LLP

20060286071 - Therapeutic pastes for medical device coating: This invention provides a high-solids therapeutic composition for coating a medical device comprising: (a) a first material which is a hydrophilic therapeutic agent; and (b) a second material which includes a hydrophobic polymer and an emulsifying surfactant, wherein the composition is in a singular stable phase. Also provided is a... Agent: Kenyon & Kenyon LLP

20060286081 - Conditioned cell culture medium, method to obtain the same and use of it for maintenance, proliferation and differentiation of mammalian cells: The invention relates to a conditioned cell culture medium and a corresponding method to obtain it. The invention also refers to methods of using this cellconditioned medium for the maintenance, proliferation and differentiation of mammalian cells. The culture medium produced in accordance with the present invention is conditioned by the... Agent: Stetina Brunda Garred & Brucker

20060286083 - Ex vivo and in vivo expression of the thrombomodulin gene for the treatment of cardiovascular and peripheral vascular diseases: The present invention relates to methods and compositions for treatment of cardiovascular and peripheral vascular diseases using ex vivo and in vivo gene delivery technologies. One aspect of the present invention relates to a method for treating a vascular disease by introducing a DNA sequence encoding a TM protein or... Agent: Dla Piper US LLP Attn: Patent Group

20060286080 - Method for obtaining plasmid-dna by means of an aqueous biphasic system: The invention relates to a process for isolation of plasmid DNA from biomass by means of an aqueous 2-phase system having a polymer component and a salt component, characterized in that the resuspension of the biomass employed, the alkaline lysis of the biomass, the neutralization of the alkaline lysis batch... Agent: Leon R Yankwich Yankwich & Associates

20060286082 - Systems and methods for generating biological material: The invention relates to systems and methods for synthesizing biological material.... Agent: Fish & Richardson PC

20060286076 - Device and method for applying active substances to the surface of a wound: The invention relates to the application of active substances to the surface of a wound. An insert made of porous material is applied to the surface of the wound, and a sealing overlay is used to cover the surface of the wound and the inlay. The liquid active substance is... Agent: Akerman Senterfitt

20060286078 - Methods of treating cardiorenal syndrome and hepatorenal syndrome: A method of treating a patient with cardiorenal syndrome and hepatorenal syndrome are provided in which a portion of the body fluid of the patient is exposed to renal epithelial cells, outside of the kidney of the patient, whereby the body fluid is in fluid communication with renal epithelial cells... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20060286077 - Perivascular mesenchymal precursor cell induced blood vessel formation: Mesenchymal precursors cells have been isolated from perivascular niches from a range of tissues utilizing a perivascular marker. A new mesenchymal precursor cell phenotype is described characterized by the presence of the perivascular marker 3G5, and preferably also alpha smooth muscle actin together with early developmental markers such as STRO-1... Agent: Cooper & Dunham, LLP

20060286079 - Use of cytokines and mitogens to inhibit pathological immune responses: The invention is generally related to methods of treating autoimmune diseases, including both antibody-mediated and cell-mediated disorders.... Agent: Dorsey & Whitney LLP

20060286084 - Agent for promoting osteogenesis and/or inhibiting bone resorption: Provided is a novel agent for promoting osteogenesis and/or inhibiting bone resorption, which: can be directly taken from daily meals by mouth for long periods without any trouble in taste; directly impart a promoting effect on osteogenesis and an inhibiting effect on bone resorption to the bone; and can be... Agent: Young & Thompson

20060286085 - Tissue inhibitor of metalloproteinase type three (timp-3) composition and methods: The present invention relates in general to metalloproteinase inhibitors and to polynucleotides encoding such inhibitors. In particular, the invention relates to novel mammalian inhibitors of metalloproteinase, which are designated as type three or TIMP-3, to fragments, derivatives, and analogs thereof, and to polynucleotides encoding the same. Novel methods of producing... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060286086 - Lysozyme-based food stuff: Homogenized, semi-solid food stuff fortified with lysozyme for augmentation of the immune system and to aid the immune compromised.... Agent: Norris, Mclaughlin & Marcus P.A.

20060286087 - Recombinant alpha-l-iduronidase, methods for producing and purifying the same and methods for treating diseases caused by deficiencies thereof: The present invention provides a recombinant α-L-iduronidase and biologically active fragments and mutants thereof, methods to produce and purify this enzyme as well as methods to treat certain genetic disorders including—α-L-iduronidase deficiency and mucopolysaccharidosis I (MPS 1).... Agent: Marshall, Gerstein & Borun LLP

20060286088 - Administration of enoxaparin sodium to patients 75 years and older with st-segment elevation myocardial infarction: Methods for treating ST-segment elevation myocardial infarction in a human patient 75 years of age or older. The methods comprise administering a dose of less than 1 mg per kg body weight, about 0.75 mg per kg of body weight, or 0.75 mg per kg of body weight of enoxaparin... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060286089 - Compositions and methods for the treatment of burns and sepsis: The present invention relates generally to methods for treating burns and sepsis, in particular for treating immune dysfunction associated with burns and sepsis. The present invention also relates to activating and expanding T cells for the treatment of burns and sepsis.... Agent: Seed Intellectual Property Law Group PLLC

20060286090 - Mediators of epithelial adhesion and their role in cancer and skin disorders: Perp is shown to mediate stratified epithelial development in vivo. Perp localizes specifically to desmosomes, adhesion junctions important for tissue integrity. In some embodiments of the invention, detection of autoantibodies specific for perp find use in the diagnosis of pemphigus. In other embodiments, agent that upregulate or mimic perp function... Agent: Bozicevic, Field & Francis LLP

20060286094 - Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same: Hapten-carrier conjugates capable of eliciting anti-hapten antibodies in vivo by administering, in a therapeutic composition, are disclosed. Methods of preparing said conjugates and therapeutic compositions are also disclosed. Where the hapten is a drug of abuse, a therapeutic composition containing the hapten-carrier conjugate is particularly useful in the treatment of... Agent: Jones Day

20060286095 - Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same: Hapten-carrier conjugates capable of eliciting anti-hapten antibodies in vivo by administering, in a therapeutic composition, are disclosed. Methods of preparing said conjugates and therapeutic compositions are also disclosed. Where the hapten is a drug of abuse, a therapeutic composition containing the hapten-carrier conjugate is particularly useful in the treatment of... Agent: Jones Day

20060286096 - Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same: Hapten-carrier conjugates capable of eliciting anti-hapten antibodies in vivo by administering, in a therapeutic composition, are disclosed. Methods of preparing said conjugates and therapeutic compositions are also disclosed. Where the hapten is a drug of abuse, a therapeutic composition containing the hapten-carrier conjugate is particularly useful in the treatment of... Agent: Jones Day

20060286097 - Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same: Hapten-carrier conjugates capable of eliciting anti-hapten antibodies in vivo by administering, in a therapeutic composition, are disclosed. Methods of preparing said conjugates and therapeutic compositions are also disclosed. Where the hapten is a drug of abuse, a therapeutic composition containing the hapten-carrier conjugate is particularly useful in the treatment of... Agent: Jones Day

20060286098 - Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same: Hapten-carrier conjugates capable of eliciting anti-hapten antibodies in vivo by administering, in a therapeutic composition, are disclosed. Methods of preparing said conjugates and therapeutic compositions are also disclosed. Where the hapten is a drug of abuse, a therapeutic composition containing the hapten-carrier conjugate is particularly useful in the treatment of... Agent: Jones Day

20060286099 - Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same: Hapten-carrier conjugates capable of eliciting anti-hapten antibodies in vivo by administering, in a therapeutic composition, are disclosed. Methods of preparing said conjugates and therapeutic compositions are also disclosed. Where the hapten is a drug of abuse, a therapeutic composition containing the hapten-carrier conjugate is particularly useful in the treatment of... Agent: Jones Day

20060286092 - Methods of using pnkp30, a member of the b7 family, to modulate the immune system: Novel methods of using isolated polypeptides, isolated polynucleotides encoding the polypeptides, and related compositions are disclosed for pNKp30 protein. The methods involved modulating the proliferation of T-cells in vitro and in vivo and modulation of immune response. The present invention also includes methods for producing pNKp30, including soluble molecules, uses... Agent: Zymogenetics, Inc. Intellectual Property Department

20060286091 - Rela-associated inhibitor, process for producing the same and utilization thereof: Human RelA-associated inhibitor (RAI) comprising 351 amino acid, process for producing it, cDNA encoding it, fragment capable of hybridizing selectively to the cDNA sequence, plasmid for expression and duplication comprising the cDNA, host cell transformed with the plasmid, antibody against the polypeptide, pharmaceutical composition comprising the polypeptide or the antibody... Agent: Sughrue Mion, PLLC

20060286093 - Soluble receptor br43x2 and methods of using: Soluble, secreted tumor necrosis factor receptor polypeptides, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed. The polypeptides comprise one cysteine-rich repeat that is homologous to other tumor necrosis factor receptors, such as transmembrane activator and CAML-interactor (TACI). The polypeptides may be used for detecting ligands, agonists and... Agent: Zymogenetics, Inc. Intellectual Property Department

20060286100 - Use of cd23 antagonists for the treatment of neoplastic disorders: Methods and kits for the treatment of neoplastic disorders comprising the use of a CD23 antagonist are provided. The CD23 antagonist may be used alone or in combination with chemotherapeutic agents. In particularly preferred embodiments the CD23 antagonists may be used to treat B cell chronic lymphocytic leukemia (B-CLL).... Agent: Pillsbury Winthrop Shaw Pittman, LLP

20060286101 - Use of cd23 antagonists for the treatment of neoplastic disorders: Methods and kits for the treatment of neoplastic disorders comprising the use of a CD23 antagonist are provided. The CD23 antagonist may be used alone or in combination with chemotherapeutic agents. In particularly preferred embodiments the CD23 antagonists may be used to treat B cell chronic lymphocytic leukemia (B-CLL).... Agent: Pillsbury Winthrop Shaw Pittman, LLP

20060286102 - Cell surface receptor isoforms and methods of identifying and using the same: Isoforms of cell surface receptors, including isoforms of receptor tyrosine kinases, and pharmaceutical compositions containing the isoforms are provided. Chimeras of and conjugates containing the cell surface receptors that contain a portion, such as an extracellular domain, from one cell surface receptor, and a second portion, particularly an intron-encoded portion,... Agent: Fish & Richardson, PC

20060286103 - Stable antibody formulation: The present invention provides a pharmaceutical formulation comprising an antibody or antigen-binding fragment thereof that exhibits high stability; along with methods of use thereof.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20060286104 - Superagonistic anti-cd28 antibodies: The present invention relates to one or more nucleic acid(s) encoding a binding molecule specifically binding to a human CD28 molecule, comprising (a) a nucleic acid sequence encoding a VH region and a nucleic acid sequence encoding a VL region comprising CDRs in a human immunoglobulin framework, wherein (i) the... Agent: Dla Piper US LLP

20060286107 - Parathyroid hormone antibodies and related methods: Methods of preparing antibodies that recognize and bind three-dimensional epitopes of antigens are disclosed. The methods are particularly useful for preparing antibodies that bind the bioactive, three-dimensional amino terminus of parathyroid hormone. The antibodies so produced are used in diagnostic and therapeutic applications.... Agent: Donald E. Stout Stout, Uxa, Buyan & Mullins, LLP

20060286106 - Systemic marker for monitoring anti-inflammatory and antioxidant actions of therapeutic agents: A diagnostic method of monitoring anti-inflammatory and/or antioxidant actions of therapeutic agents comprises determining the level of at least one systemic marker indicative of inflammation or oxidation in a bodily sample taken from a subject at base line or following administration of the therapeutic agent. The marker includes at least... Agent: Calfee Halter & Griswold, LLP

20060286105 - Tgf-beta antagonists combined with renin-angiotensin-aldosteron-system antagonists for treating renal insufficiency: The disclosure provides methods for treating, preventing, and reducing risk of occurrence of renal insufficiency in mammals. The disclosed methods include administering to a subject susceptible to, or afflicted with, renal disorder therapeutically effective amounts of a TGF-β antagonist and a renin-angiotensin-aldosterone system (RAAS) antagonist so as to maintain desirable... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060286108 - Topical compositions for the treatment of chronic wounds: Methods for treating chronic wounds in a human are described by topically administering a dermatological composition comprising a TNF antagonist, a TACE inhibitor, a neutrophil antagonist, or a combination of a TNF antagonist and/or TACE inhibitor and a neutrophil antagonist. The TNF antagonist administered includes alefacept, efalizumab, etanercept, adalimumab, and... Agent: Locke Liddell & Sapp LLP

20060286109 - Compositions and vaccines containing antigen(s) of cryptosporidium parvum and of another pathogen: Combination compositions including C. parvum antigen(s) or epitope(s) of interest with at least one other antigen or epitope of interest from a pathogen that causes enteric infection and/or symptoms and/or recombinant(s) and/or vector(s) and/or plasmid(s) expressing such antigen(s) or epitope(s) of interest and administration of such compositions such as to... Agent: Frommer Lawrence & Haug

20060286110 - Bax-responsive genes for drug target identification in yeast and fungi: The invention describes the use of nucleic acids and polypeptides which are involved in a pathway eventually leading to programmed cell death of yeast or fungi for the preparation of a medicament for treating diseases associated with yeast or fungi or for the treatment of proliferative disorders or for preventing... Agent: Philip S. Johnson Johnson & Johnson

20060286113 - Anticarcinoma antibodies and uses thereof: A novel single domain antibody AFAI and fragments thereof which has specific affinity for binding to carcinoma, and especially lung carcinoma. This antibody, and portions thereof, can be used, inter alia in the diagnosis and treatment of carcinoma.... Agent: Cassan Maclean

20060286112 - Human monoclonal antibodies that bind to very late antigen-1 for the treatment of inflammation and other disorders: The present invention relates to antibodies directed to very late antigen-1 (“VLA-1”) and uses of such antibodies. For example human monoclonal antibodies directed to VLA-1 are described. Isolated polynucleotide sequences encoding, and amino acid sequences comprising, heavy and light chain immunoglobulin molecules, particularly sequences corresponding to contiguous heavy and light... Agent: Knobbe Martens Olson & Bear LLP

20060286111 - Tumor necrosis factor related ligand: Tumor Necrosis Factor Related Ligand (TRELL) polypeptides, a novel member of the tumor necrosis factor family (TNF) and compositions comprising them are disclosed.... Agent: Fish & Richardson PC

20060286116 - Methods and compositions for treating b cell cancer: Disclosed are methods for killing or retarding the growth of a B cell cancer cell, by contacting the cell with a FRIL family member molecule. Also disclosed are methods for determining if a B cell cancer is sensitive to a FRIL family member molecule, or if a B cell cancer... Agent: Wilmer Cutler Pickering Hale And Dorr LLP

20060286117 - Neuronally expressed stem cell factor modulates angiogenesis and neural stem cell migration to areas of brain injury: The present invention relates to methods of promoting or inhibiting angiogenesis in humans comprising administering to a human in need thereof an effective amount of Stem Cell Factor or a modulator of Stem Cell Factor or an agonist or antagonist of c-Kit and methods of inducing migration of a neural... Agent: Knobbe, Martens, Olson & Bear, LLP

20060286115 - Preventive cancer vaccine based on brother of regulator of imprinted sites molecule: Polynucleotides encoding a nonfunctional mutant form of the Brother of Regulator of Imprinted Sites (BORIS) molecule, nonfunctional mutated BORIS protein, polypeptide or peptide and modified protein forms of BORIS are described. These molecules are used as a therapeutic vaccine against cancer.... Agent: Birch Stewart Kolasch & Birch

20060286114 - Synthetic gene encoding rhesus monkey carcinoembryonic antigen and uses thereof: Synthetic polynucleotides encoding rhesus monkey carcinoembryonic antigen (CEA) are provided, the synthetic polynucleotides being condon-optimized for expression in a human cellular environment. The gene encoding CEA is commonly associated with the development of human carcinomas. The present invention provides compositions and methods to elicit or enhance immunity to the protein... Agent: Merck And Co., Inc

20060286119 - Compositions and methods for treatment of chronic and infectious diseases: The present invention generally features therapeutic and diagnostic compositions and methods for increasing or decreasing the binding of a lysozyme polypeptide to a Treponema pallidum P17 polypeptide (Tp17) or a Tp17-like polypeptide. More particularly, the invention relates to compositions and methods for detecting, treating, or preventing a pathogen infection or... Agent: Kirkpatrick & Lockhart Nicholson Graham LLP

20060286118 - Lawsonia intracllularis subunit vaccine: The present invention relates to nucleic acid sequences encoding novel Lawsonia intracelluaris proteins. It furthermore relates to DNA fragments, recombinant DNA molecules and live recombinant carriers comprising these sequences. Also it relates to host cells comprising such nucleic acid sequences, DNA fragments, recombinant DNA molecules and live recombinant carriers. Moreover,... Agent: Intervet Inc. Patent Department

20060286120 - Method of drying a plant product without using monosodium glutamate, and a product obtained by implementing the method: A method of drying a spice or aromatic herb plant product including providing a quantity Q0 of frozen plant product; adding a quantity qe of an electrolyte and mixing with a quantity qg of a glucid to obtain a homogeneous quantity Q1 of an edible water-soluble carrier substance, the carrier... Agent: Ip Group Of Dla Piper US LLP

20060286121 - Adenoviral vector-based vaccines: The invention provides a method of inducing an immune response in a mammal. The method comprises administering to the mammal a non-subgroup C adenoviral vector comprising an adenoviral fiber protein having an amino acid sequence comprising about 80% or more identity to an amino acid sequence encoding a subgroup C... Agent: Leydig Voit & Mayer, Ltd

20060286122 - Modulation of angiogenesis by bartonella henselae: The present invention relates to Bartonella henselae as a component of a pharmaceutical composition for the modulation of the angiogenesis; a nucleic acid molecule that is derived from the gene encoding the Bartonella henselae adhesin A protein (BadA), a vector comprising said nucleic acid molecule; a host containing said nucleic... Agent: Knobbe Martens Olson & Bear LLP

20060286123 - prrs vaccines: The present invention is related to improved modified live PRRS vaccines of European genotype and new PRRSV strains which can be used for the manufacture of such vaccines.... Agent: Michael P. Morris Boehringer Ingelheim Corporation

20060286124 - Vaccine compositions and methods of treating coronavirus infection: The present disclosure relates to compositions and methods for treating or preventing coronavirus infections. For example, compositions are provided that comprise a coronavirus S protein or N protein, fragment, or variant thereof, capable of eliciting a protective humoral and/or cell-mediated immune response, which compositions are useful for treating or preventing... Agent: Seed Intellectual Property Law Group PLLC

20060286125 - Nucleic acid molecules and polypeptides for immune modulation: The invention provides gp38 polypeptides, which play a role in immunomodulation, nucleic acid molecules encoding these polypeptides, and therapeutic and diagnostic methods employing these polypeptides and nucleic acid molecules. The invention also provides methods for identifying compounds that modulate the biological activities of gp38 nucleic acid molecules and polypeptides, and... Agent: Clark & Elbing LLP

20060286126 - Sealing bacterial ghosts by means of bioaffinity interactions: The invention relates to a method for preparing closed bacterial ghosts by way of specific interactions between partners of a bioaffinity binding pair, and to the bacterial ghosts which can be obtained in this way. Active compounds can be packed into the closed bacterial ghosts. The closed ghosts can be... Agent: Rothwell, Figg, Ernst & Manbeck, P.C.

20060286127 - Treatment of autoimmune disorder with a neurotoxin: Methods of treating one or more autoimmune disorders include a step of administering a Clostridial neurotoxin, such as a botulinum toxin, to a patient that has an autoimmune disorder. In one aspect, a method includes a step of administering the neurotoxin to the thymus gland or near the thymus gland... Agent: Stout, Uxa, Buyan & Mullins LLP

20060286128 - Adjuvant combinations of liposomes and mycobacteriaial lipids for immunization compositions and vaccines: The present invention provides a vaccine adjuvant consisting of a combination of a surfactant i.e. dimethyldioctadecylammonium-bromide/chloride (DDA) and a lipid extract from The present invention provides a vaccine adjuvant consisting of a combination of a surfactant i.e. dimethyldeoctadecylammonium-bromide/chloride (DDA) and a lipid extract from <The present invention provides a vaccine... Agent: Knobbe Martens Olson & Bear LLP

20060286129 - Oral glp-1 formulations: The present invention provides phamaceutical compositions comprising at least one delivery agent and GLP-1. These pharmaceutical compositions facilitate the oral delivery of GLP-1, providing improved (e.g. increased) bioavailability of GLP-1 compared to administration of GLP-1 without a delivery agent.... Agent: Darby & Darby P.C.

20060286130 - Sterile gelling agents: This invention is directed to sterile gelling agents, which retain their physico-chemical properties so that they can be used in drug delivery systems. Also described are the processes for obtaining a sterile gelling agent(s).... Agent: Bio Intellectual Property Services (bio Ips) LLC

20060286131 - Use of stellate ganglion block for the treatment of hot flashes and other conditions: The present invention is directed to a method for the treatment of a patient suffering from hot flashes and other symptoms comprising the step of administering a stellate ganglion block to the patient to alleviate the symptoms. The stellate ganglion block may be followed by a sympathectomy to provide permanent... Agent: Brian J. Lum Ice Miller LLP

20060286132 - Use of stellate ganglion block for the treatment of sexual dysfunction: The present invention is directed to a method for the treatment of a patient suffering from sexual dysfunction and other symptoms comprising the step of administering a stellate ganglion block to the patient to alleviate the symptoms. The stellate ganglion block may be followed by a sympathectomy to provide permanent... Agent: Brian J. Lum Ice Miller LLP

20060286134 - Method for removing contaminants from essential oils: Method for removing a contaminant from an essential oil comprising contacting the essential oil including the contaminant with a strong acid cation exchange resin or a strong base anion exchange resin.... Agent: Sutherland Asbill & Brennan LLP

20060286133 - Self emulsifying oily liquid cosmetic: A self emulsification type oily liquid cosmetic composition includes 8 to 30% by mass of the following component A and 50 to 92% by mass of the following component B. Component A: a polyglycerin fatty acid ester having a hydroxyl value of 450 to 700, and a branched fatty acid... Agent: Knobbe Martens Olson & Bear LLP

20060286135 - Anti-viral and anti-bacterial cleaning composition: A composition comprising at least one alcohol, at least one long-chain alkyl polyamine, and at least one halogen which is suitably for application to a surface and substantially microbial contamination.... Agent: Richard E Kurtz Ii Greenberg Traurig

20060286137 - Kits, apparatus and methods for magnetically coating medical devices with living cells: Medical devices with surfaces on which viable biologic cells are magnetically attracted and retained are disclosed along with methods of magnetic coating. The medical devices can be located in a carrier liquid containing high concentrations of magnetic cells before or after implantation. The carrier liquid with magnetic cells may be... Agent: Mueting, Raasch & Gebhardt, P.A.

20060286136 - Surface treatment of biomedical implant for improved biomedical performance: The invention provides a method of preparing a biomedical implant comprising the steps of providing a biomedical implant comprising a metal and having a surface, wherein the surface comprises a metal oxide layer, contacting the biomedical implant with a composition comprising an alkaline earth element, disrupting the metal oxide layer... Agent: Steven Weseman Associate General Counsel, I.p.

20060286143 - Bioswellable, crystalline, amphiphilic, block/graft polymers and applications thereof: Absorbable, essentially non-absorbable, and non-absorbable crystalline, amphiphilic, block/graft copolymeric compositions exhibit an inherent viscosity of at least 0.5 dL/g, a heat of fusion of at least 10 J/g and undergo swelling in the biological environment due to a water up-take of at least 10 percent of original dry mass. These... Agent: Leigh P. Gregory Attorney At Law

20060286142 - Gold surfaces coated with a thermostable chemically resistant polypeptide layer and applications thereof: The present invention provides a method for producing biomolecular coatings on devices having gold surfaces. The method describes the production of recombinant fusion proteins consisting of one or more polypeptide domains of interest and a high affinity gold binding peptide consisting of 1 to 7 repeats of a gold binding... Agent: Dla Piper US LLP

20060286140 - Implants with attached silylated therapeutic agents: The present invention is directed to implants that include therapeutic molecules bonded to their surfaces. The therapeutic molecules interact with cells that are adjacent, near, or adhering to the implant. The covalently-bonded therapeutic molecules may be released from the implant surface by changes in pH or enzymes characteristic of cells... Agent: Caesar, Rivise, Bernstein, Cohen & Pokotilow, Ltd.

20060286138 - Novel biodegradable aliphatic polyesters and pharmaceutical compositions and applications thereof: Novel biodegradable aliphatic polyesters derived from fatty diacids and fatty diols with even number of carbon atoms, pharmaceutical compositions and applications thereof wherein the said pharmaceutical compositions comprises at least one pharmaceutically active ingredient and the said biodegradable aliphatic polyester and the said pharmaceutical compositions is in the form of... Agent: Berkeley Law And Technology Group

20060286139 - Polymeric drug release system for medical devices: A coating composition comprising a mixture of a poly(vinylacetal-co-vinylalcohol-co-vinylacetate) and a poly(vinylpyrrolidone-co-vinylacetate) allows a medical device to be coated with a first layer containing a first bioactive material (such as rapamycin) and a second layer containing a second bioactive material (such as dexamethasone) for release in vivo at different release... Agent: Dewitt Ross & Stevens Intellectual Property Department

20060286141 - Systems for gel-based medical implants: Systems, including methods and apparatus, for medical implants including a gel.... Agent: Kolisch Hartwell, P.C.

20060286145 - Deployment system for a medical device: A delivery and deployment system for a self-expanding stent comprises a proximal handle having a rotatable thumbscrew and a sliding component which is attached to a distal stent restraining sheath. A rigid open coil spring is provided for converting rotation of the thumbscrew into translation of the sliding component). The... Agent: Rissman Jobse Hendricks & Oliverio, LLP

20060286146 - Hemostatic compositons and methods: The present invention provides methods and compositions involving resorbable hemostatic agents that have the essential absence of microfibrillar collagen. Resorbable hemostatic agents of the present invention comprise polyethylene glycol, which controls bleeding in tissue and does not delay or interfere with healing. The resorbable hemostatic agents of the present invention... Agent: Kalow & Springut LLP

20060286144 - Reinforced collagen scaffold: A fiber reinforced basic collagen scaffold with neutralization capacity for delivery of protein based bioactives that have higher solubilities under acidic condition than at neutral pH.... Agent: Philip S. Johnson Johnson & Johnson

20060286147 - High refractive-index, hydrophilic, arylsiloxy-containing monomers and polymers, and ophthalmic devices comprising such polymers: Hydrophilic, arylsiloxy-containing monomers and macromonomers have at least a terminal hydrophilic group attached to an arylsiloxy group. The aryl groups attached to siloxy groups can be substituted with other hydrophilic groups. Polymers comprising such hydrophilic, arylsiloxy-containing monomers and macromonomers avoid or reduce the risk of forming vacuoles of absorbed water.... Agent: Bausch & Lomb Incorporated

20060286148 - Method of forming implants: The present invention is a method for producing an implant for a corneal pocket assay by introducing a solution into a perforated plate or member, allowing the solution to form pellets, and removing the pellets from the perforations. The present invention also includes a method for performing a corneal pocket... Agent: Sheridan Ross PC

20060286149 - Low molecular weight polyglucosamines and polygalactosamines: Compositions containing enriched populations of beta linked low molecular weight polymers of galactosamine and glucosamine are provided. The compositions are useful, for example, as antibacterial additives for food and other edible applications, as precursors for synthesizing other biologically active molecules related to chitin/chitosan oligomers, and/or as pharmaceutical compounds.... Agent: E I Du Pont De Nemours And Company Legal Patent Records Center

20060286150 - Therapeutic methods and compositions involving isoflavones: Therapeutic methods of treatment, compositions and foodstuffs are described which contain isoflavone compounds described by general formula (I), in which Z is H, R1 is H, or RACO where RA is C1-10alkyl or an amino acid, R2 is H, OH, or ORB where RB is an amino acid, or CORA... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060286151 - Production of foie gras: Feed and methods for changing composition and increasing liver size of poultry are discussed.... Agent: Lahive & Cockfield

20060286154 - Absorbent articles with antimicrobial zones on coverstock: The disclosure describes compositions, such as absorbent article topsheets or undersheets, that on its bodyside surfaces comprises an anionic surfactant-bound polymeric biguanide or an anionic surface-bound polymeric biguanide that can dissociate from the article so as to attack bacteria on the wearer's skin.... Agent: Gosz And Partners, LLP

20060286153 - Anti-viral lotion tissue and methods for making and using the same: A soothing anti-viral lotion composition and a lotioned tissue product having a surface with the lotion composition applied thereto, and methods for making and using the same. The lotion composition includes an anti-viral organic acid and a topical delivery system. The topical delivery system includes one or more hydroxyl-functional polyester... Agent: Brinks Hofer Gilson & Lione

20060286152 - Fabric-supported chitosan modified temperature responsive pnipaam/pu hydrogel and the use thereof in preparation of facial mask: This invention involves fabric-supported chitosan modified temperature responsive PNIPAAm/PU hydrogel and the use thereof in preparation of facial mask. The merit of this invention is the hydrogel formed can reversibly swell and deswell near body temperature; the incorporation of PU can suppress the syneresis of PNIPAAm at an elevated temperature;... Agent: Workman Nydegger (f/k/a Workman Nydegger & Seeley)

20060286155 - Pain-sensitive therapeutic wound dressings: The invention provides a wound dressing comprising a therapeutic agent and a matrix comprising polymers joined by cross-linkages which cross-linkages comprise oligopeptidic sequences which are cleavable by a kallikrein associated with wound fluid such that the rate of release of the therapeutic agent increases in the presence of elevated kallikrein... Agent: Philip S. Johnson Johnson & Johnson

20060286157 - Protein mixtures for wound healing: A protein mixture that is useful in the treatment of wounds, where the mixture is isolated from bone or is produced from recombinant proteins and may include two or more of BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-7, TGF-β1, TGF-β2, TGF-β3, and FGF-1.... Agent: Williams, Morgan & Amerson

20060286156 - Wound-dressing material and method for manufacturing the same: A wound-dressing material being a product comprising chitosan as a base material and kumazasa extract, and a method for manufacturing the wound-dressing material by gelatinizing a mixture solution containing chitosan and kumazasa extract and drying the resulting gel. The wound-dressing material can be applied to humans and animals, and have... Agent: Birch Stewart Kolasch & Birch

20060286160 - Nicotine transdermal delivery system: The present invention provides a nicotine transdermal delivery system including an adhesive layer containing a free base nicotine and a liquid ingredient compatible with the adhesive, wherein the adhesive layer is crosslinked, and the liquid ingredient is contained in a proportion of 20-75 parts by weight, per 100 parts by... Agent: Wenderoth, Lind & Ponack, L.L.P.

20060286158 - Treatment of overuse tendinopathy using transdermal nitric oxide-generating agents: The present invention provides methods for treating tendinopathy in the absence of inflammation by the transdermal administration of nitroglycerin. Such methods include methods for relieving pain associated with such tendinopathies, and the use of a transdermal patch configured to deliver glyceryl trinitrate at a rate of 5 mcg/hr to about... Agent: Thorpe North & Western, LLP.

20060286159 - Treatment of persistent active tendinopathy using transdermal glyceryl trinitrate providing durability of effect: The present invention provides methods for treating tendinopathy providing a durability of effect by administering nitroglycerin. Such methods include methods for relieving pain associated with such tendinopathies. The use of a transdermal patch configured to deliver glyceryl trinitrate at a rate of 5 mcg/hr to about 85 mcg/hr... Agent: Thorpe North & Western, LLP.

20060286161 - Injectable liposomal depots for delivering active ingredients: The invention relates to liposomal formulations for the production of an injectable depot of peptide, protein and oligonucleotide active substances for sustained release and effect in a mammal body.... Agent: Norris, Mclaughlin & Marcus, P.A.

20060286162 - Bicalutamide-adsorbates, process for preparing same, and pharmaceutical compositions thereof: The present invention relates to an adsorbate, comprising an adsorbent and bicalutamide adsorbed on said adsorbent, a process for preparing same, and a pharmaceutical composition thereof.... Agent: Smith Patent Consulting Consulting, LLC

20060286163 - Pharmaceutical composition of topiramate: The invention is directed to a pharmaceutical composition of topiramate, an anticonvulsant which is useful for treating epilepsy. More specifically, the present invention provides a solid dosage formulation of topiramate intended primarily for use by pediatric patients, or for patients who have difficulty swallowing tablets. Processes for preparing the pharmaceutical... Agent: Philip S. Johnson Johnson & Johnson

20060286164 - Pharmaceutical composition containing a stable and clear solution of anti-inflammatory drug in soft gelatin capsule and process for producing the same: Disclosed herein is a pharmaceutical composition comprising a soft gelatin capsule containing a clear and stable solution of sodium dihydratate salt of ibuprofen by employing a system of solubilizer, co-solubilizer and antioxidants.... Agent: NeifeldIPLaw, PC

20060286167 - Compositions and methods for the treatment of neurodegenerative diseases: The invention features compositions and methods for the treatment of neurodegenerative diseases.... Agent: Clark & Elbing LLP

20060286166 - Tadalafil having a large particle size and a process for preparation thereof: The present invention provides particulate tadalafil having a particle size of about 200 to about 600 microns and a process for controlling the particle size of tadalafil.... Agent: Kenyon & Kenyon LLP

20060286165 - Taste-masked pharmaceutical particle, the preparation and use thereof: The present invention provides a taste-masked pharmaceutical particle prepared by a polymer blending process, a process for preparing the particle, and the use of the particle in preparing the orally disintegrating tablets. In this process, a micronized active drug ingredient is mixed with three kinds of pharmaceutically acceptable polymer adjuvants... Agent: Hong J. Xu

20060286168 - Process for producing coated preparation: The present invention provides a production method of a preparation coated with pioglitazone hydrochloride, which is useful as a therapeutic agent for diabetes and the like and superior in the characteristics of the preparation such as dissolution property of pioglitazone hydrochloride and the like.... Agent: Mark Chao Takeda Pharmaceuticals North America Inc

20060286171 - Bone morphogenetic protein formulations: Protein formulations that can be lyophilized and are stable in organic solvents. The formulations contain bone morphogenetic proteins, lyoprotectants, and oxidation/reduction stabilizers. Optionally, the formulations may also contain solvent environment stabilizers. The protein formulations can be incorporated into a polymeric matrix to make medical devices for delivering the protein, and... Agent: Philip S. Johnson Johnson & Johnson

20060286169 - Lipophilic compositions: There is described dry compositions comprising lipophilic compounds associated with low viscosity grades of water insoluble polymer and optionally hydrophilic agent/s associated either as monomolecular or amorphous complexes. There is also described a method of preparing said lipophilic polymer complexes from a solution or homogeneous dispersion employing either water miscible... Agent: Buchanan, Ingersoll & Rooney PC

20060286170 - Method and composition for treating cancer using cellular organelle crystallizing agents: This invention provides a method for treating cancer in mammals through cellular-organelle-crystallization-induced-death (herein defined as “Cocid”), a method for treating cancer using cellular organelle and/or cytoskeleton crystallizing agents (e.g. tetrazolium salts and their derivatives), pharmaceutical compositions containing a therapeutically effective amount of organelle and/or cytoskeleton crystallizing agents, and compositions containing... Agent: Sheridan Ross PC

20060286172 - Pharmaceutical compositions comprising prostanoid-receptor agonists and methods of making and using the same: The present invention is related to pharmaceutical compositions comprising prostanoid-receptor agonists, intravaginal dosage forms comprising the same, and methods of making and using the same. The present invention is also related to a controlled release pharmaceutical gel for vaginal administration, the pharmaceutical gel comprising: (a) misoprostol; (b) a cellulose derivative;... Agent: Sterne, Kessler, Goldstein & Fox PLLC

20060286173 - Drug delivery system for sub-tenon s capsule adminstration of fine grains: The present invention provides a drug delivery system that is a sustained drug delivery system targeting a tissue in the posterior segment of the eye accompanied by low degree of tissue invasiveness without need of frequent administration, and enables selective delivery of a drug to the posterior segment of the... Agent: Frishauf, Holtz, Goodman & Chick, PC

20060286174 - Granular sustained release preparation and production thereof: There is disclosed a novel sustained release granular resin-pharmaceutical composition comprising an ion exchange resin complexed with a pharmaceutical material wherein said complex is embedded into and on the surface of a diffusion barrier material. There is also disclosed a novel process for preparing the granulated complex wherein an aqueous... Agent: Christine M. Rebman Mallinckrodt Inc.

20060286175 - Stabilized particle dispersions containing nanoparticles: In one aspect, the invention provides a stable dispersion comprising a continuous phase comprising a continuous liquid phase and a plurality of organic nanoparticles; and a dispersed phase comprising particles dispersed in the continuous phase.... Agent: 3m Innovative Properties Company

20060286176 - Processed water and therepeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to target certain pathologies in mammals, and uses thereof are provided. The tuned water is produced by passing the water through a plurality of coil sets in fluid communication. The tuned water may be used for producing and tuning... Agent: Fleshner & Kim, LLP

20060286177 - Methods and reagents for the treatment of inflammatory disorders: The invention features a method for treating a patient diagnosed with, or at risk of developing, an immunoinflammatory disorder by administering bufexamac and a corticosteroid or other compound to the patient. The invention also features a pharmaceutical composition containing bufexamac and a corticosteroid or other compound for the treatment or... Agent: Clark & Elbing LLP

20060286178 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a negative oxidation reduction potential of at least −40, and uses thereof are provided. The composition may further included dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to... Agent: Fleshner & Kim, LLP

20060286180 - Lipolysis promoter and food and drink containing the same: [Solution] A lipolysis promoter containing one kind, or two or more kinds of plant bodies and/or extracts therefrom selected from the group consisting of Myristica fragrance, Symplocarpus foetidus, Escholzia california, Sparganium stoloniferum, Sanguinaria canadensis, Mahonia Aquifolium, Acorus gramineus, the fruit site of Musa paradiciaca, Cytisus scoparius, Hydrastis canadensis, Ficaria ranunculoides,... Agent: Young & Thompson

20060286179 - Pharmeceutical composition comprising plant material or trichilia sp. alone or in association with other plant extracts for the reversion/combat and/or prevention of ventricular fibrillation: The present invention relates to the use of a plant material of the species Trichilia sp., alone or in association with one or more of the following plants: Paullinia cupana (Sapindaceae), Croton moritibensis (Euphorbiaceae) and Zingiber officinale (Zingiberaceae) in the treatment, reversion, combat and/or prevention of ventricular fibrillation. A product... Agent: Alston & Bird LLP

20060286181 - Diet supplements for causing fast weight loss, improving daytime energy, promoting nighttime relaxation and sleep, controlling appetite and/or increasing metabolism: A diet supplement is provided in two parts. One part is provided in a daytime formulation comprising at least the Calcium and Potassium double salt of Garcinia Cambogia Extract, and Green Tea Leaf Extract. The second part is provided in a night time formulation comprising at least the Calcium and... Agent: Kenyon & Kenyon LLP

20060286182 - Synergistic cinnamon combinations and methods for enhancing insulin activity: Novel compositions and methods are provided for modifying adipocyte physiology in an animal subject such as a human. The methods include administering to the animal subject a novel pharmaceutical compositions derived from Cinnamomi cassia extracts and hypoglycemic therapeutics. Also provided are methods of increasing insulin sensitivity in an animal, which... Agent: Thorpe North & Western, LLP.

20060286183 - Diet supplement for causing rapid weight loss, controlling appetite, managing stress, supporting relaxation, combating fatigue and supporting mental well-being: Compositions and methods for administering to the diet of humans a composition for inducing rapid weight loss, controlling appetite, managing stress and supporting mental well-being, supporting relaxation, and combating fatigue. A diet supplement comprising Calcium and Potassium double salt of Garcinia Cambogia Extract supplying 60% Hydroxycitric Acid, Gymnema Sylvestre Leaf... Agent: Kenyon & Kenyon LLP

20060286184 - Composition containing as the active ingredient componantes from salvia sclarea seed: The present invention concerns a food supplement comprising Salvia sclarea seeds, or flour, oil or pulp or extracts obtained from the seeds as well as finished food products comprising the food supplement. The present invention further concerns a nutraceutical or cosmetic preparation comprising as an active ingredient Salvia sclarea seeds,... Agent: Nath & Associates

20060286186 - Method and means for improving bowel health: A method and composition for improving one or more indicators of bowel health or metabolic health in a mammalian animal. This comprises the delivering to the gastrointestinal tract of the animal an effective amount of an altered wheat starch in the form of or derived from the grain of a... Agent: Cooper & Dunham, LLP

20060286185 - Veterinary composition and method of using same: This invention relates to a topical veterinary composition and method of using for the treatment of minor flesh wounds or lacerations in animal and to promote the healing thereof The composition comprises of the active ingredients of tall oil, wheat germ oil and myristic acid either per se or as... Agent: Walter G. Prokosch

20060286188 - Compositions and methods using morinda citrifolia: Dietary supplements include a complementary blend of fruits including at least noni and Luo Han Guo. Other fruits having a high ORAC value, such as blueberries and raspberries, are also preferably incorporated. The combination of the Luo Han Guo and noni masks the noni's flavors and odors while sweetening the... Agent: Workman Nydegger (f/k/a Workman Nydegger & Seeley)

20060286187 - Natural lycopene concentrate and method for production thereof: Natural lycopene concentrate obtained from a plant structure after alkalinization, solid-liquid separation, acidification and a second solid-liquid separation. The concentrate obtained is highly bioavailable and water-soluble at room temperature.... Agent: Bell, Boyd & Lloyd LLC

20060280680 - Hybrid nanocrystals for treatment and bioimaging of disease: Hybrid nanocrystals able to reach specific targets in the body for treatment and biological imaging are provided, as well as methods of making and administering same for treatment of disease conditions and for bioimaging and radiotherapy. The hybrid nanocrystals and methods can be used alone or in combination with other... Agent: Buchanan, Ingersoll & Rooney PC

20060280679 - Method of treating autoimmune disease by inducing antigen presentation by tolerance inducing antigen presenting cells: Antibodies to antigen presenting cells may be utilized to interfere with the interaction of the antigen presenting cell and immune cells, including T cells. Peptides may be linked to said antibodies thereby generating an immune response to such peptides. Preferably peptides linked to the antibodies are associated with autoimmunity.... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20060280681 - Food for testing life style-related diseases: It is intended to provide a food for testing life style-related diseases which is in the form of a food easy to ingest, differing from the existing medicines such as Trelan G, and makes it possible to simultaneously and easily perform a glucose tolerance test and examine oral glucose tolerance,... Agent: Rabin & Berdo, PC

20060280683 - Method of identifying inhibitors of gadd45 polypeptide activity, and inhibitors of such activity: The present invention is directed to novel methods for assaying for modulators of GADD45 polypeptide activity. The invention also provides means to sensitize a proliferating cell to a DNA base-damaging agent by administration of novel inhibitors of GADD45 polypeptide activity. The invention further provides polypeptides which interfere with the ability... Agent: Townsend And Townsend And Crew, LLP

20060280682 - Monitoring two dimensions of diabetes pathogenesis seperately or concurrently (insulin sensitivity and beta-cell sufficiency): uses in diagnosis, prognosis, assessment of disease risk, and drug development: Provided are methods for determining concurrently with a simple, minimally invasive test, the adequacy of pancreatic beta-cell compensation and/or the presence of tissue insulin resistance in a subject human or an experimental animal. The methods allow for the determination of a subject's or experimental animal's susceptibility to developing type 2... Agent: Morrison & Foerster LLP

20060280685 - Cell-based screen for agents useful for reducing neuronal demyelination or promoting neuronal remyelination: This invention is in the field of neurology. Specifically, the invention relates to the discovery and characterization of molecular components that play a role in neuronal demyelination or remyelination. In addition, the invention relates to the generation of an animal model that exhibits hypomyelination. The compositions and methods embodied in... Agent: Wilson Sonsini Goodrich & Rosati

20060280686 - Method of measuring the biological activity of an urotensin ii receptor: Administration of U-II to rats caused an increase in the redness or the skin temperature of the ear of the rats. The increase was inhibited by compounds that decease the biological activity of the U-II/UT receptor. Thus, the present invention provides methods of measuring the biological activity of an U-II... Agent: Philip S. Johnson Johnson & Johnson

20060280684 - Methods utilizing novel target genes related to immune-mediated diseases: The present invention provides methods utilizing novel target genes related to immune-mediated diseases, such as asthma, allergy and autoimmune diseases. The invention is based on a molecular level description of the polarization of CD4+ precursor cells (Thp) from which T helper cells are known to originate. Particularly, the present invention... Agent: Birch Stewart Kolasch & Birch

20060280689 - New mri technique based on electron spin resonance and nitrogen endohedral c60 contrast agent: Methods and systems for electron spin MRI (eMRI) and novel methods for fabricating N@C60 fullerenes using the discovery that certain endohedral fullerenes can be used as functional paramagnetic materials exhibiting increased relaxation times. These endohedral fullerenes provide improved labels for use in electron spin resonance (ESR) detection systems.... Agent: Quine Intellectual Property Law Group, P.C.

20060280687 - Compounds for tissue imaging and methods of use thereof: Briefly described, embodiments of this disclosure include cyanine/glucose compounds, methods of use, methods of imaging tissue, methods of imaging precancerous tissue, cancer, and tumors, methods of treating precancerous tissue, cancer, and tumors, methods of diagnosing precancerous tissue, cancer and tumors, methods of monitoring the progress of precancerous tissue, cancer and... Agent: Thomas, Kayden, Horstemeyer & Risley, LLP

20060280688 - Optical fluorescent imaging: Compounds and methods are disclosed that are useful for noninvasive imaging in the near-infrared (NIR) spectral range. The NIR is highly sensitive for tumor detection and tracking. The application discloses targeting a tumor-enriched cell surface receptor with a ligand-conjugated fluorescent probe, which specifically allows detection of the tumor relative to... Agent: Townsend And Townsend And Crew, LLP

20060280690 - Methods of preparing a foam comprising a sclerosing agent: Present application discloses a device for generating and dispensing a foam for therapeutic use comprising a) a housing, b) a first chamber with gas at a substantially atmospheric pressure, a second chamber with at least one sclerosant agent c) an outlet for dispensing gas and the solution in the form... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060280692 - Delivery of antipsychotics through an inhalation route: The present invention relates to the delivery of antipsychotics through an inhalation route. Specifically, it relates to aerosols containing antipsychotics that are used in inhalation therapy. In a method aspect of the present invention, an antipsychotic is delivered to a patient through an inhalation route. The method comprises: a) heating... Agent: Swanson & Bratschun, L.l.c

20060280691 - Spray freeze dried liposomal ciprofloxacin powder aerosol drug delivery: A powder for inhalatory aerosol delivery, the powder having: spray freeze dried liposome particles with a biologically active agent, such as an antibiotic, encapsulated within a phospholipid, and a method of producing a powder for inhalatory aerosol delivery, the method including the steps of: mixing a biologically active agent with... Agent: Ogilvy Renault LLP

20060280693 - Hair treatment compositions: A hair treatment composition comprising a silicone pressure sensitive adhesive emulsion in which the emulsion comprises a disperse organic solvent phase in a continuous water phase.... Agent: Unilever Intellectual Property Group

20060280697 - Composition: or a salt thereof to produce a cooling sensation, wherein R1 and R2 are independently selected from hydrogen or halogen atoms; hydroxy, cyano, nitro, mercapto, carbonyl, sulfone and carboxy groups; or optionally substituted alkyl, alkenyl, alkoxy, alkylthio, aryl, aryloxy, arylthio, amino, siloxy, ester and heterocyclic groups, characterised by an oil... Agent: Unilever Intellectual Property Group

20060280694 - Composition for the mineralization of dental hard tissues and the reduction of caries-inducive microflora: The present invention relates to a composition having increased levels of minerals for mineralizing hard tissues within the oral cavity and an ability to reduce caries-inducive microflora. The composition also has, among other things, an anti-dental caries function that promotes beneficial oral health.... Agent: Hillary J. Morgan Attorney At Law

20060280696 - Method for treating periodontal disease: Present invention provides a method for treating periodontal disease. Periodontal disease is a pathogenic infection of the gums. The method comprises the use of a laser or radiant energy source that is capable of being absorbed by pathogens. Said Radiant energy is applied to infected periodontal pockets with the intention... Agent: Geoffrey E. Dobbin, Patent Attorney

20060280695 - Methods and compositions for the prevention, suppression and elimination of oral pain: The present invention relates to methods and compositions for the prevention, suppression and elimination of oral pain. Specifically, it relates to methods and compositions including cesium and/or rubidium that are used to treat or prevent oral pain. In a method aspect of the present invention, a method of treating oral... Agent: Sheppard, Mullin, Richter & Hampton LLP

20060280699 - Effect of porcine sheath proteins on the regeneration activity of periodontal ligament: The purpose of this study was to identify the periodontal regeneration factors in enamel protein shown to induce cementum- and osteo-promotive activities in vivo. The cementum regeneration (CR), a part of periodontal regeneration, was examined by using experimental cavities prepared in a buccal dehiscence dog model. The CR activity was... Agent: Kirk Hahn

20060280698 - System for treating conditions of the periodontium: A system for treating conditions of the periodontium, such as gingivitis and periodontitis, includes an Ayurvedic medicinal solution and an applicator for delivering the solution to the periodontium. The Ayurvedic medicinal solution utilizes herbal extracts to break-down bacteria which can inflame gum tissue. In one embodiment, the solution comprises approximately... Agent: Kriegsman & Kriegsman

20060280700 - Oral hygiene system to fight the effects of aging on the mouth, gums, and teeth: A comprehensive system prevents age related damage to oral tissue and teeth. The system comprises a Daytime composition, a Nighttime composition and an Overnight gel, each applied to mouth, gums and teeth on a daily basis. The Daytime and Nighttime compositions are applied by a special applicator with a brush... Agent: Ernest D. Buff Ernest D. Buff And Associates, LLC.

20060280701 - Method for dispersing metal oxides: The present invention relates to a method for preparing a stable dispersion of a metal oxide in water comprising dispersing colloidal microcrystalline cellulose in water either prior to or concurrently with adding the metal oxide and recovering the stable metal oxide dispersion, wherein: (i) the metal oxide has an average... Agent: Paul A Fair Fmc Corporation

20060280702 - Stable sunscreen compositions containing zinc oxide: A stable, oil-in-water (O-W) emulsion-based sunscreen composition having at least one water-insoluble, organic UV-absorber having a water-solubility of much less than 0.1% by weight, contained in the oil phase of the sunscreen emulsion, comprising i) zinc oxide (ZnO) particles having a surface free of any prior coating of any inorganic... Agent: Marshall, Gerstein & Borun LLP

20060280703 - Antimycotic nail varnish: Antimycotic nail varnish containing 2 to 80 wt. %, in relation to the amount of volatile compounds, of at least one 1-hydroxy-2-pyridone of general formula (I) as an antimycosic active substance and 0.1 to 20 wt %, in relation to the amount of volatile compounds, of an absorption promoter.... Agent: Birch Stewart Kolasch & Birch

20060280704 - Topical depigmenting formulations comprising an extract of bellis perennis: The present invention pertains to topical formulations having a depigmenting effect on human skin for cosmetic and pharmaceutical use. Moreover the present invention also provides a new process for producing an extract of Bellis perennis L. by aqueous extraction comprising fractionation and electrolyte exchange and an extract produced by the... Agent: Kagan Binder, PLLC

20060280705 - Cosmetic preparation: A cosmetic preparation which comprises microparticles distributed in an adhesive solution wherein the microparticles contain a substance affording an esthetic effect.... Agent: Bachman & Lapointe, P.C.

20060280706 - Rinse-off cosmetic composition containing interference particles: A rinse-off cosmetic composition in the form of an emulsion containing an oily phase and an aqueous phase, and containing hydrophilic interference particles chosen from uncolored nacres coated with one or more coats of one or more metal oxides. The composition according to the invention changes color during application to... Agent: C. Irvin Mcclelland Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20060280709 - Emollient mixture and use thereof as a mineral oil substitute: The invention relates to an emollient mixture which is particularly suitable as a mineral oil substitute in cosmetic compositions. The emollient mixture comprises at least one ester selected from the esters of a C8-18 fatty acid with a C3-12 alcohol and the esters of adipic acid with a C3-12 alcohol... Agent: Cognis Corporation Patent Department

20060280710 - Volumizing hair compositions: The present invention relates to hair compositions comprising at least one lecithin, at least one amphoteric surfactant, at least one nonionic surfactant, at least one film forming polymer, and at least one cationic polymer. The compositions are preferably used to add volume to hair while maintaining the hair's natural shape... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20060280712 - Cosmetic: e

20060280711 - Process for treating marionette lines: A process for treating marionette lines damaged by age, sun exposure and pollution involving contacting the marionette lines with a composition containing: (a) from about 1 to about 20% by weight of ascorbic acid; (b) from about 30 to about 80% by weight of a nonaqueous polar organic solvent; and... Agent: Lerner, David, Littenberg, Krumholz & Mentlik

20060280716 - Cationic aminosilicone emulsions: The present invention discloses a method for making cationic, aminofunctional silicone emulsions particularly cationic emulsions having a low volatile cyclic siloxane content. The method of the present invention comprises an acid catalyzed emulsion condensation reaction of a mixture comprising hydroxy terminated polydimethylsiloxane and an aminosilane under conditions that do not... Agent: Geam - Silicones - 60siIPLegal

20060280714 - Aluminum starch octenylsuccinate derivative of small-granule wheat starch and cosmetic formulations made therefrom: A small-granule aluminum starch octenylsuccinate (ASO) derivative having a distribution of starch granules with a mean diameter of between 4.5 μm and 8.9 μm is disclosed herein. The small-granule ASO may be used in a wide variety of personal care formulations.... Agent: Lathrop & Gage Lc

20060280713 - Method for producing porous moulded bodies containing alginate: The invention concerns processes for the production of alginate-containing porous or sponge-like shaped articles, as well as the shaped articles obtained thereafter and their use.... Agent: Rankin, Hill, Porter & Clark, LLP

20060280715 - Retinoid solutions and formulations made therefrom: Compositions for topical application for treating a skin disorder (e.g., acne) include a retinoid, which is solubilized completely in alcohol only with the aid of cosolvents such as esters (e.g., alkyl benzoate, isopropyl palmitate, isopropyl myristate, diisopropyl adipate and their derivatives). This completely solubilized retinoid can be used to formulate... Agent: Carter, Deluca, Farrell & Schmidt, LLP

20060280707 - Composition and manufacturing method of self-diagnosis and reduction catalyst processing for permanent & straighter: The present invention relates to compositions of first agents of a permanent hair waving agent and a hair straightener for self-diagnosis with a reducing catalyst, respectively, and their manufacturing methods thereof. More specifically, the present invention relates to compositions of first agents a permanent hair waving agent and a hair... Agent: Ronald R Santucci Frommer Lawrence & Haug

20060280708 - Cosmetic composition: Present invention is on styling composition comprising at least one film forming polymer, at least one polyol at a concentration of 5% by weight or higher and polyacryloldimethyltaurate and/or its salts. The composition of the present invention improves curl retention, curl separation, shine and manageability of hair.... Agent: Norris, Mclaughlin & Marcus, P.A.

20060280717 - Body weight reduction method by ingestion of glucomannan: The present invention relates to a body weight reduction method by ingestion of glucomannan, in which a diet effect is realized with safety without being affected in one's body or health. The method of the present invention permits a reduction in body weight of one whose Body Mass Index (BMI)... Agent: Rader Fishman & Grauer PLLC

20060280719 - Phosphate transport inhibitors: e

20060280720 - Diisocyanate terminated macromer and formulation thereof for use as an internal adhesive or sealant: A novel macromer or mixture thereof is described herein, comprising benzoyl isocyanate terminal moieties and at least two residues of a water-soluble polymer having a molecular weight ranging from 80 to 10,000 adjacent to the carbonyl group of the benzoyl isocyanate moieties, thereby forming at least two ester linkages in... Agent: Philip S. Johnson Johnson & Johnson

20060280718 - Compositions and methods for treating pain: In the present invention, Applicants demonstrate the effect of a biomembrane sealing agent on the development of chronic pain following tissue injury as well as acute pain in a model of acute inflammation. Applicants demonstrate the ability of this class of agents referred to as “biomembrane sealing agents” to reduce... Agent: Fox Rothschild LLP Princeton Pike Corporate Center

20060280721 - Nutritional supplements and therapeutic compositions comprising (r)-3- hydroxybutyrate derivatives: Novel compounds and compositions containing (R)-3-hydroxybutyrate derivatives are disclosed. The compounds and compositions can be used as nutritional supplements to increase physical performance and as therapeutics to ameliorate symptoms of medical conditions, particularly neurological conditions, such as Alzheimer's and similar conditions. Novel methods for making R-3-hydroxybutyrate derivatives also are disclosed.... Agent: Klarquist Sparkman, LLP

20060280722 - Treatment of follicular lymphomas using inhibitors of the lt pathway: Therapeutic uses of inhibitors of the Lymphotoxin Pathway to treat tumors, specifically to treat follicular lymphomas.... Agent: Lahive & Cockfield

20060280723 - Interferon for treating or preventing a coronaviral infection: The present invention provides a composition and method for use in the prevention or treatment of a coronaviral infection and in particular, the human coronavirus infection termed severe acute respiratory syndrome (SARS) coronavirus (SARS-HCoV). A method of treating a coronaviral infection is provided through the administration of interferon, further the... Agent: Drinker Biddle & Reath Attn: Intellectual Property Group

20060280725 - Compositions and methods of treating and diagnosing hepatoma: Disclosed are pharmaceutical compositions and methods of treating hepatoma by administering to patients or other populations of cells agents that selectively inhibit the uptake of glutamine by hepatocarcinoma cells, causing the concomitant apoptosis of hepatocarcinoma cells. Preferred agents target the amino acid transporter B0 (ATB0) protein for inhibition. Disclosed are... Agent: Joseph E Zahner

20060280724 - Identification of ligands that enable endocytosis, using in vivo manipulation of neuronal fibers: In vivo screening is used to identify and isolate ligands that drive endocytosis (internalisation) of molecules into animal cells. These ligands can transport passenger molecules (drug or diagnostic compounds, genetic vectors, etc.) into targeted classes of cells. A population of candidate ligands, such as a phage display or combinatorial library,... Agent: Patrick D. Kelly

20060280729 - Cellular therapy for ocular degeneration: Compositions and methods applicable to cell-based or regenerative therapy for ophthalmic diseases and disorders comprising mesenchymal stem cells, particularly those characterized by the expression of at least one of the following surface markers: CD29, CD44, CD105 or CD166, and the lack of expression of at least one of CD14, CD34... Agent: Philip S. Johnson Johnson & Johnson

20060280728 - Trimeric ox40-immunoglobulin fusion protein and methods of use: Compositions including a trimeric OX-40 fusion protein are disclosed. Also disclosed are methods for enhancing the immune response of a mammal to an antigen by engaging the OX-40 receptor on the surface of T-cells involving administering to the mammal a composition comprising a trimeric OX-40 fusion protein and a pharmaceutically... Agent: Klarquist Sparkman, LLP

20060280727 - Dendritic cell isolation methods: Disclosed are methods for isolating dendritic cells and/or dendritic progenitor cells. The methods include contacting a population of cells with a plurality of FRIL family member molecules, and removing the unbound cells, wherein the cells bound to the FRIL family member molecules are an isolated population of dendritic cells and/or... Agent: Wilmer Cutler Pickering Hale And Dorr LLP

20060280726 - Soft tissue and bone augmentation and bulking utilizing muscle-derived progenitor cells, compositions and treatments thereof: The present invention provides muscle-derived progenitor cells that show long-term survival following transplantation into body tissues and which can augment soft tissue following introduction (e.g. via injection, transplantation, or implantation) into a site of soft tissue. Also provided are methods of isolating muscle-derived progenitor cells, and methods of genetically modifying... Agent: Mintz Levin Cohn Ferris Glovsky & Popeo

20060280730 - Induction of apoptosis of malignant cells by activation of calcium-activated potassium channels: Disclosed are a method of inducing apoptosis of a malignant cell, which employs a calcium-activated potassium channel (KCa) activator and is useful for treating a malignant tumor in a human subject. Also disclosed are methods of selectively inhibiting the proliferation of malignant cells compared to non-malignant cells in a mixed... Agent: Davis Wright Tremaine LLP

20060280731 - Novel substrate for rpn11 enzymatic activity: The present application provides peptides that serve as substrates for proteasome enzymatic activity, e.g., the enzymatic activity of Rpn11, a metalloprotease of the 19S regulatory particle. The present application also provides methods and compositions employing the peptide substrates.... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20060280732 - Peptides modulating caspase activation: The present invention provides structures of small molecules capable of modulating apoptotic cell death. More specifically, the structures relate to the structures of apoptotic active sites of mammalian alpha-fetoprotein (AFP) and albumin. Peptides mimicking the active site contain two sequences, Arg-Gly-Asp and Asp-X-X-Asp, wherein X means any amino acid. These... Agent: Dodds & Associates

20060280735 - Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same: Hapten-carrier conjugates capable of eliciting anti-hapten antibodies in vivo by administering, in a therapeutic composition, are disclosed. Methods of preparing said conjugates and therapeutic compositions are also disclosed. Where the hapten is a drug of abuse, a therapeutic composition containing the hapten-carrier conjugate is particularly useful in the treatment of... Agent: Jones Day

20060280736 - Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same: Hapten-carrier conjugates capable of eliciting anti-hapten antibodies in vivo by administering, in a therapeutic composition, are disclosed. Methods of preparing said conjugates and therapeutic compositions are also disclosed. Where the hapten is a drug of abuse, a therapeutic composition containing the hapten-carrier conjugate is particularly useful in the treatment of... Agent: Jones Day

20060280733 - Immunogens and corresponding antibodies specific for high molecular weight aggregation intermediates common to amyloids formed from proteins of differing sequence: Compositions of matter that comprise one or more conformational epitopes found on amyloid peptide aggregates, antibodies to such epitopes and methods for making and using the compositions, eptitopes and/or antibodies. The invention includes synthetic or isolated compositions that contain or consist of certain conformational epitopes that are found on peptide... Agent: Robert D. Buyan Stout, Uxa, Buyan & Mullins

20060280734 - Retargeting: The present invention relates to a method for the generation of immunoglobulin molecules of predetermined specificity. In particular, the invention relates to a method for the retargeting of the epitope binding specificity of one or more antibodies using single variable domains which exhibit a dominant epitope binding specificity.... Agent: Palmer & Dodge, LLP Kathleen M. Williams

20060280738 - Anti-cd19 antibody therapy for transplantation: The invention relates to immunotherapeutic compositions and methods for the treatment and prevention of GVHD, humoral rejection, and post-transplantation lymphoproliferative disorder in human subjects using therapeutic antibodies that bind to the human CD19 antigen and that preferably mediate human ADCC. The present invention relates to pharmaceutical compositions comprising human or... Agent: Jones Day

20060280737 - Wsx receptor agonist antibodies: Methods for identifying antibodies that decrease body weight, fat depot weight or food intake in an obese animal are provided, as well as antibodies. Preferred antibodies bind to a reactor having a WSX motif and the extracellular domain sequence within SEQ ID NO:2.... Agent: Knobbe Martens Olson & Bear LLP

20060280739 - Novel human beta-2 integrin alpha subunit: Methods to inhibit inflammation and macrophage infiltration following spinal cord injury are disclosed along with methods to modulate TNFα release from cells expressing αd are disclosed.... Agent: Marshall, Gerstein & Borun LLP

20060280740 - Compositions and methods for regulating nk cell activity: The present invention relates to novel compositions and methods for regulating an immune response in a subject. More particularly, the invention relates to specific antibodies that regulate the activity of NK cells and allow a potentiation of NK cell cytotoxicity in mammalian subjects. The invention also relates to fragments and... Agent: Novo Nordisk, Inc. Patent Department

20060280741 - Methods for treating autoimmune and chronic inflammatory conditions using antagonists of cd30 or cd30l: The invention provides methods of treating autoimmune and chronic inflammatory conditions by administering agents that hinder the CD30/CD30L interaction, combination treatments, and methods of treating conditions resistant to treatment with TNFα inhibitors by administering agents that inhibit signal transduction by CD30 or IL-1. Included also are treatments involving concurrently administering... Agent: Immunex Corporation Law Department

20060280743 - Humanized antibodies that recognize beta amyloid peptide: The invention provides improved agents and methods for treatment of diseases associated with amyloid deposits of Aβ in the brain of a patient. Preferred agents include humanized antibodies.... Agent: Lahive & Cockfield

20060280744 - Methods for treating demyelination disorders: This invention is in the field of neurology. Specifically, the invention relates to the discovery and characterization of molecular components that play a role in neuronal demyelination or remyelination. In addition, the invention relates to the generation of an animal model that exhibits hypomyelination. The compositions and methods embodied in... Agent: Wilson Sonsini Goodrich & Rosati

20060280742 - Methods of inhibiting tnf-alpha in patients with crohn's disease: Anti-TNF antibodies, fragments and regions thereof which are specific for human tumor necrosis factor-α (TNFα) and are useful in vivo diagnosis and therapy of a number of TNFα-mediated pathologies and conditions, as well as polynucleotides coding for murine and chimeric antibodies, methods of producing the antibody, methods of use of... Agent: Hamilton, Brook, Smith & Reynolds, P.C.

20060280745 - Prion inhibition: The invention relates to the use of an agent such as an antibody capable of reacting with PrP in the prevention of prion replication in a subject, in the treatment or prevention of prion infection, in the treatment or prevention of neuropathology associated with prion infection or in the preparation... Agent: Marshall, Gerstein & Borun LLP

20060280746 - Alpha, beta-unsaturated sulfoxides for treating proliferative disorders: e

20060280747 - Anti-vegf antibodies: Anti-VEGF antibodies and variants thereof, including those having high affinity for binding to VEGF, are disclosed. Also provided are methods of using phage display technology with naïve libraries to generate and select the anti-VEGF antibodies with desired binding and other biological activities. Further contemplated are uses of the antibodies in... Agent: Merchant & Gould PC

20060280748 - Plasma or serum fraction for treatment or prevention of abnormal cell proliferation: The present invention relates to a plasma or serum fraction derived from a mammal exposed to an inoculant, which fraction has been depleted of one or more high molecular weight proteins present in the unprocessed plasma or serum, as well as to a method to treat and/or prevent abnormal cell... Agent: King & Spalding LLP

20060280749 - Therapeutic agents comprising pro-apoptotic proteins: The present invention relates to targeted killing of a cell utilizing a chimeric polypeptide comprising a cell-specific targeting moiety and a signal transduction pathway factor. In a preferred embodiment, the signal transduction pathway factor is an apoptosis-inducing factor, such as granzyme B, granzyme A, or Bax.... Agent: Fulbright & Jaworski L.L.P.

20060280750 - Toxin-related antibodies with antimicrobial and antiviral activity: Anti-idiotypic antibodies which recognise the idiotope of an antibody specific for a yeast killer toxin possess microbicidal activity. Fragments (e.g. decapeptides) of these anti-idiotypic antibodies, particularly those comprising CDR residues, also show microbicidal activity, as do peptides having 5 the same sequence but composed of D-amino acids, or including amino... Agent: Albert Wai-kit Chan Law Offices Of Albert Wai-kit Chan

20060280751 - Method for enhancing efficacy of preparation of monoclonal antibody: A method for enhancing efficacy of a monoclonal antibody preparation is provided wherein antigens from patients are tested for their reactivity with said antibody. In accordance with the method of the invention, an amino acid sequence of an expressed protein is deduced from a nucleotide sequence determined by isolation and... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20060280752 - Peptide epitope-based vaccine for treating herpes simplex virus infections and related diseases: Described herein are peptide epitopes effective in the treatment of herpes simplex virus (HSV), as well as vaccines and other therapeutic compositions including the same. In various embodiments, the compositions of the present invention may include a pharmaceutically acceptable adjuvant to enhance the delivery and/or pharmacological efficacy of the epitope.... Agent: Robert D. Buyan Stout, Uxa, Buyan & Mullins, LLP

20060280753 - Composition and method for obtaining a nutritional food product using solid substrate fermentation: An improved food product has an enhanced nutritional profile by utilizing solid substrate fermentation and ultraviolet irradiation. A solid substrate is mixed with water and other nutrients. The mixture is then sterilized and cooled before aseptically adding UV irradiated mushroom mycelium and maintaining the temperature so as to encourage the... Agent: William J. Sapone Coleman Sudol Sapone P.C.

20060280754 - Method of preventing virus: cell fusion by inhibiting the function of the fusion initiation region in rna viruses having class i membrane fusogenic envelope proteins: The present invention relates to a method of preventing or inhibiting viral infection of a cell and/or fusion between the envelope of a virus and the membranes of a cell targeted by the virus (thereby preventing delivery of the viral genome into the cell cytoplasm, a step required for. viral... Agent: Howrey LLP

20060280755 - Modulation of nkg2d: The present invention relates to methods and compositions for treating and/or preventing autoimmune and/or inflammatory disease. In particular, the present invention provides therapeutics for impairing the expansion and function of autoreactive T cells, NK cells and/or NKT cells, by modulating NKG2D.... Agent: Medlen & Carroll, LLP Suite 350

20060280756 - Novel composition: Novel combined vaccine compositions are provided, comprising a herpes simplex virus (HSV) antigen and a HPV antigen and optionally in addition one or more of the following: an EBV antigen, a hepatitis A antigen or inactivated attenuated virus, a hepatitis B viral antigen, a VZV antigen, a HCMV antigen, Toxoplasma... Agent: Glaxosmithkline Corporate Intellectual Property - Uw2220

20060280757 - Flavivirus vaccine delivery system: A tetracycline regulatable flaviviral packaging system is provided that facilitates expression of flaviviral structural proteins necessary for flaviviral RNA replicon packaging and virus like particle production in animal cells. This regulatable packaging system is compatible with Kunjin, Dengue and West Nile virus and other flaviviral replicon-based expression systems and produces... Agent: Intellectual Property Group Fredrikson & Byron, P.A.

20060280758 - Modified vaccinia ankara virus variant: The present invention provides an attenuated virus, which is derived from Modified Vaccinia Ankara virus and characterized by the loss of its capability to reproductively replicate in human cell lines. It further describes recombinant viruses derived from this virus and the use of the virus, or its recombinants, as a... Agent: The Firm Of Hueschen And Sage

20060280759 - Live and subunit vaccines: Immunogenic compositions containing Francisella components or modified live strains of the Francisella species and their use in preventing or treating disease such as tularemia.... Agent: John S. Pratt, Esq Kilpatrick Stockton, LLP

20060280760 - Assortment of personal care products having synergistic identifiers communicating products to be purchased together: A line of personal care products comprising a first product comprising a first identifier and a second product comprising a second identifier wherein said first identifier and said second identifier are synergistic wherein said first identifier and said second identifier together communicate that said first product and said second product... Agent: The Procter & Gamble Company Intellectual Property Division

20060280761 - Nanofluidized b-12 composition and process for treating pernicious anemia: A method of manufacturing a stable nanosuspension for delivery of a biologically active agent, particularly vitamin B-12, into the bloodstream of a subject is disclosed. A nanofluidizable mixture containing vitamin B-12 is initially formed and processed via a nanofluidization process to form the stable nanosuspension, which may be administered via... Agent: Mchale & Slavin, P.A.

20060280762 - Color cosmetics - coloring/staining the skin from fruit and plant color pigments: The use of color pigment from fruits and vegetables for cosmetic purposes of coloring the skin such as staining lips, flushing cheeks and enhancing the eyes. These pigments can be used in lip sticks, lip stains, cheek stains, blush, eye liner, eye shadow, mascara, eyebrow powder/pencil, sheer to full coverage... Agent: Richard Hughes Kostick

20060280763 - Transparent solid oil cosmetics: A solid cosmetic comprising components (A), (B), (C), and (D) below: (A) a polyamide resin; (B) diisostearyl malate; (C) a polyglyceryl isostearate; and (D) a liquid oil; and not containing a wax when the component (A) comprises only an ester-terminated polyamide resin.... Agent: Wolf Greenfield & Sacks, PC

20060280764 - Vegetable sterol ester-containing composition and additive that increases the feeling effects from a hair cosmetic: A safe additive that increases the feeling effects from a hair cosmetic is provided at low costs. The additive that increases the feeling effects has less stickiness, can be easily and uniformly mixed with hair cosmetics, and can provide feelings, effects and advantages that are similar to those of sterol... Agent: Flynn Thiel Boutell & Tanis, P.C.

20060280766 - Active aromatic sulfonamide organic compounds and biocidal uses thereof: A biocidal solution comprising aromatic N-halosulfonamide organic compounds and methods of using the biocidal solution are disclosed. The solution may further comprise a wetting agent, a low molecular weight alcohol, and buffering agents. The biocidal solution is used to arrest or kill unwanted organisms.... Agent: Fay, Sharpe, Fagan, Minnich & Mckee, LLP

20060280765 - Navel orangeworm pheromone composition: The present invention provides compounds useful for preparing synthetic pheromone compositions that can be used as attractants or inhibitors of insect species. The compositions are useful in the control of navel orangeworm or meal moth insect pests.... Agent: Townsend And Townsend And Crew, LLP

20060280770 - Coating for implantable devices and a method of forming the same: Coatings for implantable devices or endoluminal prosthesis, such as stents, are provided, including a method of forming the coatings. The coatings can be used for the delivery of an active ingredient or a combination of active ingredients.... Agent: Squire, Sanders & Dempsey LLP

20060280767 - In vivo grafting material: An intracorporeally implanting material comprising a composite body of a formed finely-porous or non-porous resin article, which is finely-porous, the pore diameter of which is smaller than 0.45 μm, or is non-porous and has vital tissue-blocking ability and a formed porous resin article, which is porous, the pore diameter of... Agent: Mcdermott Will & Emery LLP

20060280768 - Meniscal repair device and method: Methods and apparatus for treating meniscal tissue damage are disclosed, including a biocompatible meniscal repair device comprising a stent. The tissue repair device is adapted to be placed in contact with a defect in the meniscus and can preferably provide a structure for supporting meniscal tissue and/or encouraging tissue growth... Agent: Philip S. Johnson Johnson & Johnson

20060280769 - Terminal sterilization of injectable collagen products: Methods of sterilizing dermal fillers and injectable collagen material have been developed which reduce the level of active biological contaminants or pathogens without adversely affecting the material, i.e., wherein the dermal fillers and injectable collagen material retain their same properties before and after its terminal sterilization. In one embodiment the... Agent: Patrea L. Pabst Pabst Patent Group LLP

20060280775 - Biabsorbable implant having a varying characteristic: A bioabsorbable implant or its part consists of a structure having a varying characteristic in at least in one direction defining a gradient corresponding this characteristic. The structure comprises bioabsorbable polymer and another substance within or next to said bioabsorbable polymer. The structure is constituted of a wound or folded... Agent: Kenyon & Kenyon LLP

20060280774 - Compositions and methods for treating glaucoma: Implants and methods are provided for modulating wound healing and controlling infection to improve the success of glaucoma filtration surgery. Formulations of one or more therapeutically active agents and a biodegradable polymer provide a substantially constant rate of release for an extended period of time.... Agent: Stout, Uxa, Buyan & Mullins LLP

20060280771 - Drug delivery system: The subject invention provides a drug delivery system comprising at least one compartment consisting of (i) a drug-loaded thermoplastic polymer core, (ii) a drug-loaded thermoplastic polymer intermediate layer and (iii) a non-medicated thermoplastic polymer skin covering the intermediate layer, wherein said intermediate layer is loaded with (a) crystals of a... Agent: Akzo Nobel Inc. Intellectual Property Department

20060280773 - Methods and devices for maintaining patency of surgically created channels in a body organ: This is directed to methods and devices suited for maintaining an opening in a wall of a body organ for an extended period. More particularly devices and methods are directed maintaining patency of channels that alter gaseous flow within a lung to improve the expiration cycle of, for instance, an... Agent: Levine Bagade Han LLP

20060280772 - Methods and devices for maintaining surgically created channels in a body organ: This is directed to methods and devices suited for maintaining an opening in a wall of a body organ for an extended period. More particularly devices and methods are directed maintaining patency of channels that alter gaseous flow within a lung to improve the expiration cycle of, for instance, an... Agent: Levine Bagade Han LLP

20060280776 - Diet food: The diet food of this invention having effects to reduce body weight and prevent/improve obesity and atherosclerotic or metabolic disorders includes an ω-3 PUFA or an ω-6 PUFA, and at least one of L-arginine, L-ornithine, an L-arginine precursor and an L-ornithine precursor, and further includes diacylglycerol, a middle or short... Agent: Young & Thompson

20060280777 - Encapsulated energy gel compositions: Encapsulated energy gel compositions are provided. The compositions include an energy gel center contained within an edible coating.... Agent: Fish & Richardson P.C.

20060280778 - Homeopathic teething pain relief composition and method: A composition for the relief of symptoms of teething in human children, and a method of its use, is disclosed. The composition includes effective amounts of the homeopathic ingredients Belladonna 3C, Chamomilla 3C and Coffea Cruda 3C, preferably combined with distilled water to form a solution. The solution is introduced... Agent: Quickpatents, Inc.

20060280779 - Phosphatidylserine enriched milk fractions for the formulation of functional foods: Disclosed is a bovine milk derived phosphatidylserine source of natural composition having excellent dispersibility and organoleptic as well as physical stability. The source is usefull in neutraceutical in powder, liquid or dispersion form. The source can be prepared from serum from butter oil production or from the retentate from microfiltration... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060280780 - Antimicrobial polypeptides: The present invention relates to polypeptides having antimicrobial activity and polynucleotides having a nucleotide sequence which encodes for the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the nucleic acid constructs as well as methods for producing and using the polypeptides.... Agent: Novozymes North America, Inc.

20060280781 - Sequestered reactive materials: A fibrous assembly is provided for performing site-specific chemistry. In general the present invention provides a fibrous assembly comprising a first fiber that sequesters a first reactive component; and a second fiber that sequesters a second reactive component, wherein at least the first or second fiber releases its reactive component... Agent: Roetzel And Andress

20060280782 - Alcohol-free transdermal insulin composition and processes for manufacture and use thereof: The instant invention is directed toward a dermal delivery system composition comprising an aqueous base vehicle including Emu oil, at least one fatty acid alkyl ester, polyethylene glycol, and a gelling agent, in combination with a therapeutically effective amount of at least one species of insulin, and to processes for... Agent: Mchale & Slavin, P.A.

20060280783 - Method and composition for transdermal drug delivery: The invention is directed to a transdermal drug delivery composition which includes at least one physiologically active agent; and at least one volatile solvent; and at least one viscosity modulating agent. The invention extends to methods of administering such a composition to a subject and treatment of subjects using the... Agent: Foley And Lardner LLP Suite 500

20060280785 - Biocidal materials for treatment against pathogens: Applicant's present invention is a biocidal material for in vivo use for treatment of pathogenic infections comprising nanoparticles or nanostructures of biocidal material encapsulated within a liposomal carrier.... Agent: Akerman Senterfitt

20060280784 - Compound modified with glycerol derivative: p

20060280786 - Pharmaceutical formulations for minimizing drug-drug interactions: A pharmaceutical combination for minimizing pharmacokinetic drug-drug interaction is described including a first pharmaceutical component having a particular pharmacokinetic profile in a mammal and a second pharmaceutical component formulated for parenteral administration having an altered pharmacokinetic profile different from the unaltered pharmacokinetic profile of the second pharmaceutical component, which would... Agent: Baxter Healthcare Corporation

20060280788 - Delivery and formulations of mast cell stabilizers: Diseases of the colon are treated by oral ingestion of a unit dosage form containing a mast cell stabilizer as an active agent. The dosage form is targeted for delivery of the active agent to the colon or when in an immediate release formulation, such as a fast-dissolving tablet, powder... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060280787 - Pharmaceutical formulation of the tubulin inhibitor indibulin for oral administration with improved pharmacokinetic properties, and process for the manufacture thereof: The present invention relates to a pharmaceutical formulation for oral administration of the poorly soluble and therefore hardly bioavailable microtubule polymerization inhibitor Indibulin and a process for its manufacture. In particular, there is provided a pharmaceutical formulation of Indibulin for oral administration comprising a granulate containing micronized Indibulin having a... Agent: Pillsbury Winthrop Shaw Pittman, LLP

20060280792 - Attachment of a handle to a solid oral dosage form: The present invention relates to a method of attaching a handle to a solid oral dosage form by use of high frequency mechanical vibrations. The present invention also relates to a method of attaching a handle to a solid oral dosage form, the method comprising: (a) placing a handle in... Agent: Sterne, Kessler, Goldstein & Fox PLLC

20060280790 - Pharmaceutical formulations: The present invention relates to oral formulations comprising an active agent comprising at least one of 2-[4-(4-chlorobenzoyl)phenoxy]-2-methyl-propanoic acid, salts of 2-[4-(4-chlorobenzoyl)phenoxy]-2-methyl-propanoic acid or buffered 2-[4-(4-chlorobenzoyl)phenoxy]-2-methyl-propanoic acid.... Agent: Robert Deberardine Abbott Laboratories

20060280791 - Pharmaceutical formulations: The present invention relates to oral formulations comprising an active agent comprising at least one of 2-[4-(4-chlorobenzoyl)phenoxy]-2-methyl-propanoic acid, salts of 2-[4-(4-chlorobenzoyl)phenoxy]-2-methyl-propanoic acid or buffered 2-[4-(4-chlorobenzoyl)phenoxy]-2-methyl-propanoic acid.... Agent: Robert Deberardine Abbott Laboratories

20060280789 - Sustained release formulations: The invention provides sustained release formulations of basic drugs, stereoisomers of basic drugs, pharmaceutically acceptable salts of basic drugs, and pharmaceutically acceptable salts of stereoisomers of basic drugs. The basic drugs may be anti-dementia drugs, such as cholinesterase inhibitors or memantine. In one embodiment, the cholinesterase inhibitor is donepezil.... Agent: Venable LLP

20060280793 - Oral sustained-release preparation of fasudil hydrochloride: Disclosed is an oral sustained-release preparation which contains at least one active-ingredient selected from the group consisting of fasudil hydrochloride and a hydrate thereof, the preparation comprising at least one sustained-release coated particle comprising a core having a surface and a coating formed on the surface of the core, wherein... Agent: Young & Thompson

20060280794 - Solid pharmaceutical preparation: A solid preparation comprising an insulin sensitizer and an HMG-CoA reductase inhibitor without deteriorating the stabilities of these drugs, wherein said preparation comprises particles containing an insulin sensitizer and particles containing an HMG-CoA reductase inhibitor.... Agent: Mark Chao Takeda Pharmaceutical North America Inc

20060280795 - Specific time-delayed burst profile delivery system: The invention provides a delivery device for the delayed release of an active agent in the gastrointestinal tract comprising a core, comprising an active agent; a first outer coating, comprising a relatively hydrophobic substantially water insoluble polymer having substantially water insoluble hydrophilic particles embedded therein; and a first inner coating... Agent: Foley And Lardner LLP Suite 500

20060280796 - Inositol-based molecular transporters and processes for the preparation thereof: Inositol derivatives in accordance with the present invention are effective in significantly enhancing the transportation of various therapeutic molecules across a biological membrane, which may include the plasma membrane, nuclear membrane or blood-brain barrier.... Agent: Sughrue Mion, PLLC

20060280797 - Blends of temperature sensitive and anionic polymers for drug delivery: A physical blend of inverse thermal gelling and shear-thinning, thixotropic polymers that has a lower gelation temperature than the thermal gelling polymer alone is provided. The blend results in an injectable hydrogel that does not flow freely at room temperature, but is injectable due to its shear-thinning properties. The thermal-gelling... Agent: Woodcock Washburn LLP

20060280798 - Nanoparticles for delivery of a pharmacologically active agent: Core-shell nanoparticles comprising: (a) a core which comprises a water insoluble polymer or copolymer, and (b) a shell which comprises a hydrophilic polymer or copolymer; said nanoparticles being obtainable by emulsion polymerization of a mixture comprising, in an aqueous solution, at least one water-insoluble styrenic, acrylic or methacrylic monomer and... Agent: Clark & Elbing LLP

20060280799 - Carrier particles: A carrier particle (10) is arranged in use to encapsulate and carry a payload molecule (4) to a target biological environment, and comprises an internal cavity (8) in which a payload molecule (4) is contained. The cavity (8) is surrounded by a perm-selective hydrogel layer (6), and the payload molecule... Agent: Davis Wright Tremaine LLP

20060280801 - Compositions and method for the reduction of post-operative pain: An organic liquid capable of solubilizing, dispensing or suspending the analgesic, such as esters of monohydric alcohols with aliphatic monocarboxylic acids; C2-C18 monohydric alcohols with polycarboxylic acids; C8-C30 monohydric alcohols; tocopherol and esters thereof with mono or polycarboxylic acids; free carboxylic acids such as oleic, capric, and lauric; dialkyl ethers... Agent: Ralph T. Lilore Third Floor

20060280800 - Tanaproget compositions containing ethinyl estradiol: Compositions containing micronized tanaproget, or a pharmaceutically acceptable salt thereof, and ethinyl estradiol and methods of preparing the same are provided. Also provided are kits containing the compositions, methods of contraception and hormone replacement therapy including administering a composition containing micronized tanaproget and ethinyl estradiol.... Agent: Howson And Howson Cathy A. Kodroff

20060280802 - Therapeutic uses of beta-casein a2 and dietary supplement containing beta-casein a2: A method of reducing the serum level in a mammal of any one more cholesterol, low density lipoprotein (LDL) cholesterol relative to high density lipoprotein (HDL) cholesterol, low density lipoprotein (LDL) cholesterol, very low density lipoprotein (VLDL) cholesterol, apolipoprotein B, and triglycerides by the ingestion of a composition containing β-casein... Agent: Young & Thompson

20060280803 - Method and apparatus for repairing bone: Formed compositions for application to a bone surface of a human or animal subject, comprising: a bone material; and a carrier comprising denatured demineralized bone, where the composition is formed into a shape suitable for administration to the bone. Methods are provided for making formed compositions for application to a... Agent: Harness, Dickey & Pierce, P.L.C

20060280804 - Bioactive peptides derived from the proteins of egg white by means of enzymatic hydrolysis: The invention relates to the production of ovoproducts containing bioactive peptides from the egg white subjected to enzymatic treatment. Said peptides have an inhibiting activity of the angiotensin converting enzyme (ACE inhibiting activity) in vitro and/or anti-hypertensive activity in rats and/or antioxidant activity. Said ovoproducts, complete hydrolizates, the fractions thereof... Agent: Klauber & Jackson

20060280806 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a boiling point higher than the boiling point of double distilled water is used. The physiologically ingestible composition may be administered to reduce changes in blood oxygen saturation levels of a mammal undergoing stress.... Agent: Fleshner & Kim, LLP

20060280807 - Method of healing: A method for treating a patient comprising: (a) injecting into the bloodstream of a patient is breathing a gas mixture having greater than 25% oxygen an aqueous solution comprising: 0.1 to 0.8 M Mg++ and having an osmolarlity less than about 1500 mOSm/l; and (b) increasing the rate of injection... Agent: Fish & Richardson PC

20060280805 - Rouge free pharmaceutical water for injection (wfi) water system: The present invention relates to rouge (corrosion) free pharmaceutical Water for Injection (WFI) systems. These systems are usually made of 316 stainless steel. Rouge is prevented by using a controlled atmosphere which does not contain carbon dioxide. Preferably, this controlled atmosphere is a mixture of about 80% nitrogen and about... Agent: Greenberg Traurig, LLP

20060280808 - Composition and process for removing and preventing mildew and fungal growth: This invention comprises a composition and the process of using the composition for removing and preventing mold, mildew, and fungal growth. The composition comprises at least one alkali metal perborate, at least one inhibiting compound selected from the group consisting of alkali metal silicates, triazoles and mixtures thereof in any... Agent: Naval Air Warfare Center Aircraft Division Office Of Counsel Bldg 435

20060280809 - Anti-infective iodine based compositions for otic and nasal use: Otic and nasal compositions containing any iodine-containing derivatives, including, free iodine and iodoform, are disclosed. lodoform is a potent germicidal agent which provides anti-infective benefits. The composition also contains one or more anti-inflammatory agents and one or more natural or synthetic compounds which provide analgesic benefits. The composition preferably also... Agent: Sheldon Palmer C/o Galvin & Palmer

20060280810 - Disinfecting teat care compositions: The present invention relates to novel compositions which are used to produce nitrous acid, in preferred aspects such compositions comprise a protic acid and a metal nitrite, and to methods for using these compositions, in particular for disinfecting mammalian teat skin.... Agent: Coleman Sudol Sapone, P.C.

20060280812 - Compositions and methods for the treatment of muscular dystrophy: Compositions and methods for treatment of individuals diagnosed with a dystrophin deficiency are disclosed. In particular, inhibitors of NFκB activation, such as pyrrolidine dithiocarbamate (PDTC), have been shown to prevent and reverse muscle damage in animals lacking dystrophin. Such compositions and methods are useful in the treatment of individuals with... Agent: Lathrop & Gage Lc

20060280811 - Formulations for the treatment of arthritis conditions: The present invention relates to formulations comprising combinations of analgesic/anti-inflammatory, immunomodulating and cartilage-reconstructing agents in particular comprising saligenig, boswellic acid, procyanidins, N-acety-glucosamine and either glucoronic acid or glucoronolactone, for the treatment of rheumatoid arthritis and, more generally, of arthritis conditions.... Agent: Young & Thompson

20060280813 - Pharmaceutical compositions containing bulbophyllum and their use for treating illnesses: Described are pharmaceutical compositions containing Bulbophyllum, in particular compositions containing Bulbophyllum neilgherese, optionally in combination with suitable pharmaceutical excipients and carriers, as well as their use for treating illnesses, in particular illnesses of the cardiovascular system.... Agent: Gary M. Nath Nath & Associates PLLC

20060280814 - Nutritional composition for increasing creatine uptake in skeletal muscle: A nutritional composition, the consumption of which provides a method for increasing creatine accumulation, building muscle size, increasing thermogenesis, reducing body fat mass leading to weight loss and/or improving muscular definition. The nutritional composition may include an aqueous solution of cinnamon and creatine. In addition, the nutritional composition may also... Agent: Kenyon & Kenyon LLP

20060280815 - Nutritional composition which promotes weight loss, burns calories, increases thermogenesis, supports energy metabolism and/or suppresses appetite: The present invention provides for a nutritional composition including at least garcinia cambogia extract, gymnema sylvestre leaf extract, and green tea leaf extract, consumption of the nutritional composition providing a method of inducing fast weight loss, burning calories, increasing thermogenesis, supports energy metabolism and/or suppressing appetite in individuals. The nutritional... Agent: Kenyon & Kenyon LLP

20060280816 - Efficient method for producing compositions enriched in total phenols: A product made by a process which results in compositions enriched in total phenols includes purification steps not involving the addition of bisulfite ions. The enriched compositions are characterized as containing monomeric, oligomeric and polymeric phenols, total phenol concentration >12% and exhibiting in vitro COX-2 inhibitory activity enhanced by a... Agent: Hogan & Hartson LLP

20060280817 - Pharmaceutical composition useful for the treatment of hepatocellular carcinoma: The present invention relates to anticancer activity against hepatocellular carcinoma of an extract and fraction isolated from flowers of Butea monosperma. Particularly, this invention relates to anticancer activity against hepatocellular carcinoma of a composition containing markered flavonoid glycosides such as butrin and isobutrin in the range of 2 to 9%... Agent: Reed Smith LLP

20060280819 - Ellagic acid food supplement prepared from pomegranate seed: A food supplement material, and method of its preparation, containing ellagic acid (i.e., in the form of bio-available ellagitannins) and also containing the so-called punicosides (i.e., punicalagins A and B), is derived from pomegranate plant materials. Most preferably, the food supplement is extracted from pomegranate seed (although the whole fruit... Agent: Law Office Of Terry L. Miller

20060280818 - Nicotinic acetylcholine receptor antagonist: The present invention relates to methods and compositions which act as nicotinic acetylcholine receptor antagonist in living organisms. More particularly, the present invention relates to methods and compositions which act as nicotinic acetylcholine receptor antagonist using processed Morinda citrifolia L. plant products.... Agent: Kirton And Mcconkie

20060280820 - Use of an extract of aloysia/verbena/lippia triphylla/citriodora for the treatment of chronic and/or inflammatory diseases: This invention relates to the use of an extract of Aloysia triphylla or a fraction thereof or of a lyophilisate thereof, or of one or more active ingredients of the extract, or of an Aloysia triphylla extract as a matrix protector for inhibiting the angiogenesis of different geneses, for chemoprevention,... Agent: Jenkins, Wilson, Taylor & Hunt, P. A.

20060280821 - Method of treating inflammation disorders using extracts of passion fruit: An extract of the skin or peel of passion fruit is prepared. The extract has the effect of ameliorating the symptoms of inflammation disorders, including asthma and osteoarthritis, in mammals, including humans, when administered in an effective amount.... Agent: Davis, Brown, Koehn, Shors & Roberts, P.C. The Financial Center

20060280822 - Extract of nelumbins semen for the treatment of depression: Disclosed are a Nelumbinis Semen extract for treating depression, method of preparing the extract, and a pharmaceutical composition and a health food, comprising the extract. The Nelumbinis Semen extract is prepared by extracting Nelumbinis Semen with an alcohol or an alcohol solution. The Nelumbinis Semen extract has been demostrated using... Agent: Robert E. Bushnell

20060275209 - Methods of [11c]-radiolabelling phenothiazine and phenothiazine-like compounds: This invention pertains to methods of [11C]-radiolabelling “phenothiazine” and “phenothiazine-like” compounds, which have a pendant group (which is a primary amino group; a cationic primary imino group; a secondary amino group; a cationic secondary imino group; a primary imino group; or a secondary imino group), by reaction with [11C]methyl trifluoromethanesulfonate... Agent: Nixon & Vanderhye, PC

20060275208 - Miniaturized 62zn/62cu generator for high concentration clinical delivery of 62cu kit formulation for the facile preparation of radiolabeled cu-bis(thiosemicarbazone)compounds: A new system accomplishes easy, interchangeable production of multiple PET radiopharmaceuticals through the use of a simplified eluant-only generator and a kit based synthesis technique employing lyophilized or freeze dried ligand. Thus, by simply switching the lyophilized ligand vial kit, any number of 62Cu-labeled radiopharmaceuticals (62Cu-ligand) can be interchangeably synthesized... Agent: Akin, Gump, Strauss, Hauer & Feld

20060275211 - Antibodies and related molecules that bind to 161p2f10b proteins: Antibodies and molecules derived therefrom that bind to 161P2F10B protein and variants thereof, are described wherein 161P2F10B exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 161P2F10B provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 161P2F10B... Agent: Agensys C/o Morrison & Foerster LLP

20060275210 - Antibodies that specifically bind to chemokine beta-4: The present invention relates to antibodies and related molecules that specifically bind to CK-B4. Such antibodies have uses, for example, in the prevention and treatment of cancer as well as immune system diseases and disorders including cancers, as well as immune system diseases and disorders including autoimmune diseases, inflammatory disorders,... Agent: Human Genome Sciences Inc. Intellectual Property Dept.

20060275212 - Treatment and diagnosis of cancer: The present invention is directed to the use of antibodies or binding portions thereof, probes, ligands, or other biological agents which either recognize an extracellular domain of prostate specific membrane antigen or bind to and are internalized with prostate specific membrane antigen. These biological agents can be labeled and used... Agent: Fish & Richardson PC

20060275214 - Methods of screening for anti-inflammatory drugs and use thereof: The present invention relates to methods for screening small organic compounds capable of inhibiting the interactions of glycosaminoglycans with effector cell adhesion molecules. Specifically, the present invention provides a method for screening of small organic compounds, the compounds inhibit the interaction of heparin with L-selectin or P-selectin. The compounds identified... Agent: Heslin Rothenberg Farley & Mesiti PC

20060275215 - Novel imaging agents: The present invention relates to diagnostic imaging agents for in vivo imaging. The imaging agents comprise a synthetic caspase-3 inhibitor labelled with an imaging moiety suitable for diagnostic imaging in vivo. The invention also provides pharmaceutical and radiopharmaceutical compositions comprising the imaging agents, together with kits for the preparation of... Agent: Amersham Health IncIPDepartment

20060275213 - Tumor targeting agents and uses thereof: This invention relates to novel tumor targeting motifs, units and agents, as well as tumor targeting peptides and analogues thereof. The targeting agents typically comprise at least one targeting motif, Aa-Bb-Cc, and at least one effector unit. The invention further relates to specific tumor targeting peptides, pharmaceutical and diagnostic composisitons... Agent: Buchanan, Ingersoll & Rooney PC

20060275216 - Bioactivated diagnostic imaging contrast agents: The present invention relates to improved diagnostic agents for Magnetic Resonance Imaging and optical imaging. In particular, this invention relates to MRI and optical imaging agents that allow for the sensitive detection of a specific bioactivity within a tissue. These agents are prodrug contrast agents which are bioactivated in vivo... Agent: Fish & Richardson P.C.

20060275217 - Chemical exchange saturation transfer contrast agents: Chelating ligands and metal chelates useful as CEST MR contrast agents are disclosed. The CEST agents can be used to evaluate blood volume changes in the heart and brain.... Agent: Fish & Richardson P.C.

20060275218 - Foamable vehicle and pharmaceutical compositions thereof: A hygroscopic pharmaceutical composition includes at least one hygroscopic substance at a concentration sufficient to provide an Aw value of at least 0.9 and an antiinfective agent. A foamble pharmaceutical carrier includes about 50% to about 98% of a polar solvent selected from the group consisting of a polyol and... Agent: Wilmer Cutler Pickering Hale And Dorr LLP

20060275219 - Radial spherical crystallization product, process for producing the same, and dry powder preparation containing the crystallization product: A radial spherical crystallization product having multiple needle-shaped projections radially extending outward from the core portion. The radial spherical crystallization product is produced by, for example, bringing a supercritical fluid mixed with a modifier according to necessity and a solution containing a sample component, which have been introduced through different... Agent: Sughrue Mion, PLLC

20060275220 - Method of creating a cosmetic spray: A method of spraying a liquid cosmetic composition onto the surface of the human body comprising: (i) mechanically pressurising a free-flowing liquid cosmetic composition to a pressure of from 1.0 to less than 5.0 MPa; (ii) passing said composition through a swirl chamber, and (iii) expelling said composition through a... Agent: Unilever Intellectual Property Group

20060275221 - Saccharide foamable compositions: A foamable composition, containing a saccharide for use in the treatment of various disorders including: water, a saccharide, about 0.2% to about 5% by weight of a surface-active agent, about 0.01% to about 5% by weight of at least one polymeric agent selected from a bio-adhesive agent, a gelling agent,... Agent: Wilmer Cutler Pickering Hale And Dorr LLP

20060275222 - Breath freshening and oral cleansing products with synergistic combinations of magnolia bark extract and essential oils: An oral composition for oral cleansing, breath freshening, and anti-microbial benefits includes an oral cavity delivery agent and an antimicrobial active agent including a synergistic combination of Magnolia Bark Extract and an essential oil. The oral composition includes chewing gums, candies, and an edible films. Specific antimicrobial active ingredient combinations... Agent: Brinks Hofer Gilson & Lione

20060275223 - Erythritol compositions for teeth and gums: An oral hygiene composition for use in cleansing a subject's teeth and gingiva can include an effective amount of erythritol admixed with an acceptable carrier. The oral hygiene composition can be configured into a gel or paste that is capable of being applied to one of a subject's tooth and... Agent: Workman Nydegger (f/k/a Workman Nydegger & Seeley)

20060275224 - Calcium carbonate compositions for use in the manufacture of toothpaste: Process for the manufacture of an oral composition, said oral composition comprising from 5 to 60% by weight calcium carbonate as abrasive, said method characterised by the preparation of a slurry which comprises substantially all of the ingredients present in said oral composition followed by the addition of a thickening... Agent: Unilever Intellectual Property Group

20060275225 - Applicator and method for applying a tooth whitening composition: The method of the present invention is directed to the storage and dispensing of a peroxide containing tooth whitening composition. During storage and subsequent use the composition in the storage chamber must be maintained segregated from the applicator surface. This is accomplished by delivering the peroxide containing tooth whitening composition... Agent: Colgate-palmolive Company

20060275227 - Process for treating inorganic particles via sintering of sinterable material: The present disclosure relates to a process for making treated inorganic particles by vapor phase deposition of surface treatments on the particle surface by reacting inorganic particles, typically titanium dioxide particles, with a composition comprising a sinterable material and a liquid medium at a temperature sufficient to evaporate the medium... Agent: E I Du Pont De Nemours And Company Legal Patent Records Center

20060275229 - Skin care active complex and methods of using same: A skin care active complex in accordance with an embodiment of the invention comprises a combination of (1) from about 0.001% to about 10% by weight, preferably from about 0.001% to about 5% by weight, of a vitamin A derivative; (2) from about 0.00001% to about 10% by weight of... Agent: Chief Patent Counsel Engelhard Corporation

20060275228 - Skin care compositions containing idebenone: A stable skin care composition, comprising an effective amount of idebenone, at least one additional skin care active, and a dermatologically acceptable carrier. The composition is substantially colorless.... Agent: The Procter & Gamble Company Intellectual Property Division

20060275226 - Titanium dioxide and methylene-bis-benzotriazolyl-phenol mixture: b1) from 20 to 75% by weight of at least one methyleoebisbenzo-triazolylphenol in which the benzotriazolyl radicals and phenol radicals can each be independently substituted by one or more C1-20 alkyl radicals, C1-20 alkoxy radicals, C1-20 hydroxyalkyl radicals, C6-12 aryl radicals, halogen, hydroxyl groups or cyano groups, as organic micropigment... Agent: Birch Stewart Kolasch & Birch

20060275230 - Compositions and methods for treating conditions of the nail unit: The biodegradable drug delivery systems described here are formulated for implantation into the nail unit and its surrounding tissues for the treatment of various nail unit conditions. The systems include non-temperature dependent phase change compositions that may be formulated as solutions, solids, semisolids, microparticles, or crystals.... Agent: Morrison & Foerster LLP

20060275231 - Cosmetic composition, a packaging device and a method of application: A cosmetic composition, in a physiologically acceptable medium, may include at least one photoluminescent agent. The at least one photoluminescent agent may cause at least three photoluminescent peaks to be observed at respective different wavelengths in the visible spectrum when the composition is illuminated at a wavelength of 365 nm.... Agent: Oliff & Berridge, PLC

20060275232 - Two-composition product, uses thereof, and makeup kit containing this product: A product for making up and/or caring for the skin, the lips or the integuments, containing a first and a second composition, the first composition being a W/O emulsion containing at least one wax and fibres, the second composition containing a fatty phase with at least one oil. The product... Agent: C. Irvin Mcclelland Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20060275233 - Long-lasting color and gloss formulations: Embodiments include colorant compositions that are water-based and gloss compositions. Certain liquid lip color embodiments include a composition having water and shellac. The composition may also include a neutralizer such as triethanolamine to neutralize the shellac. The composition may also include PPG-17/IPDI/DMPA copolymer. The composition may also include an emulsifier... Agent: Konrad Raynes & Victor, LLP

20060275234 - Poly-alpha-olefin -containing cosmetic composition: The invention is directed to a cosmetic composition which contains at least one poly-α-olefin produced by subjecting at least one primary alcohol to dehydrating polymerization at a temperature of 60° C. to 340° C. in the presence of acidic alumino layer silicates. The primary alcohol is an alcohol from the... Agent: Cognis Corporation Patent Department

20060275245 - Detergent cosmetic compositions comprising at least one amino silicone, and use thereof: Disclosed herein is novel detergent and conditioning composition comprising, in a cosmetically acceptable medium, at least one sulfate or sulfonate anionic surfactant, at least one carboxylic anionic surfactant other than the preceding surfactant, at least one amphoteric surfactant and at least one amino silicone, wherein the sulfate or sulfonate anionic... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060275235 - Cation-modified galactomannan polysaccharide and cosmetic composition containing the same: Concretely, the present invention provides a cation-modified galactomannan polysaccharide obtained by substituting some of hydroxyl groups contained in an cation-modified galactomannan polysaccharide which is nonionic polysaccharide and constitutes mannose as a main chain and galactose as a side chain and the composition ratio of mannose and galactose is 1:1 and... Agent: Oliff & Berridge, PLC

20060275239 - Depolymerized scleroglucan for regulating and improving the moisture content of the skin: The use of depolymerized scleroglucan alone, or in combination with one or more active ingredients as a moisturizer, and as anti-inflammatory active ingredient for protecting and for restoring a healthy skin barrier in the field of cosmetic or dermatological skincare is disclosed.... Agent: Leopold Presser, Scully, Scott, Murphy & Presser

20060275236 - Personal skin care compositions containing anti-flammatory and anti-microbial agents: Personal care compositions suitable for use in skin care applications, which effectively deliver and/or deposit anti-inflammatory and anti-microbial agents, which are relatively non-irritating, and thus suitable for use by people having irritated or sensitive skin, particularly the skin around the eyes of a user. The personal care composition comprises a... Agent: Patton Boggs, L.L.P.

20060275237 - Skin care compositions containing idebenone: A stable skin care composition, comprising an effective amount of idebenone, at least one additional skin care active, and a dermatologically acceptable carrier.... Agent: The Procter & Gamble Company Intellectual Property Division

20060275238 - Topical cosmetic formulations for regulating and improving the moisture content of the skin: Cosmetic and/or dermatological formulations for the topical treatment of the skin for regulating and improving the moisture content of the skin, comprising as active ingredient combination a) at least one anionic polyamino acid matrix, b) at least one polysaccharide, and optionally c) one or more osmoprotectants for topical application are... Agent: Leopold Presser, Scully, Scott, Murphy & Presser

20060275241 - Cosmetic towelette product: A cosmetic towelette product is provided which includes a water-insoluble substrate and cosmetic composition in contact with the substrate. The composition includes a copolymer structured from in part a vinyl ester of a C3-C20 acid and a tea extract delivered in a cosmetically acceptable carrier. The combination of copolymer and... Agent: Unilever Intellectual Property Group

20060275240 - Synthetic thickeners for cosmetics: Disclosed are inverse emulsions useful as thickeners for cosmetic formulations wherein the weight ratio between the aqueous phase and the oil phase is from 4:1 to 2:1 and containing from 20 to 70% by weight of an anionic acrylic polymer obtained by inverse emulsion polymerisation of one or more anionic... Agent: Paul S Madan Madan, Mossman & Sriram, PC

20060275242 - Compositions containing selenium disulfide, a washing base and optionally at least one ether containing two fatty chains, and cosmetic treatment process: Composition containing, in an aqueous medium, a washing base, optionally at least one ether containing two fatty chains, and selenium disulfide, and have a rheological profile defined by a relaxation time of from 1 to 18 ms, measured at 25° C.... Agent: C. Irvin Mcclelland Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20060275243 - Cosmetic or therapeutic combination preparation with theanine: A cosmetic or therapeutic composition with a proportion of substantially free amino acids as well as the use of such a composition for improving skin moistness, skin elasticity and/or for skin wrinkle reduction. In accordance with the invention proposed for that purpose is a cosmetic or therapeutic composition having a... Agent: Simpson & Simpson, PLLC

20060275244 - Alkyl-capped alkoxylated esters and compositions comprising same: Process of making alkyl-capped alkoxylated esters. More specifically, a process of making alkyl-capped alkoxylated esters that are comprised substantially of triethylene alkoxy ester and substantially free from ethylene glycol monoalkoxy monoester and diethylene glycol monoalkoxy monoester.... Agent: The Procter & Gamble Company Intellectual Property Division

20060275247 - Cosmetic compositions with moringa seed extract: A cosmetic composition comprising Moringa seed extract in combination with at least one liophilic particulate.... Agent: Julie Blackburn Revlon Consumer Products Corporation

20060275246 - Process for the preparation of ferutinine from ferula genus plants: The invention relates to a process for the preparation of ferutinine (Ia) from Ferula spp extracts comprising basic hydrolysis of the extracts and treatment with p-pivaloyloxybenzoic acid. The invention relates also to the use of the extracts and ferutinine in the cosmetic and dermatological field.... Agent: Young & Thompson

20060275248 - Methods and devices for infant feeding: A method of feeding an infant, the method comprising the steps of: providing a feeding device; adding a female's breast odor to the feeding device; and feeding the infant using the feeding device. A feeding device, a pacifying device and an odor carrier are also described.... Agent: Akin Gump Strauss Hauer & Feld L.L.P.

20060275249 - Co-therapy for diabetic conditions: Methods of treating diseases diabetes are disclosed. Methods of modulating elevated fructosamine levels, elevated HbA1c levels, impaired glucose tolerance, and impaired fasting glucose are also disclosed. In some embodiments, methods include co-administration of a biguanide and a bile acid sequestrant. Drug products including a biguanide and bile acid sequestrants in... Agent: Karen M. Whitney Diehl Servilla LLC

20060275252 - Conjugates formed from polymer derivatives having particular atom arrangements: Polymeric reagents are provided comprising a moiety of atoms arranged in a specific order, wherein the moiety is positioned between a water-soluble polymer and a reactive group. The polymeric reagents are useful for, among other things, forming polymer-active agent conjugates. Related methods, compositions, preparations, and so forth are also provided.... Agent: Nektar Therapeutics

20060275251 - Polymer complexes of glucuronoglucanes: A biocompatible intermolecular polymer complex comprises an anionic component and a non protein cationic component. The anionic component comprises a linear or branched polysaccharide chain wherein at least 5% of the basic structural units are glucuronic acid. The cationic component comprises a linear or branched natural, semi-synthetic or synthetic oligomer... Agent: Jacobson Holman PLLC

20060275250 - Reactive polymers and copolymers, method of their preparation and their use: The solution concerns reactive polymers and copolymers based on N-(2-hydroxypropyl)methacrylamide, which contain reactive thiazolidine-2-thione groups in side chains of the polymers or at the ends of polymer chains. The solution also includes a method of their preparation and their use for synthesis of polymer drugs and conjugates with proteins and... Agent: Notaro And Michalos

20060275253 - Beta hydroxy short to medium chain fatty acid polymer: The present invention provides a composition comprising a polymer of a β-hydroxy short-medium chain fatty acid, which is used for delivering the β-hydroxy short-medium chain fatty acid or an oligomer thereof to the large intestine. In case the composition is administrated orally, the composition will be delivered to the large... Agent: Wenderoth, Lind & Ponack, L.L.P.

20060275257 - G-csf conjugates: The invention relates to polypeptide conjugates comprising a polypeptide exhibiting G-CSF activity and having an amino acid sequence that differs from the amino acid sequence of human G-CSF in at least one specified introduced and/or removed amino acid residue comprising an attachment group for a non-polypeptide moiety, and having at... Agent: Maxygen, Inc. Intellectual Property Department

20060275256 - Inhibition of pathogenic agents including alpha6beta1 integrin receptor of alpha6beta4 integrin receptor at a surface: Disclosed are treatment agents and methods of treatment utilizing the agents directed toward diseases in which the disease causing pathogen includes α6β1 integrin receptors and/or α6β4 integrin receptors on the surface of the pathogen. In one embodiment, the disease can be breast cancer. The therapeutic agents disclosed include a polypeptide... Agent: Dority & Manning, P.A.

20060275258 - Interferon-alpha induced gene: The present invention relates to identification of a gene upregulated by interferon-α administration corresponding to the cDNA sequence set forth in SEQ. ID. No. 1. Determination of expression products of this gene is proposed as having utility in predicting responsiveness to treatment with interferon-α and other interferons which act at... Agent: Alston & Bird LLP

20060275255 - Modulating apoptosis: The use and screening of modulators of apoptosis is disclosed. The modulators may be, for example, modulator of NF-κB activity. The modulators may be used, for example, in the treatment of NF-κB-mediated diseases, conditions, and injuries.... Agent: Polsinelli Shalton Welte Suelthaus P.C.

20060275254 - Pharmaceutical composition comprising an immunoglobulin fc region as a carrier: Disclosed is a novel use of an immunoglobulin Fe fragment, and more particularly, a pharmaceutical composition comprising an immunoglobulin Fe fragment as a carrier. The pharmaceutical composition comprising an immunoglobulin Fe fragment as a carrier remarkably extends the serum half-life of a drug while maintaining the in vivo activity of... Agent: Seed Intellectual Property Law Group PLLC

20060275259 - Il-8-like proteins: This invention relates to proteins, termed INSP093, herein identified as secreted proteins, in particular, as members of the Interleukin (IL) 8-like chemokine family and to the use of these proteins and nucleic acid sequences from the encoding genes in the diagnosis, prevention and treatment of disease.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20060275260 - Use of imatinib to treat liver disorders and viral infections: The present invention relates to the use of imatinib for treating viral liver diseases and in particular for viral hepatitis. The invention provides the use of imatinib for inhibiting replication, transmission or both of hepatitis viruses. The invention further relates to the use of imatinib for inhibiting replication, transmission or... Agent: Winston & Strawn LLP

20060275261 - Adenoviral vectors having a protein ix deletion: This invention provides a recombinant adenovirus expression vector characterized by the partial or total deletion of the adenoviral protein IX DNA and having a gene encoding a foreign protein or a functional fragment or mutant thereof. Transformed host cells and a method of producing recombinant proteins and gene therapy also... Agent: Townsend And Townsend And Crew, LLP

20060275263 - Cell proliferation inhibitory proteins and polynucleotides, antisense polynucleotides to the polynucleotides, cell proliferation inhibitors using the foregoing, cancer diagnostic agents, cancer therapeutic agents and compositions for gene therapy: The genes the expression of which is reduced or disappeared in immortal cells including cancer cells are isolated, their DNA sequences are determined, the genes are expressed to produce cell proliferation inhibitory proteins, and the genes and the proteins are utilized as agents for diagnosis or treatment, including the genetic... Agent: Fitch, Even, Tabin & Flannery

20060275262 - Conditionally replicating viruses and methods for cancer virotherapy: The present invention provides for methods and compositions for translation of a viral vector both in vitro and in vivo. Specifically, the present invention pertains to a translational control element placed in a vector to cause a selective translation of a viral vector. In one embodiment, the present invention provides... Agent: Frost Brown Todd, LLC

20060275264 - Novel glutamic acid decarboxylase (gad) chimera and methods of use: The invention relates to a novel Glutamic Acid Decarboxylase (GAD). More specifically, novel DNA and protein sequences relating to GAD. Additionally, the invention discloses a novel composition and related methods for treating neurodegenerative diseases such as Parkinson's disease, Alzheimer's disease, epilepsy, and the like, using viral and non-viral delivery systems... Agent: Nutter Mcclennen & Fish LLP

20060275267 - Nucleic acids encoding inactive variants of human telomerase: The invention provides compositions and methods related to human telomerase reverse transcriptase (hTRT), the catalytic protein subunit of human telomerase. Catalytically inactive variants comprising deletions or other mutations are provided.... Agent: Geron Corporation

20060275265 - Potent inhibition of influenza virus by specifically designed short interfering rna: said sequences being inhibitory against influenza virus in animals including humans. The invention further includes one or more of said siRNA sequences in the form of an aqueous suspension suitable for nasal inhalation. Still further, the invention includes one or more of said siRNA sequences in the form of a... Agent: Joseph E. Mueth, Esq. Joseph E. Mueth Law Corporation

20060275266 - Tripeptide of fcyriia: The present invention relates, in general, to phagocytosis and phagolysosomal fusion and, in particular, to a tripeptide of FcγRIIA that mediates trafficking of targets phagocytosed via FcγRIIA to the lysosomal compartment.... Agent: Nixon & Vanderhye, PC

20060275275 - Cells and methods for estimation of effects on neurological dysfunction: The invention provides neuron-derived cells obtained by transfecting a receptor-expressing nucleic acid having an aryl hydrocarbon receptor gene, wherein outgrowth of neurites is not observed without adding a substance for the aryl hydrocarbon receptor, and outgrowth of neurites is observed by adding the substance for the aryl hydrocarbon receptor. The... Agent: C. Irvin Mcclelland Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20060275274 - Use of saposin-related proteins for preventing and treating obesity, diabetes and/or metabolic syndrome: The present invention discloses Saposin-related homologous proteins regulating the energy homeostasis and the metabolism of triglycerides, and polynucleotides, which identify and encode the proteins disclosed in this invention. The invention also relates to the use of these sequences in the diagnosis, study, prevention, and treatment of metabolic diseases and disorders.... Agent: Sutherland Asbill & Brennan LLP

20060275276 - Dilution of genetic traits: Undesirable genetic traits, such as resistance to toxin, can be inhibited or reversed by introducing sexually compatible individuals substantially homozygous for the sensitive allele, such as the wild type, into the target population.... Agent: Greenlee Winner And Sullivan P C

20060275268 - Compositions for activating the infiltration activity of dendritic cells, and immunopotentiating agents: The present invention's compositions for activating the infiltration activity of dendritic cells comprise retinoid. Retinoid increases the production of MMP-9, which is required for dendritic cells to exert their infiltration activity, and thereby activates the dendritic cells' infiltration activity. Therefore, the compositions exhibit immunopotentiating effects and can be used in... Agent: Fish & Richardson P.C.

20060275270 - In vitro mucosal tissue equivalent: The present invention relates to methods of constructing an integrated artificial immune system that comprises appropriate in vitro cellular and tissue constructs or their equivalents to mimic the normal tissues that interact with pathogens and vaccines in mammals. The artificial immune system can be used to test the efficacy of... Agent: Merchant & Gould PC

20060275273 - Intervertebral disc repair, methods and devices therefor: The present application discloses compositions, methods and devices for treatment of a degenerative intervertebral disc. A composition can comprise chondrocytes expressing type II collagen. These chondrocytes can be obtained from human cadavers up to about two weeks following death, and can be grown in vitro. The compositions can further comprise... Agent: Sonnenschein Nath & Rosenthal LLP

20060275269 - Method and data system for the treatment at birth of a patient who is identified at birth as having an elevated risk of a previously unidentified disorder: The present invention provides a procedure used in the overall treatment of a patient who is identified at birth as having an elevated risk of a previously unidentified disorder and method of using a data system to assist in the procedure. In a preferred embodiment, the procedure involves, at the... Agent: Pillsbury Winthrop Shaw Pittman LLP

20060275271 - Plasma-depleted, non-red blood cell-depleted cord blood compositions and methods of use: The umbilical cord blood (UCB) compositions of the present invention possess the unique features of having plasma that is substantially depleted from the UCB unit and red blood cells (RBC) that are not depleted from the UCB unit. Such UCB units can be prepared by a process that combines plasma... Agent: Townsend And Townsend And Crew, LLP

20060275272 - Transplantation of bone marrow stromal cells for treatment of neurodegenerative diseases: The present invention relates to a treatment of an autoimmune demyelinating disease/disorder. Also included in the present invention is the use of bone marrow stromal cells for the treatment of multiple sclerosis (MS).... Agent: Drinker Biddle & Reath Attn: Intellectual Property Group

20060275277 - Use of coagulation proteins to lyse clots: The present invention relates to the use of coagulation proteins for the lysis of blood clots. More specifically, the present invention provides a method for accelerating the dissolution of a blood clot through the administration of at least one coagulation protein comprising a basic C-terminal amino acid, wherein the coagulation... Agent: David S Resnick Nixon Peabody

20060275278 - Method and ophthalmic formulation for eye protection or treatment: An ophthalmic composition for artificial tears useful for treating dry eye symptoms or for general eye protection. The composition includes a physiologically balanced salt solution and one or more anti-oxidative ingredients which collectively confer on said ophthalmic composition a total antioxidant capacity as a FRAP value of greater than 100... Agent: Knobbe Martens Olson & Bear LLP

20060275279 - Methods for dissolving cystine stones and reducing cystine in urine: The present invention is directed to an improved method of treating cystinuria, utilizing the catalytic ability of cystinase to increase the rate of cystine stone dissolution.... Agent: Christie, Parker & Hale, LLP

20060275280 - Metalloprotease activation of myostatin, and methods of modulating myostatin activity: It has been determined that metalloprotease cleavage of a myostatin pro peptide results in activation of a latent inactive myostatin to an active form. Accordingly, methods of identifying agents that modulate metalloprotease mediated activation of myostatin are provided, as are agents identified using such methods. Also provided are methods of... Agent: Lisa A. Haile, J.d., Ph.d. Dla Piper Rudnick Gray Cary US LLP

20060275281 - Nanotubes as mitochondrial uncouplers: A method of uncoupling mitochondria in a subject including administering nanotubes to the subject in a therapeutically effective amount, wherein the nanotubes are self-rectifying is provided. A method of decreasing reactive oxygen species and decreasing detrimental loading of Ca2+ into mitochondria is provided, including administering a pharmaceutically effective amount of... Agent: Buchanan, Ingersoll & Rooney PC

20060275282 - Antibodies and fc fusion proteins with altered immunogenicity: Variant antibodies and Fc fusion proteins with reduced immunogenicity are described. In particular, the variants of antibodies and Fc fusion proteins have reduced ability to bind one or more human class II MHC molecules are described.... Agent: Robin M. Silva, Esq. Dorsey & Whitney LLP

20060275283 - Fcgamma receptor-binding polypeptide variants and methods related thereto: The compositions and methods of the present invention are based, in part, on our discovery that an effector function mediated by an Fc-containing polypeptide can be altered by modifying one or more amino acid residues within the polypeptide (by, for example, electrostatic optimization). The polypeptides that can be generated according... Agent: Lahive & Cockfield

20060275284 - Combination therapy for treatment of autoimmune diseases using b-cell depleting/immunoregulatory antibody combination: The present invention concerns treatment of autoimmune diseases with the combination of an immunoregulatory antibody, e.g. an anti-B7.1 or anti-B7.2 or anti-CD40L antibody and at least one B cell depleting antibody, such as CD19, CD20, CD22, CD23, or CD37, wherein such antibodies may be administered separately, or in combination, and... Agent: Pillsbury Winthrop Shaw Pittman, LLP

20060275286 - Antibody and use of the same: The present invention aims at providing an antibody, by which metastin or its derivative can be quantified specifically with a high sensitivity, a method of detecting/quantifying metastin or its derivative using the antibody, and a diagnostic agent (e.g., a diagnostic for pregnancy) the same. Specifically, an antibody capable of specifically... Agent: Edwards & Angell, LLP

20060275285 - Methods of inhibiting a gpcr: The invention provides methods of identifying modulators, for example, inhibitors, of a G-protein coupled receptor. The modulators can be used for the treatment or prevention of metabolic disorders such as dyslipidemia, metabolic syndrome and obesity. The invention also provides methods of treating or preventing metabolic disorders by administering modulators of... Agent: Amgen Inc.

20060275288 - Glp-1 receptor agonist and allosteric modulator monoclonal antibodies and uses thereof: The subject invention relates to monoclonal antibodies that have the ability to bolster the function of the GLP-1 receptor and may therefore have utility in the treatment of mammalian metabolic disorders such as, for example, diabetes. In particular, the invention describes the generation of fully human monoclonal antibodies made against... Agent: Robert Deberardine Abbott Laboratories

20060275287 - Scroll compressor: A scroll compressor that is easy of back pressure adjustment and capable of realizing high compression efficiency. The scroll compressor comprises a plurality of compression spaces formed by fixed spiral blades meshing with rotary spiral blades, a back pressure chamber disposed on the side opposite to the rotary spiral blade... Agent: Banner & Witcoff

20060275290 - Active or passive immunization against proapoptotic neurotrophins for the treatment and/or prevention of neurodegenerative diseases: The present invention relates to novel methods for combating cell degeneration or dysfunction resulting from neuroinflammatory conditions. The invention especially relates to the use, in the preparation of a medicament for the treatment of neurodegenerative disease associated with neuroinflammation, of an immunogenic compound which is capable of inducing an immune... Agent: C. Irvin Mcclelland Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20060275292 - Fully human anti-cd3 monoclonal antibodies: Non-toxic anti-CD3 antibody is useful for the treatment, prevention, and reversal of human autoimmune disease. Anti-CD3 antibody is generated by immunizing xenogenic mice capable of developing fully human antibodies. Because the inventive antibodies are not derived from other species, they do not the invoke the immune responses typically associated with... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20060275291 - Identification of unique binding interactions between certain antibodies and the human b7.1 and b7.2 co-stimulatory antigens: The present invention relates to the identification of antibodies which are specific to human B7.1 antigen (CD80) and which are capable of inhibiting the binding of B7.1 to a CD28 receptor and which are not capable of inhibiting the binding of B7.1 to a CTLA-4 receptor. Two of these antibodies,... Agent: Pillsbury Winthrop Shaw Pittman, LLP

20060275289 - Preventive or remedy for inflammatory bowel diseases containing anti-cd81 antibody as the active ingredient: It is possible to use a screening system using the inhibition of CD81 gene expression, the inhibition of CD81 expression or the inhibition of its function (activity) as an indication in searching for a drug for preventing, ameliorating or treating IBD. Also, anti-CD81 antibody is highly efficacious as the active... Agent: Birch Stewart Kolasch & Birch

20060275295 - Activity of thap-family chemokine-binding domains: Among the methods and compositions described herein are methods of ameliorating one or more symptoms associated with a chemokine-mediated or influenced condition by providing to a subject an agent that includes a polypeptide comprising a chemokine binding domain of a THAP-family polypeptide.... Agent: Knobbe Martens Olson & Bear LLP

20060275298 - Antagonist of th-1 immuneresponse inducing cytokine for the treatment of autoimmune diseases: Oromucosal administration of antagonists of cytokines associated with stimulation or enhancement of T helper 1 cell responses, preferably for example a Type 1-interferon antibody, is disclosed for inhibition or prevention of auto immune diseases.... Agent: Alston & Bird LLP

20060275296 - Il-31 monoclonal antibodies and methods of use: The present invention relates to methods of treating pruritic diseases, including but not limited to Contact dermatitis, Atopic Dermatitis, Drug induced delayed type cutaneous allergic reactions, Toxic epidermal necrolysis, Cutaneous T cell Lymphoma, Bullous pemphigoid, Alopecia wereata, Vitiligo, Acne Rosacea, Prurigo nodularis, Scleroderma, Herpes simplex virus, or combination thereof by... Agent: Zymogenetics, Inc. Intellectual Property Department

20060275297 - Mammalian cx3c chemokine antibodies: Nucleic acids encoding a new family of chemokines, the CX3C family, from a mammal, reagents related thereto, including specific antibodies, and purified proteins are described. Methods of using said reagents and related diagnostic kits are also provided.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20060275294 - Method of prevention and treatment of aging, age-related disorders and/or age-related manifestations including atherosclerosis, peripheral vascular disease, coronary artery disease, osteoporosis, arthritis, type 2 diabetes, dementia, alzheimers disease an: This invention relates to a method for prevention and treatment of aging, age-related disorders and/or age-related manifestations including atherosclerosis, peripheral vascular disease, coronary artery disease, osteoporosis, type 2 diabetes, dementia and some forms of arthritis and cancer in a subject comprising administering to said subject, separately, sequentially or simultaneously a... Agent: Black Lowe & Graham, PLLC

20060275293 - Splice variant of the human pituitary growth hormone: This invention relates to a novel protein, termed INSP101, herein identified as a novel splice variant of human pituitary growth hormone and to the use of this protein and nucleic acid sequences from the encoding genes in the diagnosis, prevention, and treatment of disease.... Agent: Saliwanchik Lloyd & Saliwanchik A Professional Association

20060275300 - P450rai-2 (p450 cytochrome 26b), encoding nucleic acid molecules and methods and uses thereof: The present invention provides a novel all-trans-RA inducible all-trans-RA metabolizing cytochrome P450, P450RAI-2, that is predominantly expressed in the brain, cerebellum in particular. It is also expressed in normal and tumour lung tissue and in breast cancer cells and may have a correlation with lung and breast cancer. Human P450RAI-2... Agent: Bereskin And Parr

20060275299 - Use of protein tyrosine phosphatase inhibitors for prevention and/or treatment of cancer: The invention relates to the use of a protein tyrosine phosphatase inhibitor, such as a cross-linker of a protein tyrosine phosphatase (PTP), in particular Sap-1, in the preparation of a medicament for treatment and/or prevention of cancer, and to methods of treating and/or preventing cancer using these inhibitors.... Agent: Fish & NeaveIPGroup Ropes & Gray LLP

20060275307 - Antibodies to treat cancer: Compositions and methods for the treatment of cancer, particularly melanoma, myeloma, small cell lung cancer, thymic lymphoma, T-cell lymphoma, B-cell lymphoma, osteosarcoma, and acute T-cell leukemia, are disclosed. Illustrative compositions include one or more anti-ganglioside antibodies and polynucleotides that encode such anti-ganglioside antibodies. These antibodies may be for example, hamster... Agent: Lahive & Cockfield

20060275301 - Cell death-inducing agent: To identify antigens of the 2D7 antibody, the present inventors cloned the 2D7 antigen. The results suggested that the 2D7 antigen is an HLA class I molecule. Based on this finding, the present inventors examined whether the 2D7 antibody has cell death-inducing activity. Nuclei fragmentation was observed when the 2D7... Agent: Fish & Richardson PC

20060275308 - Combination of gallium compounds with nonchemotherapeutic anticancer agents in the treatment of neoplasia: The present invention relates to a combination of a pharmaceutical composition comprising a gallium compound, especially gallium nitrate, and one or more nonchemotherapeutic anticancer agents (NCAA) including antibodies, antisense molecules, anti-telomerase agents, aptamers, biologic response modifiers, bisphosphonates, cytotoxic fusion proteins, immunomodulatory agents, immunostimulatory agents, molecular decoys, molecular inhibitors, proteasome inhibitors,... Agent: Kenyon & Kenyon LLP

20060275305 - Herceptin adjuvant therapy: The present application describes adjuvant therapy of nonmetastatic breast cancer using HERCEPTIN®.... Agent: Heller Ehrman LLP

20060275303 - Modulating angiogenesis using ll-37/hcap-18: A pharmaceutical composition containing a peptide or pharmaceutically acceptable salt thereof containing the amino acid sequence [LL-37, 37 aa] (LL-37); for preventing or treating wounds, tumors, or disease caused by or resulting in a reduced level of angiogenesis or of arteriogenesis is disclosed.... Agent: Baker & Mckenzie LLP Patent Department

20060275302 - Novel cancer-associated gene: The present invention provides: a novel DNA, a carcinoma-associated gene comprising the DNA, a recombinant protein encoded by the DNA, an antibody binding to the protein, an anti-carcinoma agent comprising the antibody, a low-molecular-weight compound binding to the protein, and a screening system. An example of such a novel DNA... Agent: Birch Stewart Kolasch & Birch

20060275304 - Novel tumor antigen useful in diagnosis and therapy of prostate and colon cancer: Compositions for the diagnosis and therapy of prostate and colon cancer, derived from or based on a novel prostate-specific, androgen-regulated, cell surface serine protease termed 20P1F12/TMPRSS2 are described. A full length cDNA comprising the entire coding sequence of the 20P1F12/TMPRSS2 gene (also designated 20P1F12-GTC1 herein) is provided (FIG. 1). Among... Agent: Morrison & Foerster LLP

20060275306 - Protein formulation: A stable lyophilized protein formulation is described which can be reconstituted with a suitable diluent to generate a high protein concentration reconstituted formulation which is suitable for subcutaneous administration. For example, anti-IgE and anti-HER2 antibody formulations have been prepared by lyophilizing these antibodies in the presence of a lyoprotectant. The... Agent: Genentech, Inc.

20060275309 - Peptide oligomers for use as hiv vaccines: Partially occluded and/or multimeric presentations of peptides mimic the epitopes recognised by antibodies capable of neutralising diverse clinical isolates of the human immunodeficiency virus type 1 (HIV-1). By “partially occluded” is meant a presentation that has a three-dimensional structure (probably a barrel/cylindrical/helical shape) generated by inter-chain disulphide bridging or other... Agent: Jaeckle Fleischmann & Mugel, LLP

20060275310 - Method and detection and decontamination of antigens by nanoparticle-raman spectroscopy: A composition and method of detecting antigens and killing bacteria and virus is described. The composition and method comprise a fluorescent nanoparticle conjugated to a substance capable of binding specifically to a antigen and exposing the location containing the fluorescent nanoparticle and antigen to a wavelength of light capable of... Agent: Ross Spencer Garsson Winstead Sechrest & Minick P.C.

20060275311 - Method for the treatment or prophylaxis of tuberculosis: The invention provides the use of intravenous immunoglobulin (IVIg) in the preparation of a medicament for the treatment and/or prophylaxis of mycobacterial infection.... Agent: Palmer & Dodge, LLP Kathleen M. Williams

20060275312 - Molecule: We describe an Fve polypeptide being a fragment, homologue, variant or derivative of Fve protein, which comprises at least one biological activity of Fve protein. Uses of such a polypeptide, etc, and nucleic acids encoding these, in the treatment and prevention of allergy and cancer are also disclosed.... Agent: Steptoe & Johnson LLP

20060275313 - Therapeutic and diagnostic agents: The present invention relates generally to therapeutic and diagnostic agents. More particularly, the present invention provides molecules having structural features characteristic of immunoregulatory signaling (IRS) molecules and which are expressed by cells of heaematopoietic lineages such as, in particular, leukocytes. The molecules of the present invention find broad application inter... Agent: Knobbe Martens Olson & Bear LLP

20060275314 - Transmembrane protein differentially expressed in cancer: The invention provides a transmembrane protein that is differentially expressed in neoplastic disorders. It also provides for the use of the protein, a cDNA encoding the protein, and antibodies that specifically bind the protein in various methods to diagnose, stage, treat, or monitor the treatment of a neoplastic disorder.... Agent: Foley And Lardner LLP Suite 500

20060275316 - Modulation of cxcr4 and related methods and compositions: A method for inhibiting the SDF1-CXCR4 signaling pathway in a subject, comprising administering to the subject an effective amount of a Beta Defensin (BD)-inducing agent. The BD-inducing agent may be a Fusobacterium associated defensin inducer (FAD-I) polypeptide or a double stranded RNA analog.... Agent: Hahn Loeser & Parks, LLP

20060275315 - Nucleic acids and proteins from streptococcus groups a & b: The invention provides proteins from group B streptococcus (Streptococcus agalactiae) and group A streptococcus (Streptococcus pyogenes), including amino acid sequences and the corresponding nucleotide sequences.... Agent: Banner & Witcoff

20060275318 - Surface protein of leptospira: The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods.... Agent: Fulbright & Jaworski, LLP

20060275317 - Vaccine compositions for prevention of chronic and infectious diseases: The present invention generally features therapeutic and diagnostic compositions and methods for increasing or decreasing the binding of a lysozyme polypeptide to a Treponema pallidum P17 polypeptide (Tp17) or a Tp17-like polypeptide. More particularly, the invention relates to compositions and methods for detecting, treating, or preventing a pathogen infection or... Agent: Kirkpatrick & Lockhart Nicholson Graham LLP

20060275319 - Saccharomyces cerevisiae yeast strain with functional expression of a glut transporter: The invention relates to a strain of the yeast Saccharomyces cerevisiae which, owing to deletion of the genomic sequences, no longer synthesizes hexose transporters and, as a consequence, can no longer grow on substrates with hexoses as the only carbon source, and whose ability of growing on a substrate with... Agent: Bell, Boyd, & Lloyd LLC

20060275320 - Method of attenuating bacterial virulence by targeting the phosphotransacetylase n-terminal domain: It is disclosed that the N-terminal domain of a long form bacterial phosphotransacetylase is important for bacterial virulence. Various isolated polypeptides, antibodies, isolated nucleic acids, vectors, and host cells that relate to the N-terminal domain of a long form bacterial phosphotransacetylase are disclosed. Further disclosed are methods of using the... Agent: Quarles & Brady LLP

20060275322 - Modified hcv peptide vaccines: Provided are an isolated peptide having the amino acid sequence DLMGYIPAV (SEQ ID NO: 1), an isolated HCV core polypeptide comprising an L→A substitution at amino acid position 139, an isolated HCV core polypeptide having the amino acid sequence of SEQ ID NO: 2, and a fragment of an HCV... Agent: National Institute Of Health C/o Needle & Rosenberg, P.C.

20060275323 - Particles of hcv envelope proteins: use for vaccination: The present invention is based on the finding that the envelope proteins of HCV induce a beneficial immune response in chronically HCV-infected chimpanzees. The immunization can preferentially be carried out using HCV envelope proteins in the form of particles which are produced in a detergent-assisted manner. The envelope proteins when... Agent: Nixon & Vanderhye, PC

20060275321 - Polypeptide antagonists of hiv-1 tat protein: Compositions and methods of using such compositions to regulate biological responses associated with binding of HIV-1 polypeptides.... Agent: Cr Miles, P.C.

20060275324 - Probiotic system for aquaculture: Probiotic bacterial strains are provided which inhibit or prevent growth or pathogenic bacteria in marine organisms. Also provided are methods of culturing marine organisms using the probiotic bacteria.... Agent: Davis Wright Tremaine, LLP

20060275327 - In vivo modulation of neuronal transport: The invention relates to means for in vivo delivery of a composition into the human or animal central nervous system or spinal cord, wherein the composition comprises a non-toxic, proteolytic fragment of tetanus toxoid in association with at least a molecule having a biological function, and said molecule is capable... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060275325 - Method for treating allodynia by peripheral administration of a neurotoxin: Methods for treating a non-spasm caused pain by peripheral administration to a patient of a therapeutically effective amount of a neurotoxin, such as a botulinum toxin.... Agent: Allergan, Inc.

20060275326 - Method for treating hyperalgesia by peripheral administation of a neurotoxin: Methods for treating a non-spasm caused pain by peripheral administration to a patient of a therapeutically effective amount of a neurotoxin, such as a botulinum toxin.... Agent: Allergan, Inc.

20060275328 - Instrument for inducing cytokine and method of inducing cytokine: It is intended to provide a novel instrument for inducing a cytokine and a method of inducing a cytokine by which a cytokine can be effectively induced compared to the existing cytokine induction therapy. Namely, an instrument for inducing a cytokine which contains a hemolytic streptococcus and/or a hemolytic streptococcus-origin... Agent: Sughrue Mion, PLLC

20060275329 - Flavin protein of trypanosoma cruzi, method of screening vermicide with the use of the same and diagnostic: It is intended to provide a method of diagnosing infection with Chagas disease by screening a trypanocidal drugs for Trypanosoma cruzi which is the pathogen of Chagas disease. Using a flavin protein TcOYE specific to Trypanosoma cruzi, a trypanocidal drugs effective against Trypanosoma cruzi is screened. Using the gene sequence... Agent: Browdy And Neimark, P.l.l.c. 624 Ninth Street, Nw

20060275330 - Pygopus in diagnosis and treatment of cancer: Expression of pygopus mRNA and Pygopus protein in established cancer cell lines and in patient tumors is described. Pygopus is shown to be a feasible diagnostic and prognostic indicator. Pygopus is also useful in cancer treatment therapy, for example in disrupting strategies that specifically target the activity of pygopus in... Agent: Smart & Biggar P.o. Box 2999, Station D

20060275331 - Pharmaceutical composition, method of manufacturing and therapeutic use thereof: The invention relates to a pharmaceutical composition prepared by freeze-drying in vacuo, containing oxaliplatin as the active component and a pharmaceutically acceptable carrier, wherein the carrier is at least one alcoholic sugar of non-animal origin, the weight ratio of oxaliplatin to the alcoholic sugar of non-animal origin or alcoholic sugars... Agent: Peter C Michalos Notaro & Michalos

20060275333 - Composition with beads for treatment of contact dermatitis: A treatment for urushiol induced pain and itching is provided for in a topical wash. A method is provided for applying, foaming, and removing a composition of substances to the effected area. The composition comprises a pramoxine compound in combination with a water-soluble nonylphenol ethoxylate and an inert foaming agent,... Agent: Jones Day

20060275332 - Cosmetic composition: A topical multiphase cosmetic composition is provided comprising co-extensive emulsion and gel phases. The phases have at least one common interface and are disposed such that the gel phase forms greater than 50% of the outer surface of the composition. The composition provides a combination of the unique sensory and... Agent: Unilever Intellectual Property Group

20060275334 - Parasiticidal composition: A parasiticidal composition comprising, as an active ingredient, at least one bioadhesive polymer and salts thereof together with at least one physiologically acceptable carrier.... Agent: Duane Morris, LLPIPDepartment

20060275335 - Pest control: A method of pest control. The method includes mass-distributing throughout a predetermined application area monolayer or multilayer structures containing a bio-active material in at least one layer thereof.... Agent: Sughrue Mion, PLLC

20060275337 - Complex coacervate core micelles as surface modification or surface treatment: Complex coacervate core micelles as surface modification or surface treatment The present invention relates to devices carrying on the surface polymeric micelles and a process for the preparation thereof. It further relates to the use of polymeric micelles as a surface coating for rendering a surface anti-fouling and/or protein-resistant. The... Agent: Jean-louis Seugnet Rhodia Inc.

20060275338 - Drug-eluting intravascular prostheses and methods of use: The present invention provides intravascular prostheses and methods of production and use. An implantable device for treating a vascular disease or disorder includes an intravascular prosthesis containing an inhibitor of smooth muscle cell proliferation and a growth factor. The device can be coated with a biodegradable drug-eluting polymer that is... Agent: Mintz, Levin, Cohn, Ferris, Glovsky And Popeo, P.C.

20060275336 - Preparation of an osteoinductive agent: This invention relates to a method for the preparation of an osteoinductive agent, the use of such an agent, and to a kit for preparing such an agent. This invention further relates to the use of the said kit in the preparation and dispensing of such an osteoinductive agent in... Agent: Nixon & Vanderhye, PC

20060275340 - Biocompatible controlled release coatings for medical devices and related methods: Biocompatible coatings for medical devices are disclosed. Specifically, polymer coatings designed to control the release of bioactive agents from medical devices in vivo are disclosed wherein the solubility parameters of polymers and drugs are closely matched to control elute rate profiles. The present application also discloses providing vascular stents with... Agent: Medtronic Vascular, Inc.IPLegal Department

20060275341 - Thin foam coating comprising discrete, closed-cell capsules: This application relates to a thin foam coating comprising discrete, closed-cell capsules. The coating may be applied to an implantable medical device, such as a stent. The closed-cell capsules each having an outer polymeric shell and an inner liquid core containing the drug. The polymeric shells degrade in vivo to... Agent: Oyen, Wiggs, Green & Mutala LLP 480 - The Station

20060275339 - Use of antiseptic active principles in pmma bone cements: The invention concerns the use of polyhexamethylene biguanide in PMMA bone cements, which preferably do not contain antibiotics. The cements exhibit a concentration of active principle not exceeding 1 wt. % relative to the total weight of the cement, which is a concentration sufficiently high to prevent microbial colonization of... Agent: The Webb Law Firm, P.C.

20060275342 - Polymerizable surfactants and their use as device forming comonomers: This invention describes the use of polymerizable surfactants at percent by weight of less than 15% as comonomers in forming ophthalmic devices such as contact lenses, intraocular lenses, corneal implants, etc.... Agent: Bausch & Lomb Incorporated

20060275343 - System for delivering a composition to the nasal membrane and method of using the same: A quick and easy system and method for delivering a composition to a nasal membrane is presented. The applicator assembly includes a sleeve member which encases a swab having a portion that contacts a gelled composition. The sleeve member is manually severed to expose the applicator and the composition. The... Agent: Snell & Wilmer

20060275345 - Collagen hydrolysate: The use of collagen hydrolysate as dietary supplement to baby food, particularly to improve the general state of health in infants and bring about a reduction in restlessness, vomiting after food intake and flatulence, is disclosed.... Agent: Leydig Voit & Mayer, Ltd

20060275344 - Flavoring of drug-containing chewing gums: A chewing gum comprising at least one active pharmaceutical ingredient (API) with a core onto which is applied at least one inner polymer film coating and thereafter onto which is applied at least one outer hard coating. A preferred API is nicotine. Flavoring agents may be incorporated in the core,... Agent: Kenneth G. Lemke Legal Division, Warner-lambert Company

20060275346 - Liquid seasoning: A liquid seasoning, comprising: (A) 3.55% by weight or less of sodium; (B) 0.5 to 4.2% by weight of potassium; and (C) 0.05 to 20% by weight of a substance having an antihypertensive effect. Salty taste is sufficiently provided despite its low sodium concentration, and pharmacological functions such as an... Agent: C. Irvin Mcclelland Oblon, Spivak, Mcclelland, Maier & Neustadt, P.C.

20060275349 - Coated antimicrobial articles: Antimicrobial articles that include a fatty acid monoester and an enhancer are described that are effective for killing at least 99.9% of microorganisms on the surface of the article.... Agent: 3m Innovative Properties Company

20060275347 - Fibrous structures comprising a polymer structure: Polymer structures and methods for making such polymer structures are provided. More particularly, polymer structures comprising a hydroxyl polymer structure, such as a fiber comprising a hydroxyl polymer are provided. Even more particularly, fibrous structures comprising a hydroxyl polymer structure, such as a fiber comprising a hydroxyl polymer, wherein the... Agent: The Procter & Gamble Company Intellectual Property Division

20060275348 - Method for preventing or treating thrombosis: A method for treating or preventing a thrombosis in a person in need thereof comprising disposing in or on an article an effective antithrombotic amount of a composition and providing the article to be in close proximity to the skin of the person, the composition comprising (i) alumina, (ii) at... Agent: Frishauf, Holtz, Goodman & Chick, PC

20060275350 - Skin dressings containing oxidoreductase enzyme: A skin dressing comprises a first dressing component (16) carrying oxidoreductase enzyme in dried condition; and a second dressing component (18) carrying a source of water, such that when the first and second dressing components are placed in fluid communication with each other, water migrates from the second component towards... Agent: Morgan Lewis & Bockius LLP

20060275352 - Device for transdermal electrotransport delivery of fentanyl and sufentanil: The invention provides an improved electrotransport drug delivery system for analgesic drugs, namely fentanyl and sufentanil. The fentanyl/sufentanil is provided as a water soluble salt (e.g., fentanyl hydrochloride), preferably in a hydrogel formulation, for use in an electrotransport device. In accordance with the present invention, a transdermal electrotransport delivered dose... Agent: Diehl Servilla LLC

20060275353 - Stable topical drug delivery compositions: A method of delivering a drug composition comprises providing a carrier having a phosphatidylcholine component and a drug entrapped therein, and applying the composition to the skin for transdermal delivery of the drug, wherein the composition is stable at room temperature.... Agent: St. Onge Steward Johnston & Reens, LLC

20060275351 - Topical oligopeptide delivery system: The invention relates to a delivery system for biologically active oligopeptides. The delivery system comprises an electrochemical cell and a skin-beneficial amount of one or more oligopeptides. In a preferred embodiment the electrochemical cell and the peptide are contained in a dermal patch. The invention also relates to a topically... Agent: The Estee Lauder Cos, Inc

20060275354 - Percutaneous absorption-type pharmaceutical preparation: A stable percutaneous absorption-type pharmaceutical preparation for percutaneous administration of drugs except for selegiline and selegiline hydrochloride, which does not suffer a decrease in the cohesive force of the adhesive layer therein even in the presence of sweat components due to perspiration during wear and which is free from cohesive... Agent: Sughrue Mion, PLLC

20060275356 - Pharmaceutical compositions for treating or preventing coronary artery disease: The present invention provides pharmaceutical compositions and methods for raising plasma levels of apolipoprotein A-I in a mammal, e.g. for treating or preventing coronary artery disease (CAD). The inventive pharmaceutical compositions comprise: (a) a negatively charged phospholipid; and (b) at least one intestinal absorption enhancer; where (a) and (b) are... Agent: Smart & Biggar P.o. Box 2999, Station D

20060275355 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated water, and the uses thereof, are provided. The obtaining method includes combining water with first oxygen, and manipulating the combined water and first oxygen into a vortex so as to cause the first oxygen to diffuse into the water and... Agent: Fleshner & Kim, LLP

20060275360 - Oral dosage forms comprising progesterone and methods of making and using the same: The present invention relates to an oral pharmaceutical dosage form comprising micronized progesterone, an edible oil, a disintegrant, and a hydrophilic excipient. Particularly, the invention relates to a pharmaceutical dosage form wherein the dosage form is in a powder form and is contained in a pharmaceutically acceptable capsule. The present... Agent: Sterne, Kessler, Goldstein & Fox PLLC

20060275357 - Organic compounds: A solid pharmaceutical composition suitable for oral administration, comprising: (a) S1P receptor agonist; and (b) a sugar alcohol.... Agent: Novartis Corporate Intellectual Property

20060275359 - Palliative effects of morinda citrifolia oil and juice: A method of preventing and treating various ailments and diseases by utilizing the Cox-2 selective inhibition characteristics of processed Morinda citrifolia.... Agent: Kirton And Mcconkie

20060275358 - Self-microemulsifying dosage forms of low solubility active ingredients such as co-enzyme q10: The invention includes dosage formulations, dosage forms and related methods for providing oral dosage forms of low solubility active ingredients such as coenzyme Q1O. The present invention includes a Self-Microemulsifying Drug Delivery System (SMEDDS) in the form of a self-microemulsifying mixture that comprises a combination of a hydrophilic surfactant and... Agent: Cardinal Health

20060275361 - Rapidly dissolving gelatin compositions and products made therefrom: Rapidly dissolving gelatin compositions and products made therefrom are disclosed. The gelatin compositions and products exhibit controllable dissolution speeds, and particularly faster dissolution times through the incorporation of one or more dissolution enhancing materials.... Agent: Hoffmann & Baron, LLP

20060275364 - Flexible solid dosage forms and methods of making and using the same: The present invention provides flexible solid dosage forms that include an active agent, gelatin, and a polyol or saccharide. The present invention also provides methods of making flexible solid dosage forms.... Agent: Sterne, Kessler, Goldstein & Fox PLLC

20060275365 - Immediate-release and high-drug-load pharmaceutical formulations of micronised (4-chlorophenyl) [4-(4-pyridylmethyl)phthalazin-1-yl] and salts thereof: The invention relates to immediate-release and high-drug-load solid pharmaceutical formulations comprising micronised (4-chlorophenyl)[4-(4-pyridylmethyl)-phthalazin-1-yl] as well as pharmaceutically acceptable salts thereof.... Agent: Millen, White, Zelano & Branigan, P.C.

20060275362 - Rapidly-dissolving pharmaceutical composition for inhibiting ovulation: A rapidly-dissolving oral dosage pharmaceutical composition for inhibiting ovulation in a mammal, said composition comprising drospirenone or a pharmaceutically acceptable salt or ester thereof, optionally ethinyl estradiol or a pharmaceutically acceptable salt, ester or ether thereof, a surfactant and at least one pharmaceutically acceptable excipient, wherein the drospirenone has a... Agent: Novartis Corporate Intellectual Property

20060275363 - Stable granulates containing s-adenosylmethionine and process for preparation thereof: A fluid bed granulation process for manufacturing non-hygroscopic, stable granulates containing a water-soluble salt of S-adenosylmethionine is described. Said process comprises: a) the simultaneous, sequential or alternate dispersion of at least a solution of a water-soluble salt of SAMe (A) and of a solution of a coating agent (B), on... Agent: Dykas, Shaver & Nipper, LLP

20060275366 - Controlled-release formulation: Controlled-release dosage formulations including at least one compound of Formulae I to XXVI herein and a controlled-release carrier and methods of treatment using the same are provided.... Agent: Schering-plough Corporation Patent Department (k-6-1, 1990)

20060275367 - Extended release formulations: The present invention relates to an extended release formulation containing a poorly water soluble active ingredient and to a method for preparing the formulation. The formulation contains a wax-based extended release material, which provides the extended release of the active ingredient.... Agent: Goodwin Procter LLP Patent Administrator

20060275368 - Biocompatible polymer: The present disclosure relates to a biocompatible polymer composition for an article comprising a surface intended to contact blood, tissue, skin, epithelial layers, wounds, cells in culture fluids, body fluids, dialysis fluids, therapeutic fluids, or mixtures thereof for removal or infusion. The invention also relates to a method for the... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060275370 - Method and compositions for treatment of epithelial damage: The present invention is directed to methods and compositions of treating or preventing epithelial lining tissue damage from dermatitis or mucositis induced by radiation exposure and/or chemotherapy, by applying to skin, mucosa or other tissues of the body an amount of a therapeutic composition which comprises a histone deacetylase inhibitor... Agent: Fish & Richardson PC

20060275369 - Orally therapeutic plastics and devices formed therefrom: The present invention provides methods whereby a thermally formable plastic is compounded with releasable active ingredients. The compounded plastic is then formed into a desired dental delivery device such as an anatomical membrane, tray or strip. The dental device is then placed in the oral environment where it will release... Agent: Geoffrey E. Dobbin, Patent Attorney

20060275371 - Hydrophobic nanotubes and nanoparticles as transporters for the delivery of drugs into cells: Methods and materials for delivering biologically active molecules to cells in vitro or in vivo are provided. The methods and materials use carbon nanotubes or other hydrophobic particles, tubes and wires, functionalized with a linking group that is covalently bound to the nanotubes, or, alternatively, to the biologically active molecule,... Agent: Peters Verny Jones & Schmitt, L.L.P.

20060275372 - Nanoparticulate imatinib mesylate formulations: The present invention is directed to a nanoparticulate compositions of imatinib mesylate, or a salt or derivative thereof, having improved pharmacokinetic profiles and reduced fed/fasted variability. The nanoparticulate imatinib mesylate particles of the composition have an effective average particle size of less than about 2000 nm and are useful in... Agent: Elan Drug Delivery, Inc. C/o Foley & Lardner LLP

20060275373 - Production of nanocapsules and microcapsules by layer-wise polyelectrolyte self-assembly: The invention relates to capsules coated with a polyelectrolyte shell and methods for the production thereof.... Agent: Fulbright & Jaworski, LLP

20060275374 - Production of nanocapsules and microcapsules by layer-wise polyelectrolyte self-assembly: The invention relates to capsules coated with a polyelectrolyte shell and methods for the production thereof.... Agent: Fulbright & Jaworski, LLP

20060275375 - Production of nanocapsules and microcapsules by layer-wise polyelectrolyte self-assembly: The invention relates to capsules coated with a polyelectrolyte shell and methods for the production thereof.... Agent: Fulbright & Jaworski, LLP

20060275376 - Microcapsules with modified release of active principles with low solubility for oral delivery: The invention concerns microcapsules for reliably modified release and adapted to industrial reproduction of an active principle hardly water-soluble, other than anti-hyperglycemia agents Each of said microcapsules comprises a core of hardly soluble active principle and a coating film applied on the core. Their mean diameter is less than 1000... Agent: Finnegan, Henderson, Farabow, Garrett & Dunner LLP

20060275377 - Soft tissue processing: The present invention is a process for preparing soft tissue such as tendons, ligaments, cartilage, fascia, dermis, human valves and human veins for implant in a human and removes cellular components and forms an decellular matrix having as major components collagens and elastins while sterilizing the tissue. The process comprises... Agent: John S. Hale Gipple & Hale

20060275380 - Composition and therapeutic uses thereof: A physiologically ingestible with microstructured water having an increased pH compared to unstructured water is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to inhibit changes in the heart rate... Agent: Fleshner & Kim, LLP

20060275382 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a vapor pressure different than double distilled water is used. The physiologically ingestible composition may be administered to reduce the amount of lactic acid/lactate produced in the muscle of a mammal undergoing stress.... Agent: Fleshner & Kim, LLP

20060275386 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a negative oxidation reduction potential of at least −40, and uses thereof are provided. The composition may further included dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to... Agent: Fleshner & Kim, LLP

20060275390 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water essentially of hydrogen and oxygen atoms, and dissolved oxygen is used. The composition may further include dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The composition may further include microstructured water having a pH of at... Agent: Fleshner & Kim, LLP

20060275391 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a melting point lower than double distilled water is used. The physiologically ingestible composition may be administered to increase the level of oxygenated hemoglobin in the blood of a mammal.... Agent: Fleshner & Kim, LLP

20060275392 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a boiling point higher than the boiling point of double distilled water is used. The physiologically ingestible composition may be administered to increase the level of oxygenated hemoglobin in the blood of a mammal.... Agent: Fleshner & Kim, LLP

20060275393 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water with an ultraviolet spectrophotometric pattern is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to inhibit changes in the heart rate of a... Agent: Fleshner & Kim, LLP

20060275394 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water with an ultraviolet spectrophotometric pattern is used. The composition may further include dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to reduce fatigue in a mammal.... Agent: Fleshner & Kim, LLP

20060275396 - Composition and therapeutic uses thereof: A physiologically ingestible with microstructured water having an increased pH compared to unstructured water is used. The composition may further include dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to reduce fatigue in a mammal.... Agent: Fleshner & Kim, LLP

20060275405 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a vapor pressure different than double distilled water is used. The physiologically ingestible composition may be administered to increase the level of oxygenated hemoglobin in the blood of a mammal.... Agent: Fleshner & Kim, LLP

20060275406 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a melting point lower than double distilled water is used. The physiologically ingestible composition may be administered to inhibit changes in the heart rate of a mammal undergoing stress.... Agent: Fleshner & Kim, LLP

20060275407 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water with an ultraviolet spectrophotometric pattern is used. The composition may further include dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to increase the level of oxygenated hemoglobin in the... Agent: Fleshner & Kim, LLP

20060275408 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water essentially of hydrogen and oxygen atoms, and dissolved oxygen is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The composition may further include microstructured water having a pH of at... Agent: Fleshner & Kim, LLP

20060275409 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms having a boiling point higher than the boiling point of double distilled water is used. The physiologically ingestible composition may be administered to reduce the amount of lactic acid/lactate produced in the muscle of a mammal... Agent: Fleshner & Kim, LLP

20060275410 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a vapor pressure different than double distilled water is used. The physiologically ingestible composition may be administered to inhibit changes in the heart rate of a mammal undergoing stress.... Agent: Fleshner & Kim, LLP

20060275411 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water essentially of hydrogen and oxygen atoms, and dissolved oxygen is used. The composition may further include dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The composition may further include microstructured water having a pH of at... Agent: Fleshner & Kim, LLP

20060275412 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a melting point lower than double distilled water is used. The physiologically ingestible composition may be administered to reduce fatigue in a mammal.... Agent: Fleshner & Kim, LLP

20060275413 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water essentially of hydrogen and oxygen atoms, and dissolved oxygen is used. The composition may further include dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The composition may further include microstructured water having a pH of at... Agent: Fleshner & Kim, LLP

20060275414 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a melting point lower than double distilled water is used. The physiologically ingestible composition may be administered to reduce the amount of lactic acid/lactate produced in the muscle of a mammal undergoing stress.... Agent: Fleshner & Kim, LLP

20060275415 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a vapor pressure different than double distilled water is used. The physiologically ingestible composition may be administered to reduce fatigue in a mammal.... Agent: Fleshner & Kim, LLP

20060275416 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a density greater than that of double distilled water is used. The composition may further include microstructured water having a cluster factor of at least 10, which may have dissolved oxygen. The physiologically ingestible composition may be administered to increase the level... Agent: Fleshner & Kim, LLP

20060275417 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water with an ultraviolet spectrophotometric pattern is used. The composition may further include dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to reduce the amount of lactic acid/lactate produced in... Agent: Fleshner & Kim, LLP

20060275418 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a boiling point higher than the boiling point of double distilled water is used. The physiologically ingestible composition may be administered to inhibit changes in the heart rate of a mammal undergoing stress.... Agent: Fleshner & Kim, LLP

20060275419 - Composition and therapeutic uses thereof: A physiologically ingestible with microstructured water having an increased pH compared to unstructured water is used. The composition may further include dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to increase the level of oxygenated hemoglobin... Agent: Fleshner & Kim, LLP

20060275422 - Composition and therapeutic uses thereof: A physiologically ingestible with microstructured water having an increased pH compared to unstructured water is used. The composition may further include dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to reduce the amount of lactic acid/lactate... Agent: Fleshner & Kim, LLP

20060275424 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a density greater than that of double distilled water is used. The composition may further include microstructured water having a cluster factor of at least 10, and may have dissolved oxygen. The physiologically ingestible composition may be administered to inhibit changes in... Agent: Fleshner & Kim, LLP

20060275427 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a density greater than that of double distilled water is used. The composition may further include microstructured water having a cluster factor of at least 10, and may have dissolved oxygen. The physiologically ingestible composition may be administered to reduce the amount... Agent: Fleshner & Kim, LLP

20060275428 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a negative oxidation reduction potential of at least −40, and uses thereof are provided. The composition may further included dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to... Agent: Fleshner & Kim, LLP

20060275432 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a negative oxidation reduction potential of at least −40, and uses thereof are provided. The composition may further included dissolved oxygen, which may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to... Agent: Fleshner & Kim, LLP

20060275436 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a density greater than that of double distilled water is used. The composition may further include microstructured water having a cluster factor of at least 10, and may have dissolved oxygen. The physiologically ingestible composition may be administered to reduce fatigue in... Agent: Fleshner & Kim, LLP

20060275446 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a boiling point higher than the boiling point of double distilled water is used. The physiologically ingestible composition may be administered to address pulmonary deficiencies of a mammal.... Agent: Fleshner & Kim, LLP

20060275449 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a density greater than that of double distilled water is used. The composition may further include microstructured water having a cluster factor of at least 10, and may have dissolved oxygen. The physiologically ingestible composition may be administered to address pulmonary deficiencies... Agent: Fleshner & Kim, LLP

20060275456 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a negative oxidation reduction potential of at least −40, and uses thereof are provided. The composition may further included dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to... Agent: Fleshner & Kim, LLP

20060275457 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water with an ultraviolet spectrophotometric pattern is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to address pulmonary deficiencies of a mammal.... Agent: Fleshner & Kim, LLP

20060275460 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a vapor pressure different than double distilled water is used. The physiologically ingestible composition may be administered to address pulmonary deficiencies of a mammal.... Agent: Fleshner & Kim, LLP

20060275461 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water essentially of hydrogen and oxygen atoms, and dissolved oxygen is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The composition may further include microstructured water having a pH of at... Agent: Fleshner & Kim, LLP

20060275462 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a vapor pressure different than double distilled water is used. The physiologically ingestible composition may be administered to reduce changes in blood oxygen saturation levels of a mammal undergoing stress.... Agent: Fleshner & Kim, LLP

20060275463 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water with an ultraviolet spectrophotometric pattern is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to heal a wound or increase a rate of... Agent: Fleshner & Kim, LLP

20060275465 - Composition and therapeutic uses thereof: A physiologically ingestible with microstructured water having an increased pH compared to unstructured water is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to reduce changes in blood oxygen saturation... Agent: Fleshner & Kim, LLP

20060275466 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water with an ultraviolet spectrophotometric pattern is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The physiologically ingestible composition may be administered to reduce changes in blood oxygen saturation levels of... Agent: Fleshner & Kim, LLP

20060275473 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a vapor pressure different than double distilled water is used. The physiologically ingestible composition may be administered to heal a wound or increase a rate of wound healing.... Agent: Fleshner & Kim, LLP

20060275479 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a melting point lower than double distilled water is used. The physiologically ingestible composition may be administered to reduce changes in blood oxygen saturation levels of a mammal undergoing stress.... Agent: Fleshner & Kim, LLP

20060275481 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water having a density greater than that of double distilled water is used. The composition may further include microstructured water having a cluster factor of at least 10, and may have dissolved oxygen. The physiologically ingestible composition may be administered to reduce changes in... Agent: Fleshner & Kim, LLP

20060275482 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water essentially of hydrogen and oxygen atoms, and dissolved oxygen is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The composition may further include microstructured water having a pH of at... Agent: Fleshner & Kim, LLP

20060275483 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a boiling point higher than the boiling point of double distilled water is used. The physiologically ingestible composition may be administered to treat infection in a mammal.... Agent: Fleshner & Kim, LLP

20060275485 - Composition and therapeutic uses thereof: A physiologically ingestible composition with microstructured water essentially of hydrogen and oxygen atoms, and dissolved oxygen is used. The composition may further include dissolved oxygen that may be present in an amount of 20 ppm to 150 ppm. The composition may further include microstructured water having a pH of at... Agent: Fleshner & Kim, LLP

20060275486 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a melting point lower than double distilled water is used. The physiologically ingestible composition may be administered to address pulmonary deficiencies of a mammal.... Agent: Fleshner & Kim, LLP

20060275487 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a melting point lower than double distilled water is used. The physiologically ingestible composition may be administered to heal a wound or increase a rate of wound healing.... Agent: Fleshner & Kim, LLP

20060275497 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a boiling point higher than the boiling point of double distilled water is used. The physiologically ingestible composition may be administered to heal a wound or increase a rate of wound healing.... Agent: Fleshner & Kim, LLP

20060275501 - Composition and therapeutic uses thereof: A physiologically ingestible composition comprising microstructured water consisting essentially of hydrogen and oxygen atoms and having a vapor pressure different than double distilled water is used. The physiologically ingestible composition may be administered to treat infection in a mammal.... Agent: Fleshner & Kim, LLP

20060275378 - Culture media and methods of making and using culture media: Micro-clustered liquids, methods of manufacture and use. Culture media and cultures comprising micro-clustered water; use of micro-clustered culture media and cultures for cell, tissue and organ maintenance and growth; use in microbial biotechnology.... Agent: Procopio, Cory, Hargreaves & Savitch LLP

20060275502 - Electrolyzed water treatment for feminine hygiene: Embodiments of the present invention provide for methods of cleaning and disinfecting the vaginal area using electrolyzed water. The electrolyzed water may be applied to both the interior and exterior of the vaginal area. A particularly preferred embodiment provides for the application of Type C water to the vaginal area.... Agent: Bracewell & Giuliani LLP

20060275421 - Microstructured water having altered melting point: A composition includes microstructured water having a melting point lower than double distilled water. The composition may include dissolved oxygen. The dissolved oxygen may be present in an amount greater than 20 ppm. The microstructured water may have a cluster size of 6-8 molecules, and may have a cluster factor... Agent: Fleshner & Kim, LLP

20060275420 - Microstructured water having altered vapor pressure: A composition includes microstructured water having a lower vapor pressure than that of double distilled water measured under the same conditions. The composition may include dissolved oxygen. The dissolved oxygen may be present in an amount greater than 20 ppm. The microstructured water may have a cluster size of 6-8... Agent: Fleshner & Kim, LLP

20060275472 - Microstructured water having uv absorption: A composition includes microstructured water having an ultraviolet spectrophotometric pattern comprising a major absorbancy from 185 nm to 250 nm. The composition may include dissolved oxygen. The dissolved oxygen may be present in an amount greater than 20 ppm. The microstructured water may have a cluster size of 6-8 molecules,... Agent: Fleshner & Kim, LLP

20060275379 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water produced by spinning water and oxygen, and uses thereof are provided. The super-oxygenated and structured water is obtained by receiving preconditioned water, combining the preconditioned water with oxygen, passing the preconditioned water/oxygen combination through a cone system... Agent: Fleshner & Kim, LLP

20060275381 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to a desired frequency, and uses thereof are provided. The method includes passing water through a magnetic flux in a spiral-type manner to tune the water to a desired frequency. The water may be passed through the magnetic flux... Agent: Fleshner & Kim, LLP

20060275383 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using oxygenated water, and uses thereof are provided. The oxygenated water is obtained by combining water and oxygen, and manipulating the combined water and oxygen into a vortex so as to cause the oxygen to diffuse into the water. Water and structured... Agent: Fleshner & Kim, LLP

20060275384 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water produced by spinning water and oxygen, and uses thereof are provided. The super-oxygenated and structured water is obtained by receiving preconditioned water, combining the preconditioned water with oxygen, passing the preconditioned water/oxygen combination through a cone system... Agent: Fleshner & Kim, LLP

20060275385 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to a desired frequency, and uses thereof are provided. The method includes passing water through a magnetic flux in a spiral-type manner to tune the water to a desired frequency. The water may be passed through the magnetic flux... Agent: Fleshner & Kim, LLP

20060275387 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by preparing water with a negative oxidation reduction potential (ORP), and the uses thereof, are provided. The obtaining method includes preconditioning water received from a water source for electrolysis, performing electrolysis on the preconditioned water, and outputting alkaline water and/or acidic water with... Agent: Fleshner & Kim, LLP

20060275388 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by water preconditioned for electrolysis and the uses thereof are provided. The matter is obtained by using water obtained by adding ozone to the water, and passing the water through a magnetic flux. The processing of water may further include filtering water received... Agent: Fleshner & Kim, LLP

20060275389 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The super-oxygenated and structured water is produced by receiving water from a source, preconditioning the water for electrolysis, performing electrolysis on the preconditioned water to produce alkaline water, combining the alkaline water... Agent: Fleshner & Kim, LLP

20060275395 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to a desired frequency, and uses thereof are provided. The method includes passing water through a magnetic flux in a spiral-type manner to tune the water to a desired frequency. The water may be passed through the magnetic flux... Agent: Fleshner & Kim, LLP

20060275397 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The super-oxygenated and structured water is produced by receiving water from a source, preconditioning the water for electrolysis, performing electrolysis on the preconditioned water to produce alkaline water, combining the alkaline water... Agent: Fleshner & Kim, LLP

20060275398 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to target certain pathologies in mammals, and uses thereof are provided. The tuned water is produced by passing the water through a plurality of coil sets in fluid communication. The tuned water may be used for producing and tuning... Agent: Fleshner & Kim, LLP

20060275399 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to a desired frequency, and uses thereof are provided. The method includes passing water through a magnetic flux in a spiral-type manner to tune the water to a desired frequency. The water may be passed through the magnetic flux... Agent: Fleshner & Kim, LLP

20060275400 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water produced by spinning water and oxygen, and uses thereof are provided. The super-oxygenated and structured water is obtained by receiving preconditioned water, combining the preconditioned water with oxygen, passing the preconditioned water/oxygen combination through a cone system... Agent: Fleshner & Kim, LLP

20060275401 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water produced by spinning water and oxygen, and uses thereof are provided. The super-oxygenated and structured water is obtained by receiving preconditioned water, combining the preconditioned water with oxygen, passing the preconditioned water/oxygen combination through a cone system... Agent: Fleshner & Kim, LLP

20060275402 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using tuned super-oxygenated and structured water having multiple attributes, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil... Agent: Fleshner & Kim, LLP

20060275403 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by preparing water with a negative oxidation reduction potential (ORP), and the uses thereof, are provided. The obtaining method includes preconditioning water received from a water source for electrolysis, performing electrolysis on the preconditioned water, and outputting alkaline water and/or acidic water with... Agent: Fleshner & Kim, LLP

20060275404 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by water preconditioned for electrolysis and the uses thereof are provided. The matter is obtained by using water obtained by adding ozone to the water, and passing the water through a magnetic flux. The processing of water may further include filtering water received... Agent: Fleshner & Kim, LLP

20060275423 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil system with structured ozone,... Agent: Fleshner & Kim, LLP

20060275425 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using oxygenated water, and uses thereof are provided. The oxygenated water is obtained by combining water and oxygen, and manipulating the combined water and oxygen into a vortex so as to cause the oxygen to diffuse into the water. Water and structured... Agent: Fleshner & Kim, LLP

20060275426 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The super-oxygenated and structured water is produced by receiving water from a source, preconditioning the water for electrolysis, performing electrolysis on the preconditioned water to produce alkaline water, combining the alkaline water... Agent: Fleshner & Kim, LLP

20060275429 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by water preconditioned for electrolysis and the uses thereof are provided. The matter is obtained by using water obtained by adding ozone to the water, and passing the water through a magnetic flux. The processing of water may further include filtering water received... Agent: Fleshner & Kim, LLP

20060275430 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using oxygenated water, and uses thereof are provided. The oxygenated water is obtained by combining water and oxygen, and manipulating the combined water and oxygen into a vortex so as to cause the oxygen to diffuse into the water. Water and structured... Agent: Fleshner & Kim, LLP

20060275431 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using tuned super-oxygenated and structured water having multiple attributes, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil... Agent: Fleshner & Kim, LLP

20060275433 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to target certain pathologies in mammals, and uses thereof are provided. The tuned water is produced by passing the water through a plurality of coil sets in fluid communication. The tuned water may be used for producing and tuning... Agent: Fleshner & Kim, LLP

20060275434 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using tuned super-oxygenated and structured water having multiple attributes, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil... Agent: Fleshner & Kim, LLP

20060275435 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The super-oxygenated and structured water is produced by receiving water from a source, preconditioning the water for electrolysis, performing electrolysis on the preconditioned water to produce alkaline water, combining the alkaline water... Agent: Fleshner & Kim, LLP

20060275437 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to target certain pathologies in mammals, and uses thereof are provided. The tuned water is produced by passing the water through a plurality of coil sets in fluid communication. The tuned water may be used for producing and tuning... Agent: Fleshner & Kim, LLP

20060275438 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using tuned super-oxygenated and structured water having multiple attributes, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil... Agent: Fleshner & Kim, LLP

20060275439 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using oxygenated water, and uses thereof are provided. The oxygenated water is obtained by combining water and oxygen, and manipulating the combined water and oxygen into a vortex so as to cause the oxygen to diffuse into the water. Water and structured... Agent: Fleshner & Kim, LLP

20060275440 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by preparing water with a negative oxidation reduction potential (ORP), and the uses thereof, are provided. The obtaining method includes preconditioning water received from a water source for electrolysis, performing electrolysis on the preconditioned water, and outputting alkaline water and/or acidic water with... Agent: Fleshner & Kim, LLP

20060275441 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil system with structured ozone,... Agent: Fleshner & Kim, LLP

20060275442 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by water preconditioned for electrolysis and the uses thereof are provided. The matter is obtained by using water obtained by adding ozone to the water, and passing the water through a magnetic flux. The processing of water may further include filtering water received... Agent: Fleshner & Kim, LLP

20060275443 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by preparing water with a negative oxidation reduction potential (ORP), and the uses thereof, are provided. The obtaining method includes preconditioning water received from a water source for electrolysis, performing electrolysis on the preconditioned water, and outputting alkaline water and/or acidic water with... Agent: Fleshner & Kim, LLP

20060275444 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil system with structured ozone,... Agent: Fleshner & Kim, LLP

20060275445 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil system with structured ozone,... Agent: Fleshner & Kim, LLP

20060275447 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated water, and the uses thereof, are provided. The obtaining method includes combining water with first oxygen, and manipulating the combined water and first oxygen into a vortex so as to cause the first oxygen to diffuse into the water and... Agent: Fleshner & Kim, LLP

20060275448 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to a desired frequency, and uses thereof are provided. The method includes passing water through a magnetic flux in a spiral-type manner to tune the water to a desired frequency. The water may be passed through the magnetic flux... Agent: Fleshner & Kim, LLP

20060275450 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using tuned super-oxygenated and structured water having multiple attributes, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil... Agent: Fleshner & Kim, LLP

20060275451 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by preparing water with a negative oxidation reduction potential (ORP), and the uses thereof, are provided. The obtaining method includes preconditioning water received from a water source for electrolysis, performing electrolysis on the preconditioned water, and outputting alkaline water and/or acidic water with... Agent: Fleshner & Kim, LLP

20060275452 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil system with structured ozone,... Agent: Fleshner & Kim, LLP

20060275453 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The super-oxygenated and structured water is produced by receiving water from a source, preconditioning the water for electrolysis, performing electrolysis on the preconditioned water to produce alkaline water, combining the alkaline water... Agent: Fleshner & Kim, LLP

20060275454 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to target certain pathologies in mammals, and uses thereof are provided. The tuned water is produced by passing the water through a plurality of coil sets in fluid communication. The tuned water may be used for producing and tuning... Agent: Fleshner & Kim, LLP

20060275455 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by preparing water with a negative oxidation reduction potential (ORP), and the uses thereof, are provided. The obtaining method includes preconditioning water received from a water source for electrolysis, performing electrolysis on the preconditioned water, and outputting alkaline water and/or acidic water with... Agent: Fleshner & Kim, LLP

20060275458 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using oxygenated water, and uses thereof are provided. The oxygenated water is obtained by combining water and oxygen, and manipulating the combined water and oxygen into a vortex so as to cause the oxygen to diffuse into the water. Water and structured... Agent: Fleshner & Kim, LLP

20060275459 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to a desired frequency, and uses thereof are provided. The method includes passing water through a magnetic flux in a spiral-type manner to tune the water to a desired frequency. The water may be passed through the magnetic flux... Agent: Fleshner & Kim, LLP

20060275464 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil system with structured ozone,... Agent: Fleshner & Kim, LLP

20060275467 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by water preconditioned for electrolysis and the uses thereof are provided. The matter is obtained by using water obtained by adding ozone to the water, and passing the water through a magnetic flux. The processing of water may further include filtering water received... Agent: Fleshner & Kim, LLP

20060275468 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to target certain pathologies in mammals, and uses thereof are provided. The tuned water is produced by passing the water through a plurality of coil sets in fluid communication. The tuned water may be used for producing and tuning... Agent: Fleshner & Kim, LLP

20060275469 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The super-oxygenated and structured water is produced by receiving water from a source, preconditioning the water for electrolysis, performing electrolysis on the preconditioned water to produce alkaline water, combining the alkaline water... Agent: Fleshner & Kim, LLP

20060275470 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water produced by spinning water and oxygen, and uses thereof are provided. The super-oxygenated and structured water is obtained by receiving preconditioned water, combining the preconditioned water with oxygen, passing the preconditioned water/oxygen combination through a cone system... Agent: Fleshner & Kim, LLP

20060275471 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to target certain pathologies in mammals, and uses thereof are provided. The tuned water is produced by passing the water through a plurality of coil sets in fluid communication. The tuned water may be used for producing and tuning... Agent: Fleshner & Kim, LLP

20060275475 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using tuned super-oxygenated and structured water having multiple attributes, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil... Agent: Fleshner & Kim, LLP

20060275476 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using oxygenated water, and uses thereof are provided. The oxygenated water is obtained by combining water and oxygen, and manipulating the combined water and oxygen into a vortex so as to cause the oxygen to diffuse into the water. Water and structured... Agent: Fleshner & Kim, LLP

20060275477 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to a desired frequency, and uses thereof are provided. The method includes passing water through a magnetic flux in a spiral-type manner to tune the water to a desired frequency. The water may be passed through the magnetic flux... Agent: Fleshner & Kim, LLP

20060275478 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water produced by spinning water and oxygen, and uses thereof are provided. The super-oxygenated and structured water is obtained by receiving preconditioned water, combining the preconditioned water with oxygen, passing the preconditioned water/oxygen combination through a cone system... Agent: Fleshner & Kim, LLP

20060275480 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil system with structured ozone,... Agent: Fleshner & Kim, LLP

20060275484 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using oxygenated water, and uses thereof are provided The oxygenated water is obtained by combining water and oxygen, and manipulating the combined water and oxygen into a vortex so as to cause the oxygen to diffuse into the water. Water and structured... Agent: Fleshner & Kim, LLP

20060275488 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using tuned super-oxygenated and structured water having multiple attributes, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil... Agent: Fleshner & Kim, LLP

20060275489 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The tuned super-oxygenated and structured water is produced by receiving oxygen enriched water into a coil system and passing the water therethrough, combining water output by the coil system with structured ozone,... Agent: Fleshner & Kim, LLP

20060275490 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by water preconditioned for electrolysis and the uses thereof are provided. The matter is obtained by using water obtained by adding ozone to the water, and passing the water through a magnetic flux. The processing of water may further include filtering water received... Agent: Fleshner & Kim, LLP

20060275491 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water produced by spinning water and oxygen, and uses thereof are provided. The super-oxygenated and structured water is obtained by receiving preconditioned water, combining the preconditioned water with oxygen, passing the preconditioned water/oxygen combination through a cone system... Agent: Fleshner & Kim, LLP

20060275492 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water, and uses thereof are provided. The super-oxygenated and structured water is produced by receiving water from a source, preconditioning the water for electrolysis, performing electrolysis on the preconditioned water to produce alkaline water, combining the alkaline water... Agent: Fleshner & Kim, LLP

20060275493 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using oxygenated water, and uses thereof are provided. The oxygenated water is obtained by combining water and oxygen, and manipulating the combined water and oxygen into a vortex so as to cause the oxygen to diffuse into the water. Water and structured... Agent: Fleshner & Kim, LLP

20060275494 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by water preconditioned for electrolysis and the uses thereof are provided. The matter is obtained by using water obtained by adding ozone to the water, and passing the water through a magnetic flux. The processing of water may further include filtering water received... Agent: Fleshner & Kim, LLP

20060275495 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using super-oxygenated and structured water produced by spinning water and oxygen, and uses thereof are provided. The super-oxygenated and structured water is obtained by receiving preconditioned water, combining the preconditioned water with oxygen, passing the preconditioned water/oxygen combination through a cone system... Agent: Fleshner & Kim, LLP

20060275496 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to a desired frequency, and uses thereof are provided. The method includes passing water through a magnetic flux in a spiral-type manner to tune the water to a desired frequency. The water may be passed through the magnetic flux... Agent: Fleshner & Kim, LLP

20060275498 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by preparing water with a negative oxidation reduction potential (ORP), and the uses thereof, are provided. The obtaining method includes preconditioning water received from a water source for electrolysis, performing electrolysis on the preconditioned water, and outputting alkaline water and/or acidic water with... Agent: Fleshner & Kim, LLP

20060275499 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by using water tuned to target certain pathologies in mammals, and uses thereof are provided. The tuned water is produced by passing the water through a plurality of coil sets in fluid communication. The tuned water may be used for producing and tuning... Agent: Fleshner & Kim, LLP

20060275500 - Processed water and therapeutic uses thereof: A physiologically ingestible composition of matter obtained by preparing water with a negative oxidation reduction potential (ORP), and the uses thereof, are provided. The obtaining method includes preconditioning water received from a water source for electrolysis, performing electrolysis on the preconditioned water, and outputting alkaline water and/or acidic water with... Agent: Fleshner & Kim, LLP

20060275474 - System for preparing oxygenated water with a stable negative oxidation reduction potential (orp): A system for preparing oxygenated water with a stable negative oxydation reduction potential (ORP) is provided. The system includes a water preconditioning system configured to receive water from a water source and output water preconditioned for electrolysis and an electrolysis device in fluid communication with the water preconditioning system and... Agent: Fleshner & Kim, LLP

20060275503 - Combination treatment with strontium for the prophylaxis and/or treatment of cartilage and/or bone conditions: A combination treatment, wherein a strontium-containing compound together with one or more active substances capable of reducing the incidence of bone fracture and/or increasing bone density and/or improving healing of fractured bone and/or improving bone quality are administered for use in the treatment and/or prophylaxis of cartilage and/or bone conditions.... Agent: Thomas G Rowan Jones Day

20060275504 - Methods and compositions for augmenting cancer chemotherapeutic agents: This invention provides methods and pharmaceutical compositions/therapy combination product for cancer treatment and/or augmenting the effectiveness of cancer chemotherapeutic agents by use of a combination of ascorbic acid and vitamin K3.... Agent: Ladas & Parry

20060275506 - Compositions, methods and kits for enhancing weight loss while inhibiting loss of lean body mass: Disclosed are combinations of soy protein, chromium and free leucine in amounts effective to inhibit the loss of lean body mass of a subject under conditions of caloric restriction. The soy protein, chromium and free leucine can be administered in several products, including a powder that is mixable into a... Agent: Klarquist Sparkman, LLP

20060275505 - Method and composition for increasing the alkalinity of the body: A composition for increasing alkalinity in the body containing water, a source of alkalinity, and silicon.... Agent: Laubscher & Laubscher, P.C.

20060275507 - Composition for preventive treatment of cold sores: The invention relates to a composition for the preventive treatment of fever blisters, including recurring fever blisters, wherein a composition, which comprises a physical UV filter, a zinc salt