FREE patent keyword monitoring and additional FREE benefits. /images/triangleright (1K) REGISTER now for FREE triangleleft (1K)
Fresh Patents freshpatentsnav7_icons (5K)
browse patent apps by agents browse patent apps by inventors browse patent apps by industry browse patents by location monitor patent applications
    




USPTO Class 514  |  Browse by Industry: Previous - Next | All     monitor keywords
10/2006 | Recent  |  09: Oct | Sept | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan |  | 08: Dec | Nov | Oct | Sp | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan |  | 07: Dec  | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan |  | 06: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | 

Drug, bio-affecting and body treating compositions inventions 10/06

Recently published patent applications awaiting approval from the USPTO. Recent week's RSS XML file available below.
Listing format for abstract view: USPTO application #, Title, Abstract excerpt,Patent Agent. Listing format for list view: USPTO National Class full category number, title of the patent application.   10/26/2006 > patent applications in patent subcategories.

20060241015 - Cancer genes: The present invention relates to all facets of novel polynucleotides, the polypeptides they encode, antibodies and specific binding partners thereto, and their applications to research, diagnosis, drug discovery, therapy, clinical medicine, forensic science and medicine, etc. The polynucleotides are differentially expressed in prostate and breast cancers and are therefore useful...

20060241016 - Extraction process: A process for isolating low molecular weight (“LMW”) peptides from tissue in situ comprising the steps: a) homogenizing the tissue; b) mixing the homogenized tissue with an organic solvent to form a fully-wetted slurry; c) standing or agitating the slurry to denature the proteins in situ within the tissue; d)...

20060241017 - Novel compounds with high therapeutic index: The present invention is directed to novel therapeutic compounds comprised of an amino acid bonded to a medicament or drug having a hydroxy, amino, carboxy or acylating derivative thereon. These high therapeutic index derivatives have the same utility as the drug from which they are made, and they have enhanced...

20060241018 - Linkers for radiopharmaceutical compounds: A new and improved method for extending the half life of pharmaceutical compounds for use in diagnostic imaging or therapy uses a novel linker to attach a diagnostic or therapeutic moiety to a targeting peptide or another diagnostic or therapeutic moiety. The resulting compound may have the general formula M-N-O-P-Q,...

20060241019 - Long lasting insulin derivatives and methods thereof: The present invention relates to an insulin derivative comprising an insulin molecule and a reactive group for covalently bonding a blood component, wherein preferably the insulin molecule is human natural insulin molecule and the reactive group is coupled to an amino acid of the insulin molecule at a position selected...

20060241021 - Methods of treating cognitive dysfunction by modulating brain energy metabolism: Methods for treating cognitive dysfunction by modulating brain energy metabolism are discussed....

20060241020 - Protein tyrosine phosphatase inhibitors: The invention relates to phosphopeptides inhibiting protein tyrosine phosphatases, and their uses....

20060241025 - Biodegradable glucosamine-muramyl peptides for apoptosis modulation: The present invention includes apoptosis modulating glucosamine-muramyl-peptides, obtained by specific endopeptidase digestion of gram positive bacteria, methods of preparation of thereof and medical food compositions for management and treatment of conditions caused by TNF alpha cytotoxicity....

20060241024 - Intermediate for preparing glycopeptide derivatives: This invention provides 9-fluorenylmethoxycarbonyl compounds that are useful as intermediates for preparing glycopeptide antibiotics....

20060241023 - Methods for alleviating deleterious effects of 3-deoxyglucosone: Disclosed is a class of compounds which inhibit the enzymatic conversion of fructose-lysine into fructose-lysine-3-phosphate in an ATP dependent reaction in a recently discovered metabolic pathway. According to the normal functioning of this pathway, fructose-lysine-3-phosphate (FL3P) is broken down to form free lysine, inorganic phosphate and 3-deoxyglucosone (3DG), the latter...

20060241022 - Selectin targeting bioconjugates: The present invention provides novel compositions comprising one or more selectin binding molecule covalently linked to a hydrophilic polymer, pharmaceutical compositions thereof, and methods for their use in treating anti-inflammatory disorders....

20060241026 - Novel cyclic peptides and use thereof as anti-microbial agents: The invention relates to compounds selected from: peptides having formula (1): C(s)—X1—X2—X3—X4—X5—X6—X7-C(s), wherein the two cysteine residues are linked by means of a disulphide bridge which is represented by symbol C(s) and X1, X2, X3X4, X5, X6 and X7 denote amino acids selected from a determined list; and derivatives of...

20060241039 - Amino acid-substituted coagulation factor v: There is provided FV derivatives that reduce blood clotting activity, by reducing thrombin generation, when compared to wild-type FV. In particular, the FV of the present invention comprises single-point and multi-point mutations, encompassed by aspartic acid 79 to glutamic acid 119. The derivatives can be used to treat patient with...

20060241031 - Assay: An assay method for an anti-bacterial agent comprising: (a) providing as a first component protein SIC; (b) providing as a second component an antibacterial peptide; (c) contacting the first component with a test substance in the presence of the second component; and (d) determining the interaction or activity of the...

20060241043 - Bacillus cry9 family members: The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of Bacillus thuringiensis encoding δ-endotoxins having pesticidal activity against insect pests, including Lepidoptera. Particular embodiments of the invention provide isolated nucleic acids encoding pesticidal proteins, pesticidal compositions, expression cassettes, and transformed microorganisms and plants comprising a nucleic...

20060241044 - Bacillus cry9 family members: The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of Bacillus thuringiensis encoding δ-endotoxins having pesticidal activity against insect pests, including Lepidoptera. Particular embodiments of the invention provide isolated nucleic acids encoding pesticidal proteins, pesticidal compositions, expression cassettes, and transformed microorganisms and plants comprising a nucleic...

20060241042 - Calcineurin activators: A calcineurin activator, comprising the following protein (a) or (b) as an active ingredient and having the action of increasing intracellular calcium ion concentration through the influx of calcium ions into eukaryotic cells: (a) a killer protein (KLKP), being composed of 3 subunits consisting of amino acid sequences represented by...

20060241037 - Compositions comprising trefoil factor family peptides and/or mucoadhesives and proton pump ihhibitor prodrugs: Disclosed are methods of preventing or treating a disease or adverse condition affecting the gastrointestinal tract of a mammal which comprise orally administering to a mammal a therapeutically effective amount of a prodrug of a proton pump inhibitor and an effective amount of a trefoil family factor peptide, mucoadhesive agent,...

20060241047 - Fsh formulation: This invention relates to FSH or a FSH variant containing an alpha and beta subunit contained in formulations, and articles of manufacture. The invention provides advantageous new proteins and nucleic acids, multi-use pharmaceutical solutions, formulations and products of said proteins and nucleic acids where none approved for commercial use had...

20060241041 - Fvii or fviia gla domain variants: Gla domain variants of human Factor VII or human Factor VIIa, comprising 1-15 amino acid modifications relative to human Factor VII or human Factor VIIa, wherein a hydrophobic amino acid residue has been introduced by substitution in position 34; or having an amino acid substitution in position 36; and use...

20060241027 - Hiv inhibiting proteins: The invention relates to proteins comprising HIV fusion inhibiting peptides, such as T-20 and/or T-1249 peptides (including, but not limited to, fragments and variants thereof), which exhibit anti-retroviral activity, fused to albumin (including, but nbot limited to fragments or variants of albumin). These fusion proteins are herein collectively referred to...

20060241029 - Hypocretin administration as a treatment for obesity: The invention provides compositions and methods for treatment and prophylaxis of weight disorders. Such methods entail administering to an individual a therapeutically or prophylactically effective dosage regime of a hypocretin or an agonist thereof, and monitoring the condition of the individual responsive to the administering....

20060241030 - Irs modulators: This invention is directed to a general method for the chronic treatment, potential cure, or prevention of various metabolic and related diseases in people, including diabetes, by modulating IRS2 activity in cells and tissues in the body. IRS1 and IRS2 are part of the insulin or insulin-like growth factor signaling...

20060241046 - Linear gamma-carboxyglutamate rich conotoxins: The invention relates to linear y-carboxyglutamate rich conotoxins, derivatives or pharmaceutically acceptable salts thereof, and uses thereof, including the treatment of neurologic and psychiatric disorders, such as anticonvulsant agents, as neuroprotective agents or for the management of pain. The invention further relates to nucleic acid sequences encoding the conopeptides and...

20060241033 - Markers for pre-cancer and cancer calls and the method to interfere with cell proliferation therein: A novel family of human mitochondrial RNAs, referrred to as chimeric RNAs, which are differentially expressed in normal, pre-cancer and cancer cells, are described. Oligonucleotides targeted to the chimeric RNAs are provided. The described oligonucleotides or their analogs can be used for cancer diagnostics and cancer therapy as well as...

20060241034 - Means for preventing and treating cellular death and their biological applications: Inhibitors for preventing, blacking/silencing caspase-2 activity in cell death....

20060241045 - Method for producing preparation containing bioactive substance: A method for producing a preparation containing a bioactive substance, characterized in that it comprises forming a solid material containing the bioactive substance and a polymer, and contacting the solid material with a high pressure gas. The method allows the production of a preparation which is suppressed in excessive initial...

20060241040 - Methods of treating disorders associated with toll-like receptor 4 (tlr4) signalling: Described herein are methods and compositions for treating, preventing, and diagnosing disorders associated with TLR4 signalling, e.g., gram negative bacterial infection and sterile inflammations such as rheumatoid arthritis....

20060241032 - Rgd-enriched gelatine-like proteins with enhanced cell binding: The invention concerns a cell support comprising an RGD-enriched gelatine that has a more even distribution of RGD sequences than occurring in a natural gelatine and with a minimum level of RGD sequences. More precise the percentage of RGD sequences related to the total number of amino acids is at...

20060241036 - Soluble human interleukin 18 receptor-alpha, method of assaying the same, assay kit and medicinal composition: [PROBLEMS] To confirm the presence of a solubilized human IL-18 receptor-α by a novel ELISA method and provide an assay kit and a medicinal composition containing the solubilized human IL-18 receptor-α as the active ingredient. [MEANS FOR SOLVING PROBLEMS] A solubilized human interleukin-18 receptor-α, a method of assaying the solubilized...

20060241038 - Therapeutic agent for abeta related disorders: The present invention provides a pharmaceutical composition comprising at least one member selected from a compound capable of enhancing Aβ37 production, a compound capable of inhibiting Aβ40 and Aβ42 production and enhancing Aβ37 production, and salts of the compounds and hydrates thereof....

20060241028 - Use of compounds having the biological activity of vasoactive intestinal peptide for the treatment of sarcoidosis: The present invention relates to peptides which arm highly biologically and pharmacologically active as therapeutic drug for the treatment of diseases related to sarcoidosis. The peptides which can be used according to the invention for the treatment of said disease comprise at least one specific highly conservative amino acid residue...

20060241035 - Use of dg153 secreted protein products for preventing and treating pancreatic disease and/or obesity and/or metabolic syndrome: The present invention discloses proteins secreted by the developing pancreas, and polynucleotides, which identify and encode these proteins. The invention also relates to the use of these sequences in the diagnosis, study, prevention, and treatment of pancreatic diseases (e.g. diabetes), obesity, and/or metabolic syndrome....

20060241050 - Inhibiting furin with polybasic peptides: Small, polybasic peptides are disclosed that are effective as furin inhibitors, e.g. hexa- to nona-peptides having L-Arg or L-Lys in most positions. Removing the peptide terminating groups can improve inhibition of furin. High inhibition was seen in a series of non-amidated and non-acetylated polyarginines. The most potent inhibitor identified to...

20060241048 - Modified therapeutic agents: The invention provides a modified therapeutic agent, said modified agent comprising three or more membrane binding elements with low membrane affinity covalently associated with the agent which elements are capable of interacting independently and with thermodynamic additivity, with components of cellular or artificial membranes exposed to extracellular fluids wherein at...

20060241049 - Use of thrombin-derived peptides for the therapy of chronic dermal ulcers: Disclosed is a method of promoting healing of a chronic dermal skin ulcer, such as a diabetic ulcer, on a subject. The method comprises the step of contacting the chronic dermal skin ulcer with an effective amount of an agonist of the non-proteolytically activated thrombin receptor....

20060241052 - Facially amphiphilic polymers and oligomers, compositions thereof, and use thereof in methods of treating cancer: The present invention discloses compositions of facially amphiphilic polymers and oligomers and their use in methods for treating or reducing cancers in humans or animals....

20060241051 - Metastin derivatives and use thereof: The present invention provides a metastin derivative in which the amino acids comprising metastin were modified by alternative chemical substituents resulting in metastin derivitives, having excellent blood stability and exhibiting cancer metastasis inhibiting action or cancer growth inhibiting action....

20060241053 - Compounds and their analgesic applications: Application of peptides with analgesic properties as the active ingredient in devices for the direct application of medication to the site of their expected analgesic activity, particularly in the central nervous system....

20060241054 - Growth hormone-releasing peptides in the treatment of prevention of atherosclerosis and hypercholesterolemia: According to the invention there is provided a method of treatment or prophylaxis of atherosclerosis, hypercholesterolemia or a cardiovascular disease associated with atherosclerosis, which method comprises administration of one or more Growth Hormone Releasing Peptides (GHRPs) to a patient in need of such treatment or prophylaxis. There are also provided...

20060241055 - Peptides promoting cell adherence, growth and secretion: The present invention provides specific peptides identified as having cell adhesion, growth, expression or secretion-enhancing activities. Many of the peptides of the invention may be produced in large quantity by such means as chemical synthesis or recombinant DNA methodology. They may be non-specifically adsorbed, or chemically attached to a surface...

20060241056 - Potent and specific immunoproteasome inhibitors: Compounds and methods of selectively inhibiting an immunoproteasome are described. Also described are methods of treating a cancer, an inflammation, and/or an autoimmune disease and methods of suppressing endogenous antigenic peptide generation by administering to a subject in need of treatment thereof a therapeutic amount of an immunoproteasome specific inhibitor....

20060241057 - Peptidyl allyl sulfones: The present disclosure provides compositions for inhibiting proteases, methods for synthesizing the compositions, and methods of using the disclosed protease inhibitors. Aspects of the disclosure include peptidyl allyl sulfone compositions that inhibit proteases, for example cysteine proteases, either in vivo or in vitro....

20060241058 - Acetyl l-carnitine for prevention of painful peripheral neuropathy in patients with type 2 diabetes: Acetyl L-carnitine, or of one of its pharmaceutically acceptable salts, is useful for the prevention of painful peripheral neuropathy in patients suffering from type 2 diabetes, in which symptoms are pain, paraesthesia or hyperaesthesia. The acetyl L-carnitine is administered orally at a dose of at least 3 grams/day....

20060241059 - Treatments for viral infections: The present invention relates to improved methods and compositions for treating viral infections and other diseases and conditions that induce a cytokine storm. More particularly, the present invention relates to novel compositions comprising quercitin, and an anti-convulsant, such as phenytoin, in combination with mulivitamins as an anti-viral composition and methods...

20060241060 - 10-substituted macrolide antibiotics: The invention provides antibiotic 10-desmethyl macrolides....

20060241061 - Stable aqueous solution of natamycin fungicide: The present invention provides an aqueous composition comprising—water; —a water miscible solvent; —and a polyene fungicide which is dissolved in the water and water miscible solvent. The present invention further provides a method for the production of the composition of the invention. The composition of the invention may be used...

20060241062 - Method involving pde4, compositions, and the screening thereof, for the treatment of degenerative ocular pathologies: The invention relates to the field of biology, genetics and medicine. In particular, the invention relates to novel methods for the detection, characterization and/or treatment (or management) of neurodegenerative pathologies. The invention also relates to methods for the identification or screening of compounds active in the aforementioned pathologies. The invention...

20060241063 - Novel uses of neuraminidase inhibitors in infectious diseases: The present invention relates to methods of decreasing the infectivity, morbidity and rate of mortality, in treating diseases associated with a variety of pathogenic organisms, specifically diseases involving one or more pathogens that require neuraminidase as a virulence factor. In addition, the present invention uses biology based therapy to treat...

20060241064 - Nucleoside compounds for treating viral infections: Disclosed are compounds, compositions and methods for treating viral infections caused by a Flaviviridae family virus, such as hepatitis C virus....

20060241065 - Ring-expanded nucleosides and nucleotides: The present invention relates to compositions comprising analogues of purine nucleosides containing a ring-expanded (“fat”) heterocyclic ring, in place of purine, and an unmodified or modified sugar residue, pharmaceutically acceptable derivatives of such compositions, as well as methods of use thereof. In particular, these compositions may be utilized in the...

20060241070 - Antisense oligonucleotides directed to ribonucleotide reductase r2 and uses thereof in the treament of cancer: The present invention provides antisense oligonucleotides directed to a mammalian ribonucleotide reductase R2 gene and combinations of the antisense oligonucleotides with one or more chemotherapeutic agents for use in the treatment of cancer....

20060241066 - Decoy composition for treating and preventing inflammatory disease: It is intended to efficiently treat an inflammatory disease without causing side effects. This object can be achieved by providing a medicinal composition for treating and preventing an inflammatory disease and disorders, and disorders caused by the disease and disorders which contains at least one decoy of NF-κB or an...

20060241071 - Functional synthetic molecules and macromolecules for gene delivery: The present invention describes a synthetic non-viral vector composition for gene therapy and the use of such compositions for in vitro, ex vivo and/or in vivo transfer of genetic material. The invention proposes a pharmaceutical composition containing 1) a non-cationic amphiphilic molecule or macromolecule and its use for delivery of...

20060241073 - Means and methods for counteracting fatty acid accumulation: The invention provides a method for, at least, in part, counteracting a disease involving accumulation of a fatty acid, the method comprising administering a compound which is capable of inducing and/or upregulating omega-oxidation of the fatty acid, or whose metabolite is capable of inducing and/or upregulating omega-oxidation of the fatty...

20060241067 - Methods for inhibiting angiogenesis, cell migration, cell adhesion, and cell survival: The invention relates to methods for detecting and inhibiting angiogenesis, cell migration, cell adhesion, and/or cell survival in endothelial and non-endothelial cells as well as in normal and tumor cells. The invention further relates to methods for screening test compounds for their ability to inhibit angiogenesis, cell migration, cell adhesion,...

20060241074 - Methods for treatment of pain: The present invention relates to a method for the treatment or prevention of pain by administering to an animal an agent that decreases the activity of the complement cascade....

20060241076 - Modified oligoribonucleotide analogs with enhanced immunostimulatory activity: The invention provides immunostimulatory compositions and methods for their use. In particular, the immunostimulatory compositions of the invention include RNA-like polymers that incorporate an immunostimulatory sequence motif and at least one chemical modification to confer improved stability against nuclease degradation and improved activity. Specific modifications involving phosphate linkages, nucleotide analogs,...

20060241068 - Novel actin-associated cytosekeltone protein lacs: The present invention provides the novel actin-related cytoskeletal protein LACS and genes encoding the protein....

20060241072 - Oligomeric compounds for use in gene modulation: The present invention provides modified oligomeric compounds and compositions of oligomeric compounds for use in the RNA interference pathway of gene modulation. The modified oligomeric compounds include siRNA and asRNA having at least one affinity modification. The present invention also provides methods for modulating gene expression using the modified oligomeric...

20060241075 - Rna interference mediated inhibition of desmoglein gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating Desmoglein (e.g, DSG1, DSG2, DSG3, and/or DSG4) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways of...

20060241069 - Treatment of hyperproliferative disease: A short interfering RNA (siRNA) duplex that includes complementary sense and anti-sense sequences corresponding to at least part of the A3 adenosine receptor (A3AR) mRNA sequence, a double-stranded RNA (dsRNA) construct that can be converted within a cell into a siRNA duplex and a transcript system that can induce transcription...

20060241077 - Methods and compositions for ameliorating or inhibiting decline in memory or intelligence or improving same: The present invention is directed to methods of ameliorating hippocampal dysfunction and improving or inhibiting decline in intelligence or cognitive or hippocampal-dependent memory of a subject and of increasing synthesis and release of neurotransmitters, neurite outgrowth, and levels of neurofilament proteins in the brain and CNS of a subject, comprising...

20060241078 - Pharmaceutical compositions comprising a contraceptive agent in solution and a teratogen: The present invention relates to pharmaceutical compositions comprising an estrogen and a progestin in solution, and a teratogen suspended in the estrogen and progestin solution. The present invention also relates to methods of making and using the pharmaceutical compositions described herein....

20060241079 - Use of beta glucans for the treatment of osteoporosis and other diseases of bone resorption: The invention provides methods of using beta glucans to treat conditions associated with bone loss or low bone density as well as methods for promoting bone growth in situations where enhanced bone growth is desirable. In the invention methods beta glucans are administered so as to enhance the development of...

20060241080 - Glycerophospholipids containing omega-3 and omega-6 fatty acids and their use in the treatment and improvement of cognitive functions: Disclosed herein is a lipid preparation, said preparation comprising a phosphatidylserine moiety, and poly-unsaturated fatty acid (PUFA) acyl groups, particularly long-chain poly-unsaturated fatty acid (LC-PUFA) acyl groups such as omega-3 and/or omega-6 acyl groups, wherein said PUFA is covalently bound to said glycerophospholipid. Said lipid preparations are particularly useful in...

20060241081 - Novel compounds and methods for therapy: s

20060241082 - Modulating vesicular monoamine transporter trafficking and function: a novel approach for the treatment of parkinson's disease: Disclosed are compositions and methods for treating Parkinson's disease....

20060241083 - Novel heteroaryl phosphonates as cardioprotective agents: This invention teaches a-substituted phosphonates, their preparation, pharmaceutical compositions thereof, biologically acceptable salts thereof, and methods for treating various disorders using such compositions....

20060241084 - Inhibition of vascular endothelial growth factor: This invention relates to therapeutic organic compounds and inhibition of secretion of vascular endothelial growth factor (VEGF) and its effects, including angiogenesis....

20060241085 - Compounds having anti-proliferative properties: There is a provided a method of inhibiting the occurrence of one of more of the following conditions: —the proliferation of monocytes/macrophages; or —the proliferation of smooth muscle cells; or —the expression of CD36 receptors; or —the uptake of oxidized LDL, the method comprising the step of administering an effective...

20060241086 - Calcium salt of myo-inositol 1,6:2,3:4,5 tripyrophosphate as an allosteric effector of hemoglobin: The present invention relates to various salts of inositol tripyrophosphate including the calcium, lithium, beryllium, magnesium, potassium, strontium, barium, rubidium and cesium salts of inositol tripyrophosphate, compositions comprising these salts, methods of making the various salts, and methods of use of the above salts. Methods of use include administering the...

20060241087 - Phosphonates useful as modulators of t $g(g)9$g(d)2 lymphocyte activity: The invention concerns novel phosphonate derivatives, preparation method, use thereof as ligands modulating T γ9δ2 lymphocyte activity and pharmaceutical compositions comprising them....

20060241089 - Dipyridamole, acetylsalicylic acid, and angiotensin ii antagonist pharmaceutical compositions: A pharmaceutical composition comprising a therapeutically effective amount of: (a) dipyridamole or a pharmaceutically acceptable salt thereof; (b) acetylsalicylic acid; and (c) an angiotensin II antagonist, kits containing these three compounds, and methods for preventing stroke or reducing the risk of stroke or secondary stroke in a patient in need...

20060241088 - Oxylipins from long chain polyunsaturated fatty acids and methods of making and using the same: Disclosed are novel oxylipins, referred to herein as docosanoids, that are derived from C22 polyunsaturated fatty acids, and method of making and using such oxylipins. Also disclosed is the use of docosapentaenoic acid (C22:5n-6) (DPAn-6), docosapentaenoic acid (C22:5n-3) (DPAn-3), and docosatetraenoic acid (DTAn-6: C22:4n-6) as substrates for the production of...

20060241090 - Use of 2-methylene-19-nor-20(s)-1alpha,25dihydroxyvitamin d3 to increase the life expectancy of human beings: This invention provides pharmaceutical uses for 2-methylene-19-nor-20(S)-1α,25-dihydroxyvitamin D3. Administration of this compound increases the life expectancy of human beings, especially elderly human beings. In particular, it increases the survival rate of females lacking estrogen, especially post-menopausal females, and reduces mortality resulting from spontaneous development of malignant tumors in both males...

20060241092 - Contraceptive regimens for lower-weight women: The present invention discloses methods of providing contraception to a female based on the body weight of the female. According to the methods provided, the body weight of the female is determined and a contraceptive regimen is selected based on the female's body weight. The selected contraceptive regimen is then...

20060241091 - Extended estrogen dosing contraceptive regimen: A method of contraception that provides for sequentially administering to a female of child bearing age: (a) a first composition containing a progestin in an amount equivalent to about 0.3 to about 1.5 mg norethindrone acetate and an estrogen in an amount equivalent to about 5 to about 20 mcg...

20060241093 - Use of dhea derivatives for enhancing physical performance: A method is disclosed for administering a DHEA derivative or a physiologically acceptable salt, ester or ether thereof for one of decreasing body weight, reducing adipose tissue, increasing endurance, as an anti-aging compound and generating production of red blood cells....

20060241094 - Compositions that modulate the activity of estrogen receptors and estrogen-related receptors and methods for use: Disclosed are compositions for treating an estrogen receptor (ER) or estrogen related receptor (ERR) mediated disorder, comprising a therapeutically effective amount of a compound selected from the group consisting of Compound Nos. 1-9, 7-2, 7-4, 7-5, 7-7, 7-8, 8-2 and 3-15 set forth herein or a pharmaceutically acceptable salt thereof,...

20060241095 - Orally bioavailable low molecular weight metalloporphyrins as antioxidants: The invention relates to compounds which are orally bioavailable water soluble metalloporphyrins. These compounds, e.g. represented by Structural Formula (I): wherein R1 and R2 are each independently lower alkyl, cycloalkyl, halogen substituted alkyl or substituted or unsubstituted phenyl groups, are synthetic catalytic scavengers of reactive oxygen chemical species. The invention...

20060241096 - Agent for preventing or treating organ functional disorders and organ dysfunction: The present invention provides an agent for preventing or treating organ functional disorders, an agent for preventing or treating organ dysfunction and an agent for preventing or treating obesity and deuteropathy thereof, each of which comprises a compound having an effect of increasing ubiquinone or a salt thereof or a...

20060241098 - Pesticidal n-substituted azacyclic derivatives: Pesticidal compositions comprising a pesticidally effective amount of an N-substituted azacyclic derivative of the formula (I); wherein R, an N-substituted azacycle, and V, Q, X, T and U are defined, as well as their agriculturally acceptable salts, in admixture with at least one agriculturally acceptable extender or adjuvant are disclosed....

20060241097 - Pesticidal substituted 1,2,5-thiadiazole derivatives: Insecticidal and acaricidal compositions comprising an insecticidally or acaricidally effective amount of a 1,2,5-thiadiazole of the formula (I); wherein R, Q and m are as defined in admixture with at least one agriculturally acceptable extender or adjuvant are disclosed. In addition, methods of controlling insects and acarids comprising applying said...

20060241100 - Acylaminobicyclic heteroaromatic compounds and uses thereof: s

20060241099 - Use of 2-thia-dibenzo[e,h]azulenes for the manufacture of pharmaceutical formulations for the treatment and prevention of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of 2-thia-dibenzo[e,h]azulenes and of their pharmacologically acceptable salts and solvates for the manufacture of a pharmaceutical formulation for the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the...

20060241101 - Novel benzimidazole derivatives and pharmaceutical compositions comprising these compounds: The present invention relates to novel benzimidazole derivatives of the formula (I) as defined in the description and in the claims, pharmaceutical compositions containing these compounds, and methods of treatment therewith. The compounds of the invention are useful in the treatment of central nervous system diseases and disorders, which are...

20060241102 - Medicinal compositions: The present invention provides pharmaceutical compositions, which are useful for treatment of depression and the like, and which comprises a compound having an adenosine A2A receptor antagonistic activity such as (E)-8-(3,4-dimethoxystyryl)-1,3-diethyl-7-methyl-3,7-dihydro-1H-purine-2,6-dione or a pharmaceutically acceptable salt thereof and an antidepressant drug (for example, a tricyclic antidepressant, a tetracyclic antidepressant, a...

20060241103 - Inhibitors of ftsz and uses thereof: The invention relates to inhibitors of FtsZ polymerization and uses thereof....

20060241104 - Oxalamide derivatives as kinase inhibitors: e

20060241105 - Pesticidal 1-ayl-3-amidoxime-pyrazole derivatives:

20060241107 - Androgen receptor modulators and methods of use thereof: Compounds of structural formula (I) as herein defined are disclosed as useful in a method for modulating the androgen receptor in a tissue selective manner in a patient in need of such modulation, as well as in a method of agonizing the androgen receptor in a patient, and in particular...

20060241106 - Isoxazole compounds as inhibitors of heat shock proteins: Isoxazoles of formula (A) or (B) are inhibitors of HSP90 activity, and useful for treatment of, for example cancers: (A), (B) wherein R1, is a group of formula (IA): —Ar1-(Alk1)p-(Z)r-(Alk2)s-Q, wherein in any compatible combination Ar1 is an optionally substituted aryl or heteroaryl radical, Alk1 and Alk2 are optionally substituted...

20060241108 - Substituted phenoxazines and acridones as inhibitors of akt: The invention provides compositions and methods that modulate the activity of AKT family kinase proteins, including AKT1, AKT2 and AKT3 (also referred to as PKBα, PKBβand PKBγ). Specifically, the invention provides a number of phenoxazine and acridone compounds that inhibit AKT phosphorylation and kinase activity. The invention provides compositions for...

20060241109 - Pgd2 receptor antagonists for the treatment of inflammatory diseases: e

20060241111 - Aroyl semicarbazide derivatives against thromboembolic diseases: Novel compounds of the formula (I) in which Het, R1, R2 and R3 have the meaning indicated in Patent claim 1, are inhibitors of coagulation factor Xa and can be employed for the prophylaxis and/or therapy of thromboembolic diseases and for the treatment of tumours....

20060241110 - Compounds, compositions, and methods: Certain substituted urea derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, are useful in the treatment of systolic heart failure including congestive heart failure....

20060241112 - Kinase inhibitors: r

20060241113 - Polyarylcarboxamides useful as lipid lowering agents:

20060241114 - Derivatives of azasugars as anticancer agents: Certain derivatives of azasugars, useful in the treatment of cancer, are presented. This invention also relates to pharmacological compositions containing the compounds of present invention and treatment of cancer, including tumor or other neoplasm, with an azasugar....

20060241116 - 3-heteroaryl-3,5-dihydro-4-oxo-4h-pyridazino[4,5-b]indole-1-carboxamide derivatives, their preparation and therapeutic use: in which X represents a hydrogen or halogen atom; R1 represents a hydrogen atom or a (C1-C4)alkyl group; R2 and R3 each represent, independently of one another, a hydrogen atom or a (C1-C4)alkyl group or else R2 and R3 form, with the nitrogen atom which carries them, a pyrrolidinyl, piperidinyl,...

20060241115 - Compounds and methods of use: Selected compounds are effective for prophylaxis and treatment of diseases, such as HGF mediated diseases. The invention encompasses novel compounds, analogs, prodrugs and pharmaceutically acceptable salts thereof, pharmaceutical compositions and methods for prophylaxis and treatment of diseases and other maladies or conditions involving, cancer and the like. The subject invention...

20060241117 - Therapeutic agents useful for treating pain: where Ar1, Ar2, X, Z1, Z2, R3, and m are as disclosed herein or a pharmaceutically acceptable salt thereof (a “Pyridylene Compound”); compositions comprising an effective amount of a Pyridylene Compound; and methods for treating or preventing pain or other conditions in an animal comprising administering to an animal in...

20060241118 - Hydroxamate sulfonamides as cd23 shedding inhibitors: A class of piperazine and related heterocyclic derivatives, substituted at the 4-position by a substituted aryl or heteroaryl moiety, and at the 1-position by an ethylsulfonyl group which in turn is substituted at the 2-position by a hydroxamic acid moiety and also by a range of alternative substituents, being potent...

20060241119 - Thio-substituted tricyclic and bicyclic aromatic methanesulfinyl derivatives: wherein Ar, Y, R1 and q are as defined herein; and their use in the treatment of diseases, including treatment of sleepiness, promotion of wakefulness, treatment of Parkinson's disease, cerebral ischemia, stroke, sleep apneas, eating disorders, stimulation of appetite and weight gain, treatment of attention deficit hyperactivity disorder (“ADHD”), enhancing...

20060241120 - Cannabinoid receptor ligands and uses thereof: Compounds of Formula (I) that act as cannabinoid receptor ligands and their uses in the treatment of diseases linked to the mediation of the cannabinoid receptors in animals are described herein....

20060241121 - Substituted piperazines as cb1 antagonists: m

20060241122 - Combination therapy for the treatment of neoplasms: The invention features compositions, methods, and kits for the treatment of neoplasms....

20060241123 - Substituted piperidine and piperazine derivatives as melanocortin-4 receptor modulators: The present invention relates to novel substituted piperidine and piperazine derivatives as melanocortin-4 receptor (MC-4R) modulators. MC-4R agonists of the invention can be used for the treatment of disorders and diseases such as obesity, diabetes, and sexual dysfunction, whereas the MC-4R antagonists are useful for the treatment of disorders and...

20060241124 - Combinations comprising paroxetine and 2- (s) - (4-fluoro-2-methyl-phenyl) -piperazine-1-carboxylic acid [1- (r)- (3,5-bis-trifluoro-2-methyl-phenyl) -ethyl]-methyl amide for treatment of depression and/or anxiety: The present invention relates to therapeutic combinations comprising paroxetine or physiologically acceptable salts or solvates thereof and 2-(S)-(4-Fluoro-2-methyl-phenyl)-piperazine-1-carboxylic acid [1-(R)-(3,5-bis-trifluoromethyl-phenyl)-ethyl]-methyl-amide or physiologically acceptable salts or solvates thereof, to pharmaceutical compositions containing said combinations and their use in the treatment of depression and/or anxiety....

20060241125 - Compounds useful in therapy: e

20060241126 - Pyrimidinone derivatives and their use in the treatment of atherosclerosis:

20060241127 - Heteroaryloxy-substituted phenylaminopyrimidines as rho-kinase inhibitors: The invention relates to heteroaryloxy-substituted phenylaminopyrimidines, to methods for the production thereof, and to the use of the same for producing medicaments for the treatment and/or prophylaxis of diseases, especially cardiovascular diseases. The inventive compounds inhibit Rho-Kinase....

20060241128 - Substituted 6-(2-halogennphenyl)-triazolopyrimidines: e

20060241130 - Anti-inflammatory compositions and uses thereof: Methods of treating medical conditions associated with inflammation employing compounds capable of inhibiting an activity and/or a formation of an oxidant associated with the inflammation, pharmaceutical composition and inhalation devices containing such compounds are provided. Further provided are methods of identifying drug candidates for treating inflammation-associated medical conditions by inhibiting...

20060241129 - Novel class of cytodifferentiating agents and histone deacetylase inhibitors, and methods of use thereof: wherein each of R1 and R2 is, substituted or unsubstituted, aryl, cycloalkyl, cycloalkylamino, naphtha, pyridineamino, piperidino, t-butyl, aryloxy, arylalkyloxy, or pyridine group; wherein A is an amido moiety, —O—, —S—, —NH—, or —CH2—; and wherein n is an integer from 3 to 8. The present invention also provides a method...

20060241131 - Pyrrolo[2,3-d]pyrimidine compounds: wherein R1, R2 and R3 are as defined above, which are inhibitors of the enzyme protein kinases such as Janus Kinase 3 and as such are useful therapy as immunosuppressive agents for organ transplants, xeno transplation, lupus, multiple sclerosis, rheumatoid arthritis, psoriasis, Type I diabetes and complications from diabetes, cancer,...

20060241133 - Electrically variable pneumatic structural element: There is disclosed the use of a compound of formula (I): or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for the treatment of age-related cognitive decline or mild cognitive impairment, in particular with a view to preventing or delaying the onset of Alzheimer's disease....

20060241132 - Spiro derivatives and adhesion molecule inhibitors comprising the same as active ingredient: Since the spiro acid derivatives according to the present invention are excellent in the effect of inhibiting cell adhesion via adhesion molecules, especially adhesion molecule VLA-4, they are useful as therapeutic drugs against various inflammatory diseases. For example, provided are the spiro derivative and the adhesion molecule inhibitor which includes...

20060241134 - Pharmaceutical combinations of a proton pump inhibitor and a compound which modifies gastrointestinal motility: The invention relates to the combination of certain active compounds from the acid pump antagonist class and compounds which modify gastrointestinal motility....

20060241135 - Opiod receptor agonist compounds and their use in treatment of pain: Structurally novel opioid receptor agonists are provided, and the use of these agonists in treatment of chronic and/or acute pain....

20060241136 - Pharmaceutical composition combining tenatoprazole and a histamine h2-receptor antagonist: The invention relates to a novel pharmaceutical combination. The inventive pharmaceutical composition, which is intended for the treatment of pathologies linked to gastric hyperacidity, comprises a combination of tenatoprazole and one or more histamine H2-receptor antagonists preferably selected from cimetidine, ranitidine, famotidine and nizatidine. The invention is particularly suitable for...

20060241137 - Triazole compounds and the therapeutic use thereof: The invention relates to triazole compounds of general formula (I), wherein A, B, R1, R2, R3 and R4 have the meaning cited in claim 1. The invention also relates to a pharmaceutical agent containing at least one compound of general formula (I) in addition to the use of the compound...

20060241138 - Heterocyclic amide derivatives for the treatment of diabetes and other diseases: e

20060241139 - Treatment of dna damage related disorders: The present invention provides methods and compositions for prophylaxis and treatment of a variety of disorders including DNA damage related disorders, cancer, ischemia, oxidative stress, atherosclerosis, and stroke using a chloroquine compound....

20060241140 - Imidazolamino compounds: The invention relates to novel imidazolamino compounds. Also disclosed are methods of treating cancer by using one of these compounds and pharmaceutical compositions containing one of these compounds....

20060241141 - Use of pyridin-2-ylmethylamine derivatives for the production of a medicament for the treatment of chronic pain symptoms of neuropathological or psychogenic origin: This invention relates to a treatment of chronic pain symptoms, especially of neuropathological or psychogenic origin, with pyridin-2-yl methylamine derivatives or pharmaceutically acceptable additive salts thereof....

20060241142 - Naphthamide derivatives and their use: i

20060241143 - Combination of paroxetine and 2-methoxy-5-(5-trifluoromethyl-tetrazol-1-yl-benzyl)-(2s-phenyl-piperidin-3s-yl)-amine for treatment of depression and/or anxiety: The present invention relates to therapeutic combinations comprising paroxetine or physiologically acceptable salts or solvates thereof and 2-methoxy-5-(5-trifluoromethyl-tetrazol-1-yl-benzyl)]-(2S-phenyl-piperidin-3S-yl)-amine or physiologically acceptable salts or solvates thereof, to pharmaceutical compositions containing said combinations and their use in the treatment of depression and/or anxiety....

20060241144 - Method for treating apathy syndrome: The present invention provides a method of treating apathy syndrome in a human subject. The human subject is first evaluated to determine whether one or more behavioral characteristics of apathy are observed. If such characteristics are observed, the subject is treated with a 2-oxopyrrolidine compound, such as nefiracetam, piracetam, aniracetam,...

20060241146 - Nitrogen-containing 5-membered ring compound: e

20060241145 - Piperidine derivative crystal, process for producing the same, and use:

20060241148 - Fluorinated pyridine n-oxide thrombin modulators and process for n-oxidation of nitrogen containing heteroaryls:

20060241147 - Pyridine derivatives useful for inhibiting sodium/calcium exchange system:

20060241149 - Chemical compounds: Pyridinyl-benzoheterocycyl kinase inhibitor compounds are disclosed. Also disclosed are methods of making such compounds as well as methods of using the same in the treatment of diseases....

20060241150 - P38 kinase inhibitor compositions and methods of using the same: Methods of treating an individual who has been identified as having been infected with HIV are disclosed. Methods of treating an individual who is suspected of having been exposed to HIV are disclosed. Some methods disclosed comprise the step of administering to the individual an amount of a p38 inhibitor...

20060241151 - Pyrid-2-one derivatives and methods of use: Selected compounds are effective for treatment of diseases, such as cell proliferation or apoptosis mediated diseases. The invention encompasses novel compounds, analogs, prodrugs and pharmaceutically acceptable derivatives thereof, pharmaceutical compositions and methods for prophylaxis and treatment of diseases and other maladies or conditions involving stroke, cancer and the like. The...

20060241152 - Imidazoline derivatives having cb1-antagonistic activity: l

20060241153 - Benzamides and related inhibitors of factor xa: Novel benzamide compounds including their pharmaceutically acceptable isomers, salts, hydrates, solvates and prodrug derivatives having activity against mammalian factor Xa are described. Compositions containing such compounds are also described. The compounds and compositions are useful in vitro or in vivo for preventing or treating coagulation disorders....

20060241154 - Benzotropolone derivatives and modulation of inflammatory response: v

20060241155 - Tnf-alpha production inhibitors:

20060241156 - Preparation of epothilone derivatives:

20060241157 - Heterocyclic ppar modulators: The present invention is directed to compounds represented by the following structural formula, Formula I: wherein: (a) X is selected from the group consisting of a single bond, O, S, S(O)2 and N; (b) U is an aliphatic linker; (c) Y is selected from the group consisting of O, C,...

20060241158 - Zolmitriptan crystal forms: The invention encompasses novel crystalline forms of zolmitriptan herein defined as Form B, D, C, E, F, G, H, I, J, K, M, N, O, P, Q, R, S, or Amorphous and to methods of making thereof. The invention also encompasses methods of making zolmitriptan crystalline Form A....

20060241159 - Zolmitriptan crystal forms: The invention encompasses novel crystalline forms of zolmitriptan herein defined as Form B, D, C, E, F, G, H, I, J, K, M, N, O, P, Q, R, S, or Amorphous and to methods of making thereof. The invention also encompasses methods of making zolmitriptan crystalline Form A....

20060241160 - Zolmitriptan crystal forms: The invention encompasses novel crystalline forms of zolmitriptan herein defined as Form B, D, C, E, F, G, H, I, J, K, M, N, O, P, Q, R, S, or Amorphous and to methods of making thereof. The invention also encompasses methods of making zolmitriptan crystalline Form A....

20060241161 - Process for preparing losartan potassium with improved flowability: Provided is a method of improving the flowability of losartan potassium powder having an initial Hausner ratio of 1.45 or more, which method includes reslurrying the losatrtan potassium in a reslurry solvent....

20060241162 - Optically active (r)-hydantoin derivative: (R)-(+)-5-hydroxy-1-methylhydantoin is an optically active substance having an excellent suppressive action of the progression of renal failure. At an administration to a model animal of renal failure, (R)-(+)-5-hydroxy-1-methylhydantoin significantly suppresses an increase of creatinine in blood as compared with the S-form and the racemate, and shows an excellent suppressive action...

20060241163 - Optically active (s)-hydantoin derivative: (S)-(−)-5-hydroxy-1-methylhydantoin is useful as a drug having high safety. Since the compound of the present invention, (S)-(−)-5-hydroxy-1-methylhydantoin, rarely changes to the metabolite having high toxicity compared with the R-form and the racemate, it is preferred as an agent for renal failure especially when used for chronic renal insufficiency in a...

20060241164 - Pharmacological treatment for sleep apnea: The present invention relates generally to pharmacological methods for the prevention or amelioration of sleep-related breathing disorders via administration of agents or combinations of agents that possess serotonin-related pharmacological activity....

20060241165 - Method and kit for regulation of microvascular tone: Methods and kits for regulating arterial microvascular tone in which a COX-2 inhibitor and a cannabinoid receptor agonist are co-administered to a subject....

20060241166 - Sapphyrins and uses thereof: The present invention relates to compounds of Formula (I): their pharmaceutical composition and their utility in treating neoplasm....

20060241167 - Crystalline form of fluvastatin sodium: A novel crystalline form of Fluvastatin sodium hydrate is described, referred to hereinafter as polymorphic Form G. Furthermore, processes for the preparation of this crystalline form and pharmaceutical compositions comprising this crystalline form are reported....

20060241168 - Antidepressant: wherein ring A: an optionally substituted benzene ring; ring B: an optionally substituted 5- to 7-membered nitrogen-containing heterocycle; R4: an aliphatic hydrocarbon group substituted with an aromatic group and further optionally substituted, or an acyl group containing an aromatic group; R5: H, C1-6 alkyl or acyl; R4c: an aromatic group,...

20060241169 - Crystalline forms of [r-(r*.r*)]-2-(4-fluorophenyl)-beta,delta-dihydroxy-5-(1-methylethyl)-3-phenyl-4-[(phenylamino)carbonyl]-1h-pyrrole-1-heptanoic acid calcium salt (2:1): Novel crystalline forms of [R-(R*,R*)]-2-(4-fluorophenyl)-β,δ-dihydroxy-5-(1-methylethyl)-3-phenyl-4-[(phenylamino)carbonyl]-1H-pyrrole-1-heptanoic acid hemi calcium salt designated Form V, Form VI, Form VII, Form VIII. Form IX, Form X, Form XI, Form XII, Form XIII, Form XIV, Form XV, Form XVI, Form XVII, Form XVIII, and Form XIX are characterized by their X-ray powder diffraction, solid-state NMR,...

20060241170 - Methods and formulations of taxanes: In accordance with the present invention, there are provided compositions and methods useful for the in vivo delivery of a pharmaceutically active agent, wherein the agent is associated with a polymeric biocompatible material....

20060241171 - Novel physiologically active substances: (wherein, R3, R6, R7 and R21 are the same as or different from one another and each represents a hydroxyl group etc.), a pharmacologically acceptable salt thereof or a hydrate of them. The compound (I) of the present invention suppresses angiogenesis, in particular, suppresses VEGF production in a hypoxic condition...

20060241172 - Benzodioxane and benzodioxolane derivatives and uses thereof: wherein each of R1, R2, R3, R4, y, n, m, and Ar are as defined, and described in classes and subclasses herein, which are agonists or partial agonists of the 2C subtype of brain serotonin receptors. The compounds, and compositions containing the compounds, can be used to treat a variety...

20060241173 - Compound: The present invention relates to sulphamate compounds that are an inhibitor of both oestrone sulphatase activity and aromatase activity....

20060241175 - Vehicle for topical delivery of anti-inflammatory compounds: A vehicle for topical delivery which contains a liquid eutectic mixture of hydrophobic compounds....

20060241174 - Vitamin e tocotrienols inhibition of intracellularly obligate pathogen chlamydia and methods of use: This invention reveals the beneficial use of vitamin E tocotrienols for inhibition of chlamydial infections. Chlamydial infection levels in mouse macrophages treated with tocotrienol were decreased >50%, with concomitant aberrant pathogen development. The number of large and small inclusions in tocotrienol-versus-control cells was decreased 3-fold and 2-fold, respectively. When treated...

20060241176 - Dihydrobenzofuran derivatives and uses thereof: i

20060241177 - Novel compounds, pharmaceutical compositions containing same, and methods of use for same: Pharmaceutical composition comprising a pharmaceutical diluent and a compound of formula IX: R29═H, or C1-C20 alkyl, cycloalkyl, alkenyl, aryl, arylalkyl, or alkylaryl, ═CHR31, —C(O)OR31, —C(O)R31, —CH2C(O)OR31, CH2C(O)NHR31, where R31 is H or C1-C10 alkyl, cycloalkyl, or alkenyl; R30═C1-C20 alkyl, cycloalkyl, alkenyl, aryl, arylalkyl, or alkylaryl; X5═—OR32, or NHR32, Where R32...

20060241178 - Compositions and methods for treating lung cancer: The invention is directed to methods and compositions of inhibiting lung tumorigenesis. Such method involves the administration of an isothiocyanate conjugate at the post-initiation stage of tumor growth, while avoiding the drawbacks of toxicity of the parent compounds....

20060241179 - Biphenylcarboxylic amide derivatives as p38 kinase inhibitors: e

20060241180 - Selective androgen receptor modulators and methods of use thereof: This invention provides a class of androgen receptor targeting agents (ARTA). The compounds are selective androgen receptor modulators (SARM) useful for, inter-alia, suppressing spermatogenesis, treating a subject having a hormone related condition, treating a subject suffering from prostate cancer, delaying the progression of prostate cancer, preventing the recurrence of prostate...

20060241181 - Alpha-ketoglutarates of active ingredients and compositions containing same: Novel stable and pharmacologically acceptable salts of L-carnitine and lower alkanoyl L-carnitines with alpha-ketoglutaric acid are disclosed as well as the compositions useful as dietary and dietetic supplements, nutraceuticals or drugs containing same....

20060241182 - Antibiotic, functional cosmetic and functional food containing levulinic acid and their derivatives: The present invention relates to antibiotics, functional cosmetics and functional foods comprising levulinic acid or its derivatives as effective ingredients. More particularly, the present invention relates to antibiotics comprising levulinic acid or its derivatives having antibiotic activities against various microorganisms including Gram positive bacteria, Gram negative bacteria, yeast and drug-resistant...

20060241183 - Compositions and methods of using d-dopa to treat parkinson's disease: A method of treating Parkinson's disease by administering the racemic mixture of D,L-DOPA in combination with both peripheral amino acid decarboxylase and catechol, O-methyltransferase (COMT) inhibitors in pharmaceutically acceptable salts forms and effective doses for the treatment of Parkinson's disease. Alternatively, D-DOPA is administered in combination with both peripheral amino...

20060241184 - Medicament for treatment of nocturia: A method for therapeutic treatment of nocturia which comprises administering to a mammal, including a human in need of such treatment, a therapeutically effective amount of loxoprofen or a pharmacologically acceptable salt thereof....

20060241185 - Antibiotics targeting mreb: The identification of MreB as essential for bacterial chromosome segregation provides a new target for antibiotic action. The MreB function is useful in the development of screening assays for new antibiotics, which may use, for example, genetic mutants in MreB, tests of MreB mediated chromosome segregation, and the like. In...

20060241186 - Alkylating agent combinations in the treatment of cancer: This application provides compositions and methods useful in the treatment of certain cancers. In part, this application is based on the recognition that certain molecules that target abasic lesions or AP sites in DNA improve, augment, or potentiate the chemotherapeutic efficacy of certain anticancer agents....

20060241187 - Compound with antitumor activity and preparation method therefor: The present invention provides the diaminophenyladamantane derivatives with antitumor activities and the preparation method therefore. The method includes a step of reacting an aromatic diol with at least one 5-halo-2-nitrophenol in the presence of at least one inorganic base in an organic solvent with a relatively high boiling point....

20060241188 - Treatment of pervasive developemental disorders with norepinephrine reuptake inhibitors: Provided are methods and medicaments for treating a Pervasive Developmental Disorder, comprising administering to a patient in need of such treatment an effective amount of a selective norepinephrine reuptake inhibitor....

20060241189 - Sertraline hydrochloride polymorphs: The present invention is directed to forms II, III, V, VI, VII, VIII, IX and X of sertraline hydrochloride and novel methods for their preparation. According to the present invention, sertraline hydrochloride polymorph II may be produced by slurrying sertraline hydrochloride polymorph VI in aprotic organic solvent. Sertraline hydrochloride polymorphic...

20060241191 - Crystalline levosalbutamol sulphate and polymorphic forms thereof: The invention provides three polymorphic forms of crystalline levosalbutamol sulphate designated herein as Forms I, II and III. Crystalline levosalbutamol sulphate Form I is characterised by a powder XRD pattern with peaks at 10.8, 11.9, 13.0, 18.3, 28.5±0.2 degrees 2 theta. Crystalline levosalbutamol sulphate Form II is characterised by a...

20060241190 - Keratolytic composition with anti-allergic anti-inflammatory properties: A product with an enhanced medicinal and cosmetic composition with a specific utility of “Psoriasis, Eczema and like skin disorders application” is characterized by the fact that it comprises active agents and ingredients as vanilla extract, ammonium chloride, potassium chloride and quaternary ammonium compound having formulated at a specific pH...

  
10/19/2006 > 181 patent applications in 114 patent subcategories.

20060234904 - Method for preparing polymorphism of irinotecan hydrochloride: A method for preparing a novel crystalline polymorphic irinotecan hydrochloride which is excellent in the solubility in water and reduced in the content of impurities is provided. A method for preparing c-type crystals of irinotecan hydrochloride having diffraction peaks (2θ) at 9.15°, 10.00°, 11.80°, 12.20°, 13.00° and 13.40° in the...

20060234907 - Albumin solution and process for the production thereof: (c) optionally one or more stabilizers selected from the group of sugars, amino acids and sugar alcohols are added, with the proviso that no indole stabilizer and no C6-C10 fatty acid is employed as said stabilizer, whereupon (d) said second albumin solution to which a stabilizer has optionally been added...

20060234909 - Compositions and methods for increasing drug efficiency: )

20060234911 - Method of reversing epithelial mesenchymal transition: A method of reversing epithelial mesenchymal transition, comprising the step of treating a fibrotic disease patient or cancer disease patient with an amount of kinase inhibitor capable of reversing EMT, wherein the kinase inhibitor comprises a TGF-βI kinase inhibitor and a Rho kinase inhibitor or a TGF-βI inhibitor and a...

20060234905 - Method of stimulating growth and resistance to diseases of aquatic organisms: The invention is related with the chemical synthesis for increase the growth rate in marketable fish and crustacean The aim of this invention is supply GHRP-6 to induce directly or indirectly the release of growthing hormone or like, to produce the increase of circulating growthing hormone level in the blood...

20060234908 - Methods for improving the structure and function of arterioles: The present invention relates to the unexpected finding that vessels smaller than even the smallest arteries (i.e. arterioles) thicken, become dysfunctional and cause end organ damage to tissues as diverse as the brain and the kidney. This invention provides a method to improve the structure and function of arterioles and...

20060234912 - Methods for modulating neuronal responses: The invention provides, in part, methods and reagents for modulating neuronal apoptosis and for modulating synaptic plasticity....

20060234910 - Methods for the treatment of insulin resistance and disease states characterized by insulin resistance: The MINOR and TR3 genes are disclosed to be insulin responsive genes differentially expressed as a function of insulin resistance and Type 2 Diabetes in humans and a variety of well characterized animal models. The present disclosure shows that MINOR and TR3 have a functional role in insulin resistance. Therefore,...

20060234906 - Structure of a complex of retinoblastoma protein bound to e2f, and uses thereof: The present invention provides the crystal structure of pRb/E2F(409-426) as well as uses of the structure in identifying agents which modulate the binding between pRb and E2F and/or a pRb/E2F(409-426) complex, and thus are useful as pharmaceutical agents in the prevention or treatment of proliferative diseases....

20060234914 - Fragments of proinsulin c-peptide: The present invention relates to peptides being the N-terminal fragment of human proinsulin C-peptide and having the sequence EAEDLQVGQVEL (SEQ ID No: 2) or a fragment or peptide derivative thereof retaining the functional ability of the N-terminal fragment to contribute to C-peptide activity, wherein said fragment or peptide derivative comprises...

20060234913 - Oral insulin therapy: Pharmaceutical dosage forms for oral administration to a patient for the treatment of diabetes, comprising insulin and a delivery agent that facilitates insulin transport in a therapeutically effective amount to the bloodstream and that result in a lower incidence of vascular diseases associated with the repeated administration of insulin are...

20060234915 - Compositions and methods for delivering carbon monoxide (co) and nitric oxide (no) to tissue using heme proteins as carriers: The present invention relates to compositions and methods for delivering nitric oxide (NO) or carbon monoxide (CO) to cells using heme proteins as carriers. In one embodiment, the present invention relates to the use of modified hemoglobin to deliver NO or CO to cells...

20060234916 - Cardioprotective agent: A problem of the present invention is to provide an agent which allows effective protection of cardiac damage in a case where a variety of symptoms such as arrhythmia, cardiac desmoplasia and heart-failure are likely to accompany with hypertension, hypercardia, myocardial infarction, arteriosclerosis, diabetic and non-diabetic renal diseases, and re-stenosis...

20060234918 - Methods for treating and preventing cancers that express the hypothalamic-pituitary-gonadal axis of hormones and receptors: Methods are provided for treating HPG axis-positive cancers, preventing or slowing proliferation of cells of HPG axis-positive cancer origin, preventing HPG axis-positive cancers in a patient at risk of contracting such cancers, preventing or inhibiting an upregulation of the cell cycle in HPG axis-positive cancer-derived cells in a patient, and...

20060234917 - Truncated baff receptors: The disclosure provides a non-naturally occurring BAFF-R glycoprotein having a deletion in the extracellular domain which results in an altered 0-linked glycosylation pattern. The disclosure also provides methods and pharmaceutical compositions for treating B-cell- and T-cell-mediated disorders....

20060234920 - New antitumoral compounds: The present invention is directed to new kahalalide antitumoral compounds, in particular to analogues of kahalalide F, useful as antitumoral, antiviral, antifungal agents and in the treatment of psoriasis....

20060234922 - Remedy for corneal failure: The present invention provides a new type of pharmaceutical agent that recovers corneal sensitivity after corneal surgery or improves the condition of dry eye. Application of a somatostatin receptor agonist is expected to provide an improvement effect on decreased corneal sensitivity after cataract surgery or LASIK surgery, decreased corneal sensitivity...

20060234923 - Template-fixed peptidomimetics as medicaments against hiv and cancer: Template-fixed β-hairpin peptidomimetics of the General Formula (I); wherein Z1 and Z2 are template-fixed chains of 4 and 6 or 5 and 7 α-amino acid residues which, depending on their positions in the chain are Gly, or Pro, or of certain types which, as the remaining symbols in the above...

20060234921 - Treatment of osteoarthritis: This invention relates to methods of treatment of osteoarthritis, and especially to treatment of this condition with cyclic peptidic and peptidomimetic compounds which have the ability to modulate the activity of G protein-coupled receptors. The compounds preferably act as antagonists of the C5a receptor, and are active against C5a receptors...

20060234919 - Use: The present invention relates to the use of substances with oxytocin for the preparation of pharmaceutical composition against inflamation. It also relates to a pharmaceutical composition comprising at least one substance with oxytocin activity against inflamation....

20060234928 - Cell death-inducing fused gene acting specifically on cancer and gene product thereof: The present invention provides a protein having a potent cell-death inducing activity that is, a fused protein is in which a modified Bax protein fused with GFP at the N-terminus and is further fused with a homing signal peptide having a homing activity specific for endothelial cells in tumor angiogenesis;...

20060234934 - Composition and method for selective cytostasis: A method of inducing cytostasis in a population of HIV-infected cells is disclosed which comprises applying to a population of HIV-infected cells a cytostatically effective amount of an inhibitor comprising an isolated peptide having the amino acid sequence FCRFLLCPSRTSD or SQCEQEGGRCRFLLCPSRTSNIGKLGCEPLWKC CKRWGG, or a conservative variant thereof, whereby cell growth...

20060234925 - Embryo implantation inhibitor: For a pregnancy to be established, communication between conceptus and mother, and implantation of the conceptus on the uterine wall must occur. If a factor mediating the communication between conceptus and mother is investigated and the factor can be used to control the communication, it may be possible to develop...

20060234936 - Method for screening substances capable of inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells: There are provided PACAP which is a substance capable of inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells, a method for inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells in a human by PACAP administration, a pharmaceutical composition...

20060234937 - Modulation of angiogenesis: Substances are provided that are capable of modulating angiogenesis mediated by Lmo2 or a functionally related polypeptide, which substance binds to Lmo2 and/or a functionally related polypeptide, or alters the expression of Lmo2 or a functionally related polypeptide in a cell. Assay methods are provided for identifying such substances....

20060234935 - Mutants of the factor vii epidermal growth factor domain: The application relates to modified blood coagulation factor, sequencing encoding such modified factors, processes for their production, and related pharmaceutical compositions comprising such factors and their uses. More specifically, the application relates to mutations in the human FVII EGF-1 domain, wherein said mutations were analyzed for clotting activity, amidolytic activity...

20060234927 - Neuroprotective iron chelators and pharmaceutical compositions comprising them: Novel iron chelators exhibiting neuroprotective and good transport properties are useful in iron chelation therapy for treatment of a disease, disorder or condition associated with iron overload and oxidative stress, eg. a neurodegenerative or cerebrovascular disease or disorder, a neoplastic disease, hemochromatosis, thalassemia, a cardiovascular disease, diabetes, a inflammatory disorder,...

20060234924 - Novel proteins and dnas thereof: A novel sodium-dependent bile acid transporter protein, an Na+/H+ exchange transporter protein, a P-type ATPase protein and a vanilloid receptor protein, and polynucleotides encoding these proteins are useful in screening preventives/remedies for hyperlipemia, arteriosclerosis, genital diseases or digestive diseases; respiratory diseases, renal diseases or digestive diseases; pancreatic diseases, central nerve...

20060234926 - Nucleic acid ligands and uses therefor: The present invention relates to novel nucleic acid molecules or ligands or aptamers with affinities for specific target molecules, and uses of such molecules. The target molecules are fibrillar proteins in all forms of the protein that is to say its monomeric, pre-fibrillar, protofibrillar and mature fibrillar forms. The molecules...

20060234932 - Prolonged efficacy of islet neogenesis therapy methods with a gastrin/cck receptor ligand and an egf receptor ligand composition in subjects with preexisting diabetes: Compositions and methods are provided for achieving in vivo islet cell regeneration in subjects with preexisting diabetes. The methods comprise short term treatment with a composition having a gastrin/cholecystokinin receptor ligand and an EGF receptor ligand. Treatment with such a composition for a short term resulted in a prolonged period...

20060234929 - Rasgap derived peptide for selectively killing cancer cells: The present invention relates to a peptide consisting in the N2 sequence of the RasGAP protein, a fragment thereof, or a variant thereof which enhances the ability of a drug to selectively kill cells. Furthermore, it relates to a pharmaceutical composition comprising as an active substance a pharmaceutically effective amount...

20060234931 - Treatment of diseases with kinase inhibitors: The invention is directed to the identification and use of additional targets of BIRB 796, imatinib mesylate, and BAY 43-9006. The new targets of BIRB 796, imatinib mesylate, and BAY 43-9006 can be used to screen for suitable therapeutic compounds. Also, novel therapeutic and prophylactic uses for BIRB 796, imatinib...

20060234930 - Use of dg008,dg065,dg210 or dg239 secreted protein products for preventing and treating pancreatic diseases and/or obesity and/or metabolic syndrome: The present invention discloses proteins secreted by the developing pancreas, and polynucleotides, which identify and encode the proteins. The invention also relates to the use of these sequences in the diagnosis, study, prevention, and treatment of pancreatic diseases (e.g diabetes), obesity, and/or metabolic syndrome....

20060234933 - Vasoactive intestinal polypeptide pharmaceuticals: Pharmaceutical compositions relating to vasoactive intestinal polypeptides and methods for the treatment of metabolic disorders, including diabetes, insulin resistance, metabolic acidosis and obesity are presented. Methods of using the vasoactive intestinal polypeptide compositions are also disclosed....

20060234939 - Methods of using ziconotide to treat overactive bladder: The invention relates to methods of using Cav2.2 subunit calcium channel modulators to treat painful and non-painful lower urinary tract disorders and the related genitourinary tract disorders vulvodynia and vulvar vestibulitis in normal and spinal cord injured patients....

20060234938 - Peptides impairing pbx dependent gene regulation: e

20060234940 - Secondary binding site of dipeptidyl peptidase iv (dp iv): The present application relates to the secondary binding site of dipeptidyl peptidase IV, its relationship amongst substrates and to the modulation of substrate specificity of dipeptidyl peptidase IV (DP IV, synonym: DPP IV, CD26, EC 3.4.14.5). The application relates further to compounds that bind to the secondary binding site of...

20060234941 - Peptide epitopes of vegfr-2/kdr that inhibit angiogenesis: The disclosure provides antigenic peptides of Vascular Endothelial Growth Factor Receptor 2(VEGFR-2)/KDR. Pharmaceutical compositions including the peptides and/or antigen presenting cells that exhibit the VEGFR-2/KDR peptides on their cell surface are also provided. Methods for eliciting an immune response and for inhibiting angiogenesis by administering such pharmaceutical compositions are provided....

20060234943 - Biological active peptides comprising isoleucyl-valyl-threonyl-asparaginyl-threonyl-threonine (ivtntt): The peptide Isoleucyl-valyl-threonyl-asparaginyl-threonyl-threonine is disclosed with its use as a pharmaceutical composition. A method is also disclosed for making a pharmaceutical composition comprising providing an Isoleucyl-valyl-threonyl-asparaginyl-threonyl-threonine peptide and mixing said peptide with a pharmaceutical acceptable carrier....

20060234942 - Use of at least one $g(a)62 casein peptide with angiotensin i converting enzyme inhibiting activity for preparing medicines, food products and food complements: e

20060234944 - Beta-secretase inhibitors and methods of use: Compounds inhibit memapsin 2 β-secretase activity and selectively inhibit memapsin 2 β-secretase activity relative to memapsin 1 β-secretase activity. The compounds are employed in methods to inhibit memapsin 2 β-secretase activity, in the treatment of Alzheimer's disease, in the inhibition of hydrolysis of a β-secretase site of a β-amyloid precursor...

20060234945 - Ophthalmic therapeutic composition: An object is to find the minimum activity expression site of fibronectin, clarify the actions of this minimum unit in relation to ophthalmological fields, and provide a ophthalmological composition having this minimum unit as an effective component. This invention provides an ophthalmological composition, in particular, a corneal disorder treatment agent...

20060234947 - Peptides antibodies directed thereagainst and methods using same for diagnosing and treating amyloid-associated diseases: Peptides having at least 2 amino acids and no more than 15 amino acids are provided. The peptides comprise amino acid sequence X-Y or Y-X, wherein X is an aromatic amino acid and Y is any amino acid other than glycine. Also provided are pharmaceutical compositions and kits including such...

20060234946 - Use of telmisartan for the prevention and treatment of vascular headache: The present invention relates to a method for the prophylaxis of vascular headaches which do not originate from hypertension, especially migraine, the method comprising administration of telmisartan to a subject in need of such a treatment. The present invention relates also to a method for the prophylaxis of vascular headaches,...

20060234948 - Lignan-containing compositions: Compositions are provided that includes a lignan, and an additional compound such as an isoflavone, a tocopherol, a phytosterol, a polyphenol, a catechin, an anthocyanin, an astaxanthin, or a glucosamine. The compositions can be formulated as a dietary supplement, in tablet, powder or liquid form, or can be incorporated into...

20060234949 - Adduct of topiramate and tramadol hydrochloride and uses thereof: This invention relates to a new pharmaceutically useful compound which is a stoichiometrically 1:1 adduct of tramadol hydrochloride and topiramate, and to the manufacture and use thereof....

20060234950 - Combination therapy for effecting weight loss and treating obesity: The present invention features a novel therapy for effecting weight loss which involves treating a subject with a sympathomimetic agent (e.g., phentermine or a phentermine-like drug) in combination with an anticonvulsant sulfamate derivative (e.g., topiramate) such that the subject experiences weight loss. The combination methods of the present invention also...

20060234951 - Combination therapy for effecting weight loss and treating obesity: The present invention features a novel therapy for effecting weight loss which involves treating a subject with a sympathomimetic agent (e.g., phentermine or a phentermine-like drug) in combination with an anticonvulsant sulfamate derivative (e.g., topiramate) such that the subject experiences weight loss. The combination methods of the present invention also...

20060234952 - Combination therapy for effecting weight loss and treating obesity: The present invention features a novel therapy for effecting weight loss which involves treating a subject with a sympathomimetic agent (e.g., phentermine or a phentermine-like drug) in combination with an anticonvulsant sulfamate derivative (e.g., topiramate) such that the subject experiences weight loss. The combination methods of the present invention also...

20060234953 - Glucopyranosyl-substituted (heteroaryloxy-benzyl)-benzene derivatives, medicaments containing such compounds, their use and process for their manufacture: e

20060234954 - Substituted benzimidazole-, benztriazole-, and benzimidazolone-o-glucosides: This invention relates to to substituted benzimidazole-O glucosides, benztriazole-O-glucosides, and benzimidazolone-O-glucosides, compositions containing them, and methods of using them, for example, for the treatment or prophylaxis of diabetes and Syndrome X....

20060234955 - Cardiac glycosides to treat cystic fibrosis and other il-8 dependent disorders: A method of inhibiting the secretion of IL-8 and other pro-inflammatory cytokines from cells secreting elevated levels of these compounds is provided. The method includes contacting the cell with a composition comprising a cardiac glycoside such as oleandrin. The cardiac glycoside can be used to treat cystic fibrosis and other...

20060234956 - Dicarboxylic acid ester derivatives of ginsenoside, pharmaceutical preparations containing the same, and preparation thereof: The present invention relates to a series of dicarboxylic acid ester derivatives of ginsenosides such as succinate and glutarate derivatives of 20-O-β-D-glucopyranosyl-protopanaxadiol (compound K, abbreviated as CK), preparation thereof and pharmaceutical uses thereof. The dicarboxylic acid ester derivatives of ginsenosides of the present invention can be used to form pharmaceutical...

20060234957 - Adiponectin expression promoter: To prevent or alleviate various pathologies caused by lifestyle-related diseases, etc., the present invention provides a substance having an effect of promoting the expression and elevating the expression level of adiponectin, and applications thereof. An adiponectin expression promoting agent containing, as an active ingredient, at least one cyanidin compound selected...

20060234959 - Photodynamic therapy utilizing multiple duty cycle light modulation: A method of photodynamic disruption of target cells within a target cell site wherein the target cells are associated with one or more of a sterilization procedure, a biofilm eradication procedure, a sterilization procedure of a medical prosthesis, a treatment of an infection at a tissue site, eradication of cancer...

20060234958 - Process of increasing cellular production of biologically active compounds: A process of increasing the cellular production of biologically active compounds is provided. The process is particularly useful for increasing antibiotic production by bacterial cells. The process includes the step of inhibiting the activity of methylmalonyl-CoA mutase....

20060234960 - Methods and compositions for increasing the safety and efficacy of albumin-binding drugs: A method is provided for increasing the safety and efficacy of albumin-binding drugs such as those used as anti-cancer, anti-infective, or anti-hypertensive drugs, or for numerous other conditions. In the preferred method, the invention modulates those drugs which bind at the IB site on human serum albumin by co-administering a...

20060234961 - Novel anti bacterial compounds: The invention relates to novel paranmycin compounds that have activity against gram positive and gram negative bacteria, preferably bacteria that are resistant to other antibiotics. Paranmycins are of the general formula...

20060234963 - Hepatitis c therapies: The invention provides methods for treating hepatitis C viral infections and related viral infections, as well as compounds and compositions that are useful for treating such infections....

20060234962 - Nucleoside derivatives as inhibitors of rna-dependent rna viral polymerase: The present invention provides nucleoside compounds and certain derivatives thereof which are inhibitors of RNA-dependent RNA viral polymerase. These compounds are inhibitors of RNA-dependent RNA viral replication and are useful for the treatment of RNA-dependent RNA viral infection. They are particularly useful as inhibitors of hepatitis C virus (HCV) NS5B...

20060234971 - Calpains as targets for inhibition of prion propagation: The present invention relates to methods for the inhibition of disease-associated prion formation and propagation. Such methods are based on inhibition of PrPSc cleavage, which prevents PrPSc accumulation and results in reduced prion titers. More particularly, the present invention relates to endoproteolytic cleavage of PrPSc by calpain, a calcium (Ca2+)-activated...

20060234969 - Compositions and methods for inhibiting inflammation of vessel walls and formation of neointimal hyperplasia: Compositions and methods for inhibiting inflammation of vessel wall and/or formation of neointimal hyperplasia by gene therapy using a soluble Flt-1 (sFlt-1) gene, are provided. VEGF has an essential role in the development of neointimal hyperplasia by causing inflammation. sFlt-1 gene transfer to the site of vascular injury blocks Flt-1-mediated...

20060234972 - Compositions and their uses directed to thymus and activation-regulated chemokine (tarc): Disclosed herein are compounds, compositions and methods for modulating the expression of TARC in a cell, tissue or animal. Also provided are methods of target validation. Also provided are uses of disclosed compounds and compositions in the manufacture of a medicament for treatment of diseases and disorders related to expression...

20060234967 - Human protooncogene and protein encoded therein: The present invention relates to a novel proto-oncogene HPP1 (Human proto-oncogene 1), which is non-homologous to existing oncogenes and the protein encoded by the said oncogene. This novel proto-oncogene can be advantageously used in diagnosing of various cancers; in construction of transformed animals; and in anti-sense gene therapy. The present...

20060234964 - Inducible plasmid vector encoding tgf-beta and use thereof: The present invention provides alternatives to traditional drug and surgical treatments for IBD. In particular, the present invention provides compositions and methods for the treatment of autoimmune diseases such as IBD in humans using TGF-β therapy. The compositions of the present invention provide vectors containing TGF-β under the control of...

20060234968 - Inhibition of the cd95 ligand/receptor system for the treatment of neurological disorders and injuries: The present invention relates to the use of inhibitors of the CD95 ligand/receptor system for the manufacture of a medicament for the treatment of neurological disorders or injuries in a mammal, particularly for the treatment of spinal cord injury, more particularly for the treatment of paraplegia....

20060234966 - Method for expressing inducible rna [in cells, nucleic acid molecules therefor and cells transformed by said molecules: A method of expressing RNAi in cells including introducing into cells a molecule of nucleic acid including the sequence sense and antisense of RNAi placed under the control of a promoter of single transcription, which sense and antisense sequences are separated by a sequence of DNA including a sequence for...

20060234970 - Methods and compositions for the treatment of eye disorders with increased intraocular pressure: The present invention relates to methods and compositions that decrease intraocular pressure (IOP) of the eye. The compositions of the invention comprise short interfering nucleic acid molecules (siNA) including, but not limited to, siRNA that decrease expression of genes associated with production or drainage of intraocular fluid. The compositions of...

20060234965 - Novel full-length genomic rna of japanese encephalitis virus, infectious jev cdna therefrom, and use thereof: The present invention relates to a novel genomic RNA of Japanese encephalitis virus (JEV) and an infectious JEV cDNA therefrom. Particularly, the present invention relates to a full-length genomic RNA of JEV represented by SEQ. ID. No 15 and an infectious JEV cDNA therefrom. JEV genomic RNA and infectious JEV...

20060234973 - Transcription factor rna interference reagents and methods of use thereof: The present invention concerns methods and reagents useful in modulating transcription factor gene expression in a variety of applications, including methods of use in therapeutic, diagnostic, target validation, and genomic discovery applications. Specifically, the invention relates to small nucleic acid molecules, such as short interfering nucleic acid (siNA), short interfering...

20060234974 - 2,6-dihalogeno-8-substituent-purine compound and process for producing the same: R1, R2 and Z are each as defined in the description, or a salt thereof, a production method thereof and the like. A 2,6-dihalogeno-8-substituted-purine compound or a salt thereof, which is useful as an intermediate for producing medicaments, can be conveniently produced from a 2,6-dihalogenopurine compound or a salt thereof,...

20060234975 - Use of adenosine receptor agonists in therapy: Use of compounds of formula: (I) wherein R is C1-4 alkoxy and X is H or OH; for the prevention, treatment, or amelioration of cancer, inflammation, auto-immune disease, ischemia-reperfusion injury, epilepsy, sepsis, septic shock, neurode-generation (including Alzheimer's Disease), muscle fatigue or muscle cramp is described. The compounds are effective at...

20060234976 - Process for the preparation of 4,6-disubstituted-tetrahydro-furo, thieno, pyrrolo and cyclopenta-[3,4][1,3]dioxoles: The present invention is directed to a processes for the synthesis of trans isomer of 4,6-disubstituted-tetrahydro-furo, thieno, pyrrolo and cyclopenta-[3,4][1,3]dioxoles (Formula I). The process comprises the steps of: (a) obtaining a compound of Formula II, which is a mixture of cis and trans-diastereomers, and (b) chemically decomposing the compound of...

20060234977 - Antiviral compostion comprising a sulphated glucose polymer and a bacteriostatic agent: There is described a pharmaceutical composition comprising a glucose polymer or a mixture of glucose polymers and optionally, salts thereof and a non-sensitising bacteriostatic agent, such as sorbic acid. There is also described a method of treatment, alleviation or prevention of HIV-1 or a related virus or other sexually transmitted...

20060234978 - Glycosaminoglycan composition and method for treatment and prevention of interstitial cystitis: The invention provides compositions and methods useful for the treatment and/or prevention of interstitial cystitis and/or a related urinary tract condition in man or in animals. Specifically, provided are compositions specially formulated for direct instillation into the bladder and/or parenteral use in the treatment and/or prevention of interstitial cystitis. Compositions...

20060234979 - Aripiprazole complex formulation and method: An aripiprazole formulation is provided which includes the antipsychotic agent aripiprazole in the form of an inclusion complex in a β-cyclodextrin, preferably, sulfobutyl ether β-cyclodextrin (SBECD), which in the form of an injectable produces reversible generally minimal to mild irritation at the intramuscular injection site. A method for minimizing or...

20060234980 - Antiinflammatory agent, agent for preventing/ameliorating allergic diseases and functional food: It is intended to provide an anti-inflammatory agent made from a highly safe material which can be daily taken as a food, an agent for preventing or ameliorating allergic diseases and a functional food having the above-mentioned effects. The anti-inflammatory agent contains an α-bond galactooligosaccharide as the active ingredient. The...

20060234981 - Boron-containing small molecules: This invention relates to compounds useful for treating fungal infections, more specifically topical treatment of onychomycosis and/or cutaneous fungal infections. This invention is directed to compounds that are active against fungi and have properties that allow the compound, when placed in contact with a patient, to reach the particular part...

20060234982 - Compositions and methods for combination antiviral therapy: The present invention relates to therapeutic combinations of [9-[R-2-[[(S)-[[(S)-1-(isopropoxycarbonyl)ethyl]amino]-phenoxyphosphinyl]methoxy]propyl]adenine (GS-7340) and (2R, 5S, cis)-4-amino-5-fluoro-1-(2-hydroxymethyl-1,3-oxathiolan-5-yl)-(1H)-pyrimidin-2-one (emtricitabine, (−)-cis FTC, Emtriva™ and their physiologically functional derivatives. The combinations may be useful in the treatment of HIV infections, including infections with HIV mutants bearing resistance to nucleoside and/or non-nucleoside inhibitors. The present invention is...

20060234983 - Prodrugs of 2,4-pyrimidinediamine compounds and their uses: The present disclosure provides prodrugs of biologically active 2,4-pyrimidinediamine compounds, compositions comprising the prodrugs, intermediates and methods for synthesizing the prodrugs and methods of using the prodrugs in a variety of applications....

20060234984 - Mitotic kinesin inhibitors: The present invention relates to dihydropyrrole compounds of Formula (I) that are useful for treating cellular proliferative diseases, for treating disorders associated with KSP kinesin activity, and for inhibiting KSP kinesin. The invention is also related to compositions which comprise these compounds, and methods of using them to treat cancer...

20060234985 - Combination therapy comprising a bisphosphonate and a hmg-coa reductase inhibitor: A pharmaceutical composition for treatment of malignancies, in particular multiple myeloma (MM), comprises in combination a bisphosphonate, e.g. zoledronic acid or a salt or ester, and an HMG-CoA reductase inhibitor for simultaneous, sequential or separate use. Also provided is a method of treating a patient suffering from a malignant disease...

20060234986 - Use of tafi inhibitors for enhanced myocardial reperfusion and facilitated pci: This invention relates to TAFI inhibitors and their use to enhance myocardial reperfusion and facilitate percutaneous coronary intervention (PCI) in the treatment of acute ST elevation myocardial infarction (STEMI)....

20060234987 - Neuroprotective benzo 1 3 oxathiol 2 ones: This invention relates to benzo[1,3]oxathiol-2-ones, derivatives, and precursors thereof, and their use as neuroprotective agents in the treatment and prevention of neuronal disorders of the central and peripheral nervous systems....

20060234988 - 7-n-substituted phenyl tetracycline compounds: 7-substituted tetracycline compounds, methods of treating tetracycline responsive states, and pharmaceutical compositions containing the 7-substituted tetracycline compounds are described....

20060234989 - Formulations of quaternary ammonium neuromuscular blocking agents: Muscle relaxant formulations which include one or more quaternary ammonium neuromuscular blocking agents have a reduced tendency for hydrolytic degradation, and therefore a longer shelf life stability, when combined with one or more organic anions having at least six carbon atoms and having a pKa of less than 4.0 (preferably...

20060234990 - Compositions of boswellic acids derived from boswellia serrata gum resin, for treating lymphoproliferative and autoimmune conditions: A method of treatment of lymphoproliferative and autoimmune disorders with a new composition of four boswellic acids including β-boswellic acid, 3-O-acetyl-β-boswellic acid, 11-keto-β-boswellic acid, and 3-O-acetyl-11-keto-β-boswellic acid. Boswellic acids of invention have been obtained in a novel industrial process from the gum resin of Boswellia serrata tree, providing standardized composition...

20060234991 - Combinations for the treatment of immunoinflammatory disorders: The invention features pharmaceutical compositions that include dipyridamole and a corticosteroid....

20060234992 - Dhea composition and method: Disclosed are improved pharmaceutical formulations comprising dehydroepiandrosterone (DHEA), enriched in selected polymorphic forms, for therapeutic applications. In one embodiment, the formulation comprises, in solid form, DHEA, at least 85% of which is present as a single polymorph selected from the form I polymorph or the form II polymorph, and at...

20060234993 - Use of androstane derivatives for enhancing physical performance: s

20060234994 - Method and device for concentrating and stabilizing conjugated estrogens from mare urine: A method and apparatus for concentrating and stabilizing conjugated estrogens from pregnant mare urine on solid adsorbent supports to obtain a starting material for pharmaceuticals that contain a natural mixture of conjugated estrogen mixtures on cartridges in the vicinity of the horses. The adsorbent cartridges can be loaded at the...

20060234995 - Compositions containing piperacillin and tazobactam useful for injection: An aminocarboxylic acid chelating agent, preferably EDTA, or a salt thereof has been found to be useful for inhibiting particulate formation in piperacillin/tazobactam parenteral combinations. The composition may also contain a buffer, preferably citrate, and optionally an aminoglycoside. The product may be in the form of a frozen composition that...

20060234996 - Novel crystalline form of ezetimibe and processes for the preparation thereof: A novel crystalline form of Ezetimibe and processes for the preparation thereof are disclosed....

20060234997 - Tetrahydro-pyridoazepin-8-ones and related compounds for the treatment of schizophrenia: are disclosed, wherein G, D, A, Q, Y, Z, and R1 through R10 are defined in the specification. Also provided are descriptions of processes for preparing compounds of formula 1, intermediates used in making the same, and pharmaceutical compositions containing such compounds and their use in the treatment of central...

20060234999 - Cephalotaxane derivatives and their processes of preparation and purification: e

20060234998 - Compositions and methods for treating cns disorders: The invention generally relates to thienopyridinone 5-HT4 receptor modulators, and in particular the use of these compounds and their pharmaceutical compositions, e.g., in the treatment, modulation and/or prevention of physiological conditions associated with serotonin action, such as in treating Alzheimer's disease, cognition disorders, depression, and anxiety....

20060235000 - Compositions and methods for reducing the risk of epileptic occurrence and/or for treatment of seizure disorders: The present invention relates to compounds and compositions useful for reducing the risk of epileptic occurrences and/or for alleviating epileptic phenomena in patients. In accordance with the invention, the compounds and compositions have at least the following two components: a) vitamin B6-based component selected from pyridoxal, pyridoxamine, pyridoxine, their pharmaceutically...

20060235001 - Compositions for the treatment of neoplasms: The invention features a method for treating a patient having a cancer or other neoplasm by administering to the patient a composition that includes a phenothiazine and another active agent, where predetermined plasma drug levels are achieved and maintained for 12 hours or more....

20060235002 - Novel physiologically active substance: (I) wherein R7 and R21 are the same or different and each represents optionally substituted C2-22 alkoxy, etc.; a pharmaceutically acceptable salt thereof or hydrates of the same. The compound (1) inhibits angiogenesis and inhibits the production of VEGF particularly under hypoxic conditions, which makes it useful as a remedy...

20060235003 - Aromatic oxyphenyl and aromatic sulfanylphenyl derivatives: The present invention relates to compounds of formula I wherein the substituents are as defined below. The compounds of formula are useful for the treatment of diseases such as schizophrenia, including both the positive and the negative symptoms of schizophrenia and other psychoses....

20060235004 - Pyrimidin-2-one compounds and their use as dopamine d3 receptor ligands: The invention relates to pyrimidin 2-one compounds of general formula (I), in addition to the derivatives and tautomers of (I) and the physiologically acceptable salts of said compounds. In said formula, A represents linear or branched C3-C6 alkene, which can have a double bond or triple bond and/or a group...

20060235005 - Use of phosphodiesterase 5 (pde5) inhibitors in the treatment of schizophrenia: The use of phosphodiesterase 5 (PDE5) inhibitors for treatment of schizophrenia is described. Suitable PDE5 inhibitors for use for treatment of schizophrenia include sildenafil, vardenafil, tadalafil, E-8010, zaprinast, and E-4021. In one embodiment, for example, a method is described for treating schizophrenia in a patient which comprises treating the patient...

20060235006 - Combinations, methods and compositions for treating cancer: The invention relates to a combination of BCR-ABL inhibitor, exemplified by ′N-(2-Chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyethyl)-1-piperazinyl]-2-methyl-4-pyrimidinyl]amino]-5-thiazolecarboxamide and/or other BCR/ABL inhibitors, and a stem cell selective cytotoxic, exemplified by (R)-2,3,4,5-tetrahydro-1-(1H-imidazol-4-ylmethyl)-3-(phenylmethyl)-4-(2-thienylsulfonyl)-1H-1,4-benzodiazepine-7-carbonitrile, hydrochloride salt, and or other stem cell cytotoxic agents, pharmaceutical compositions of the combination and to methods of using the pharmaceutical compositions in the treatment...

20060235007 - Substituted 1,4-diazepines and uses thereof: R6, R7 and R8 are independently hydrogen, alkyl, cycloalkyl, aryl, heteroaryl, a saturated or partially unsaturated heterocycle, cycloalkylalkyl, aralkyl or heteroarylalkyl, each of which is optionally substituted; or R6 and R7, together with the carbon atom to which they are attached form a 3- to 7-membered carbocyclic ring optionally substituted...

20060235008 - Novel polymorphs of efavirenz: The present invention relates to novel amorphous and crystalline forms of efavirenz, processes for their preparation and pharmaceutical compositions containing them. In accordance with the present invention efavirenz crude is dissolved in acetone at 25° C.-30° C., the solution is slowly added to water for 30 minutes at 0° C.-5°...

20060235009 - Treatment of vascular, autoimmune and inflammatory diseases using low dosages of impdh inhibitors: The disclosure provides methods and compositions for treating a vascular, autoimmune, and/or inflammatory disease, or a condition associated therewith, with a dose of an inosine monophosphate dehydrogenase (IMPDH) inhibitor effective to treat the vascular, autoimmune and/or inflammatory disease, or associated condition but that does not produce immunosuppression sufficient to reduce...

20060235010 - Inhibitors of papilloma virus: e

20060235011 - 7-phenyl pyrazolopyridine compounds: [wherein R1 is methoxy, methylthio, ethyl, etc.; R5 and R6 are each independently cyclopropylmethyl, (4-tetrahydropyranyl)methyl, etc.; and two of R40, R41 and R42 are C1-6 alkoxy while the remaining one is methoxymethyl, etc.], a salt thereof, or a hydrate of the foregoing. This compound has excellent antagonism against corticotropin-releasing factor...

20060235012 - Carboline and betacarboline derivatives for use as hdac enzyme inhibitors: Compounds of formula (IA) and (IB) are inhibitors of histone deacetylase activity and useful for the treatment of, inter alia, cancers: wherein fused rings A1 and A2 are optionally substituted; linker radical R1 represents a radical of formula...

20060235013 - Tricyclic azole derivatives: m

20060235014 - Inhibitors of p38: The present invention relates to inhibitors of p38, a mammalian protein kinase involved cell proliferation, cell death and response to extracellular stimuli. The invention also relates to methods for producing these inhibitors. The invention also provides pharmaceutical compositions comprising the inhibitors of the invention and methods of utilizing those compositions...

20060235016 - Morpholine dopamine agonists: e

20060235015 - Pyrrole-2,5-dione derivatives as liver x receptor modulators: to processes for preparing such compounds, to their the utility in modulation of nuclear hormone receptors Liver X Receptor (LXR) α (NR1H3) and/or β (NR1H2) and in treating and/or preventing clinical conditions including cardiovascular diseases such as atherosclerosis; inflammatory diseases, Alzheimer's disease, lipid disorders (dyslipidemias) whether or not associated with...

20060235017 - Cytokine inhibitors: Where Ar1, X, Y, Q, W, R3, R4, R5, R6 and Ry are defined herein. The compounds of the invention inhibit production of cytokines involved in inflammatory processes and are thus useful for treating diseases and pathological conditions involving inflammation such as chronic inflammatory disease. The compounds are also useful...

20060235018 - Prokineticin 1 receptor antagonists: e

20060235020 - Process for preparing salts of 4-[[5-[(cyclopropylamino)carbonyl]-2-methylphenyl]amino]-5-methyl-n-propylpyrrolo[2,1-f][1,2,4]triazine-6-carboxamide and novel stable forms produced therein: Processes are provided for selectively preparing novel stable crystalline salt forms, selectively and consistently, namely, preparing Form N-1 of the methanesulfonic acid salt, and Form N-1 and Form N-4 of the hydrochloric acid salt of the p38 kinase inhibitor 4-[[5-[(cyclopropylamino)carbonyl]-2-methylphenyl]amino]-5-methyl-N-propylpyrrolo[2,1-f][1,2,4]triazine-6-carboxamide. The processes preferably employ solvent systems including formic acid/acetone and...

20060235019 - Substituted quinazolinone compounds: A variety of low molecular weight, guanidino-containing molecules capable of acting as MC4-R agonists are provided. The compounds are useful in treating MC4-R mediated diseases. The compounds have the structure of Formulas (IA), (IB), or (IC): where the values of the variable are defined herein....

20060235021 - Phenylpyridazine derivatives as ligands for gaba receptors: A class of 4-phenylpyridazine derivatives of Formula (I), being selective ligands for GABAA receptors, in particular having high affinity for the α2 and/or α3 and or α5 subunit thereof, are accordingly of benefit in the treatment and/or prevention of adverse conditions of the central nervous system, including anxiety, convulsions and...

20060235022 - Therapeutic agents useful for treating pain: where Ar1, Ar2, X, R1, R2, R3, m, and n are as disclosed herein or a pharmaceutically acceptable salt thereof (a “Phenylene Compound”); compositions comprising an effective amount of a Phenylene Compound; and methods for treating or preventing pain and other conditions in an animal comprising administering to an animal...

20060235023 - Inhibitors of macrophage migration inhibitory factor and methods for indentifying the same: e

20060235024 - Acetylinic piperazine compounds and their use as metabotropic glutamate receptor antagonists:

20060235025 - Novel pyrazolopyrimidines as cyclin dependent kinase inhibitors: In its many embodiments, the present invention provides a novel class of pyrazolo[1,5-a]pyrimidine compounds as inhibitors of cyclin dependent kinases, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment, prevention, inhibition,...

20060235026 - Quinoline-4-carboxamide derivatives as nk-3 and nk-2 receptor antagonists: any of R2, R5, R8, R10, R11 and R12 may optionally be substituted one or more times by halo, hydroxy, amino, cyano, nitro, carboxy or oxo; a process for preparing such compounds, a pharmaceutical composition comprising such compounds and the use of such compounds and composition in medicine....

20060235027 - Inhibitors of cdc25 phosphatases: y

20060235028 - Inhibitors of 11-beta hydroxysteroid dehydrogenase type i:

20060235029 - Novel compounds: Novel substituted 2,4,8-trisubstituted 8H-pyrido[2,3-d]pyrimidin-7-one containing compounds and compositions, and their use use in therapy as CSBP/RK/p38 kinase inhibitors....

20060235030 - Novel compounds: Novel substituted 1,5,7-trisubstituted-3,4-dihydro-pyrimido[4,5-d]pyrimidin-2-(1H)-one compounds and compositions, and their use in therapy as CSBP/RK/p38 kinase inhibitors....

20060235031 - 6,6-bicyclic ring substituted heterobicyclic protein kinase inhibitors: and pharmaceutically acceptable salts thereof, wherein X1, X2, X3, X4, X5, X6, X7, R1, and Q1 are defined herein, inhibit the IGF-1R enzyme and are useful for the treatment and/or prevention of hyperproliferative diseases such as cancer, inflammation, psoriasis, allergy/asthma, disease and conditions of the immune system, disease and conditions...

20060235032 - Substituted quinazolines as antiviral agents, especially against cytomegaloviruses: The invention relates to substituted quinazolines and to methods for the production thereof, in addition to the use thereof in the production of medicaments for the treatment and/or prophylaxis of diseases, especially for use as antiviral agents, especially against cytomegaloviruses....

20060235033 - Quinoline derivatives and quinazoline derivatives inhibiting autophosphorylation of macrophage colony stimulating factor receptor: wherein X represents CH or N; Z represents O or S; R1, R2, and R3 represent H, optionally substituted alkoxy or the like; R4 represents H; R5, R6, R7, and R8 represent H, halogen, alkyl, alkoxy, trifluoromethyl or the like; R9 and R10 represent H, alkyl or the like; and...

20060235034 - Novel compounds for treatment of cancer and disorders associated with angiogenesis function: Novel compounds for treatment of cancer and disorders associated with angiogenesis function. Also disclosed are a method of preparing the compounds, pharmaceutical compositions and packaged products containing the compounds, a method of using these molecules to treat cancer (e.g., leukemia, non-small cell lung cancer, colon cancer, CNS cancer, melanoma, ovarian...

20060235035 - Novel methoxybenzamibe compounds for use in mch receptor related disorders: Novel compounds of Formula (I) which modulate MCH activity are disclosed, in which A is a linker; Ar1 is an aryl or heteroaryl group; R1 is a lower alkoxy group; R2 is an R1 group or hydrogen, an OH or an NH2 group, Q together with the carbonyl forms an...

20060235036 - Vanilloid receptor ligands and their use in treatments: and compositions containing them, for the treatment of acute, inflammatory and neuropathic pain, dental pain, general headache, migraine, cluster headache, mixed-vascular and non-vascular syndromes, tension headache, general inflammation, arthritis, rheumatic diseases, osteoarthritis, inflammatory bowel disorders, inflammatory eye disorders, inflammatory or unstable bladder disorders, psoriasis, skin complaints with inflammatory components, chronic...

20060235037 - Heterocyclic inhibitors of protein arginine methyl transferases: d

20060235039 - Hydromorphone polymorphs: Hydromorphone hydrochloride forms are disclosed which are useful as analgesic agents either in combination with or as replacements for hydromorphone hydrochloride....

20060235038 - Novel therapeutic uses for nalmefene: The present invention relates to novel compositions, methods and therapeutic uses for nalmefene, a unique opioid antagonist drug. The invention teaches administering nalmefene by means that function to produce optimal steady-state plasma or serum concentrations. These means plus functions are claimed for treating alcoholism and pathological gambling....

20060235040 - Pharmaceutical compositions containing camptothecins: A camptothecin-containing pharmaceutical composition which contains: (a) camptothecin or a derivative thereof, and (b) one or more compounds selected from among ascorbic acid or a salt thereof, sodium hydrogen sulfite, sodium sulfite, potassium pyrosulfite, sodium erythorbate, sodium thioglycolate, sodium pyrosulfite, and α-thioglycerin. The pharmaceutical composition is useful in that, after...

20060235041 - New isothiazoloquinolones and related compounds as anti-infective agents: Certain compounds of Formula I and Formula II disclosed herein are potent and selective inhibitors of bacterial DNA synthesis and bacterial replication. The invention also provides antimicrobial compositions, including pharmaceutical compositions, containing one or more compounds of Formula I or Formula II and one or more carriers, excipients, or diluents....

20060235042 - Synthesis: The present invention provides a novel substituted azaindoline intermediate of formula (I) and a method for its synthesis. The novel substitued azaindoline intermediate (I) is provided for use in the manufacture of 5-substituted 7-azaindolines and 5-substituted 7-azaindoles....

20060235043 - Antiviral pyrazolopyridine compounds: e

20060235044 - Azabicyclononene derivatives: The invention relates to novel 9-azabicyclo[3.3.1]nonene derivatives and related compounds and their use as active ingredients in the preparation of pharmaceutical compositions. The invention also concerns related aspects including processes for the preparation of the compounds, pharmaceutical compositions containing one or more of those compounds and especially their use as...

20060235045 - Therapeutic agent for chronic obstructive pulmonary disease and method for treatment for chronic obstructive pulmonary disease with the same: wherein R1 represents a hydrogen atom or an alkyl group; R2 and R3 each represents a group selected from a hydrogen atom, an acyl group, an alkyl group and an alkenyl group; and R4 and R5 each represents a group selected from a hydrogen atom, an acyl group, an alkyl...

20060235046 - Use of an epidermal growth factor receptor kinase inhibitor (egfr) in gefitinib resistant patients: This invention discloses method of treating or inhibiting cancer in a human having at least one of an Exon 19 del E746-A750 and/or an Exon 21 point mutation comprising administering to said human gefitinib and/or iressa alone or in combination with other cytotoxic agents or chemotherapeutic agents and an effective...

20060235047 - Antibacterial compounds and uses thereof: The invention relates to antibacterial compounds and their use to treat bacterial infections. More particularly, the invention relates to substituted biphenyl compounds having antibacterial activity. The invention provides methods for treating bacterial infections using PBDEs that have not previously been used to treat bacterial infections. The invention further provides novel...

20060235049 - Non-imidazole aryloxyalkylamines: Substituted aryloxyalkylamines of formula (I), compositions containing them, and methods of making and using them to treat histamine-mediated conditions....

20060235048 - Treatment of connective tissue diseases of the skin: The present invention provides effective and safe medicaments for the treatment of connective tissue diseases of the skin, particularly with respect to the treatment of cutaneous forms of Lupus Erythematous. The medicaments comprise as the therapeutically active ingredient a beta2 adrenoceptor agonist. The invention furthermore relates to dermatological compositions without...

20060235050 - Diamine calcium channel blockers: Aromatic derivatives of aliphatic diamines are effective in ameliorating conditions characterized by unwanted calcium ion channel activity, especially T-type and N-type channels. These conditions include, for example, stroke and pain....

20060235051 - Compounds, compositions, and methods for treatment and prevention of orthopoxvirus infections and associated diseases: Methods of using di, tri, and tetracyclic acylhydrazide derivatives and analogs, as well as pharmaceutical compositions containing the same, for the treatment or prophylaxis of viral infections and diseases associated therewith, particularly those viral infections and associated diseases cased by the orthopoxvirus....

20060235053 - Agents for the treatment of lower abdominal disorders: The invention relates to the use of pantoprazole in the treatment of lower abdominal disorders....

20060235052 - Disulfide, sulfide, sulfoxide, and sulfone derivatives of cyclic sugars and uses: In the present invention there are disclosed new derivatives of dianhydrohexite mononitrate corresponding to formula (I), tautomers, pharmaceutically acceptable salts, prodrugs and solvates thereof as well as pharmaceutical compositions comprising these compounds and uses thereof....

20060235054 - 2-thio-substituted imidazole derivatives and their use in pharmaceutics:

20060235055 - Therapeutic agents useful for treating pain: (where R1, Q, A and R2 are disclosed herein) or a pharmaceutically acceptable salt thereof (a “Pyridine-alkynyl Compound”); pharmaceutical compositions comprising an effective amount of a Pyridine-alkynyl Compound; and methods for treating or preventing a condition such as pain, urinary incontinence, an addictive disorder, Parkinson's disease, parkinsonism, anxiety, epilepsy, a...

20060235056 - Novel 3,4-disubstituted 1,2,3,6-tetrahydropyridine derivatives: The invention relates to novel 3,4-disubstituted 1,2,3,6-tetrahydropyridine derivatives and related compounds and their use as active ingredients in the preparation of pharmaceutical compositions. The invention also concerns related aspects including processes for the preparation of the compounds, pharmaceutical compositions containing one or more of those compounds and especially their use...

20060235057 - Phenyl compounds: e

20060235058 - Substituted 5-membered ring compounds and their use: Compound of a compound of formula (1) or a salt, N-oxide, hydrate or solvate thereof, in the preparation of a composition for inhibition of HSP90 activity: wherein ring A is an aromatic or non-aromatic carbocyclic or heterocyclic ring having 5 ring atoms, for example 1,2,3-triazolyl or a 1,2,4-triazolyl or a...

20060235059 - Cancer treatment with epothilones: The present invention relates to an in vivo regimen for the treatment of a proliferative disease, where an epothilone, is administered in a loading dose followed by at least 1, maintenance doses....

20060235060 - Hetero-polycyclic compounds, and coloring matters, pigments, dyes, color-changing material compositions, and color-changing films, made by using the compounds: Provided are novel hetero-polycyclic compounds having a specific structure, color-changing material compositions comprising (A) a fluorescent coloring matter comprising at least one of the hetero-polycyclic compounds described above and (B) a binder material, color-changing films comprising the above hetero-polycyclic compounds, coloring matters comprising the above hetero-polycyclic compounds, and pigments or...

20060235061 - Methods of using benzothiophenone derivatives to treat cancer or inflammation: Methods of using benzothiophenone derivatives to treat cancer or inflammation in a mammal and pharmaceutical compositions containing such derivatives are disclosed....

20060235062 - Novel heterocyclic analogs of diphenylethylene compounds: Novel diphenylethylene compounds and derivatives thereof containing thiazolidinedione or oxazolidinedione moieties are provided which are effective in lowering blood glucose level, serum insulin, triglyceride and free fatty acid levels in animal models of Type II diabetes. The compounds are disclosed as useful for a variety of treatments including the treatment...

20060235063 - Method of protecting a soybean plant with flutriafol: This invention relates to a method of protecting a soybean plant or the seed from which it is grown from foliar diseases, such as rust diseases, using the compound flutriafol. This invention also relates to a method of protecting a plant from soybean rust diseases using the compound flutriafol....

20060235064 - Method of protecting a soybean plant with flutriafol: This invention relates to a method of protecting a soybean plant or the seed from which it is grown from foliar diseases, such as rust diseases, using the compound flutriafol. This invention also relates to a method of protecting a plant from soybean rust diseases using the compound flutriafol....

20060235065 - Aminopyrazole derivatives: i

20060235066 - Aqueous suspension preparation of bactericide for folieage application: The present invention provides an aqueous suspension formulation containing (RS)—N-[2-(1,3-dimethylbutyl)thiophene-3-yl]-1-methyl-3-trifluoromethyl-1H-pyrazole-4-carboxamide and having high rain resistance and stable residual effectiveness. A aqueous suspension formulation for foliar application fungicide of the present invention contains a fungicidal active ingredient, (RS)—N-[2-(1,3-dimethylbutyl)thiophene-3-yl]-1-methyl-3-trifluoromethyl-1H-pyrazole-4-carboxamide, and a polyoxyalkylene rosin acid ester or liquid paraffin, and has improved rain...

20060235067 - 6h-thieno[2,3-b]pyrrole derivatives as antagonists of gonadotropin releasing hormone (gnrh): e

20060235068 - Ophthalmological surgery colorant and delivery system: Improved ophthalmological surgical methods, systems and devices, employing a colorant....

20060235069 - Benzamide modulators of metabotropic glutamate receptors: The present invention is directed to compounds which are allosteric modulators of metabotropic glutamate receptors, including the mGluR5 receptor, and which are useful in the treatment or prevention of neurological and psychiatric disorders associated with glutamate dysfunction and diseases in which metabotropic glutamate receptors are involved. The invention is also...

20060235070 - Compositions and methods for treating vascular, autoimmune, and inflammatory diseases: The disclosure provides methods and compositions for the treatment of vascular, autoimmune and inflammatory diseases using a combination of an inosine monophosphate dehydrogenase (IMPDH) inhibitor and a HMG CoA reductase inhibitor....

20060235071 - Novel clerodanes and methods for repelling arthropods: in which R1 is H, halogen, formyl, a straight chain or branched C1-4 saturated alkyl, a straight chain or branched C2-4 unsaturated alkyl, or an aryl containing 6-10 carbon atoms in the ring skeleton thereof, wherein R1 is unsubstituted or substituted with one or more substituents, which are the same...

20060235072 - Potassium channel opener: wherein R1, R2, R3, R4, R5, R6 and R7 are each independently hydrogen, alkyl, alkenyl, halogen, hydroxy, halogenated alkyl, hydroxyalkyl, aminoalkyl, alkoxy, aryl, heteroaryl, acyl, carboxyl, alkoxycarbonyl, hydroxamate, sulfo, carbamoyl, sulfonamide, aldehyde, or nitrile; or R4 and R5 may be bonded to each other to form a ring; or R6...

20060235073 - Diamino-functional chalcones: The invention provides novel diamino-functionalised chalcone derivatives and analogues thereof. Use of the compounds, or compositions comprising them, as pharmaceutically active agents, in particular against bacterial and parasitic infections, is also disclosed. The invention further relates to a method for detecting inhibitory effects against e.g., bacteria, parasites, fungi, and helminths....

20060235074 - Matrix metalloproteinase inhibitors: with the proviso that when R1 is C4-12alkyl, Z is other than a bond, O or CH2; and physiologically functional derivatives thereof, processes for their preparation, pharmaceutical formulations containing them and their use as inhibitors of matrix metallproteinase enzymes (MMPs) are described....

20060235075 - Analogous compounds of strobilurines and their use as acaricides and insecticides: Compounds are described, having general formula (I) and their use as acaricides, insecticides and/or fungicides....

20060235076 - Medicinal composition for treating infection with drug-resistant staphylococcus aureus: The invention relates to a therapy of an infection with a drug resistant bacterium wherein a characteristic of multivalent phenol derivatives and/or extracts from “Tara” which enhance the activity of β-lactam antibiotics on the drug resistant bacteria is utilized. Specifically, the invention relates to an enhancer of β-lactam antibiotics comprising...

20060235077 - Diverticular remodling technique: A diverticular remodeling technique comprises the introduction of a remodeling agent into the diverticulum to promote permanent closure of the diverticular sac. In disclosed exemplary embodiments, the diverticulum is accessed non-invasively and optionally cleaned to remove unwanted matter therefrom. The remodeling agent is introduced into the diverticular interior and the...

20060235078 - Insulin secretion potentiator: d

20060235079 - Process for the preparation of gabapentin form-ii: The present invention relates to a new industrial feasible process for the preparation of Gabapentin Form-II via a novel intermediate Gabapentin hemisulphate hemihydrate with out forming Gabapentin Form-III by neutralizing the Gabapentin hemisulphate hemihydrate solution with a base at higher temperatures followed by cooling to yield Gabapentin Form II with...

20060235080 - Treatment or prevention of cancer and precancerous disorders: The NSAID, sulindac and/or its metabolites and derivatives, in combination with hydrogen peroxide or another oxidizing agent, such as arsenic trioxide that generates reactive oxygen species (ROS), significantly enhances the killing of cancer cells. This effect occurs at concentrations of each compound that individually have little or no activity directed...

20060235081 - Mono di & tri cyclic compounds useful for lowering ige concentrations: The present invention is directed novel compounds which are derivatives of minocycline or doxycycline, pharmaceutical compositions containing same and use thereof in lowering excess IgE levels in a mammal suffering from a disease where IgE is pathogenic....

20060235082 - Long-chain, straight-chain 2-amino-3-hydroxyalkanes: Investigation of the activity of extracts of the clam Spisula polynyma has led to antitumor long-chain, straight-chain alkane compounds which have a 2-amino group and a 3-hydroxy group. Compositions and methods comprising an isolated and purified long-chain, straight-chain 2-amino-3-hydroxyalkane, or prodrug thereof, and a pharmaceutically acceptable carrier are also described,...

20060235083 - Peg-poly(ortho ester) graft copolymers and pharmaceutical compositions: This invention relates to graft copolymer delivery vehicles comprising a polyethyleneglycol-poly(ortho ester), and to controlled release pharmaceutical compositions comprising the delivery vehicle and an active agent. The graft copolymer delivery vehicles may be thermogels graft copolymers. The pharmaceutical compositions may be in the form of a topical, syringable, or injectable...

20060235084 - Peg-polyacetal diblock and triblock copolymers and pharmaceutical compositions: This invention relates to block copolymer delivery vehicles comprising a polyethyleneglycol-polyacetal, and to controlled release pharmaceutical compositions comprising the delivery vehicle and an active agent. The block copolymers of the invention may be thermogel block copolymers. The pharmaceutical compositions may be in the form of a topical, syringable, or injectable...

  
10/12/2006 > 136 patent applications in 95 patent subcategories.

20060229233 - Compositions and methods for treating neurological disorders: Compositions useful for treating neurological disorders including neurodegenerative disorders associated with deleterious protein aggregation, aberrant protein folding, such as brain amylogenic diseases, and/or neurodegenerative autoimmune disorders are described. Methods of using said compositions also are described. In particular, methods to treat a neurodegenerative disorder such as Alzheimer's disease and a...

20060229234 - Peptide factor: The present invention relates to use of oxidised thymosin β4 in therapy, more particularly in the treatment of diseases or conditions associated with an inflammatory response or septic shock. The present invention also provides pharmaceutical formulations comprising oxidised thymosin β4 together with a suitable excipient....

20060229235 - Synthetic mimics of mammalian cell surface receptors: method and compositions: The present invention relates to new synthetic receptors. More particularly, the present invention relates to the use of the synthetic receptors for delivering a protein, peptide, drug, prodrug, lipid, nucleic acid, carbohydrate or small molecule into a target cell via receptor-mediated endocytosis. According to the invention, novel synthetic mimics of...

20060229236 - Cyclic tetrapeptide compound and use thereof: A cyclic tetrapeptide compound of the formula (I): wherein R1 is hydrogen; R2 is lower alkyl, aryl, optionally substituted ar(lower)alkyl, heterocyclic(lower)alkyl, cyclo(lower)alkyl(lower)alkyl, lower alkylcarbamoyl(lower)alkyl or arylcarbamoyl(lower)alkyl; R3 and R4 are each independently hydrogen, lower alkyl, optionally substituted ar(lower)alkyl, optionally substituted heterocyclic(lower)alkyl or cyclo(lower)alkyl(lower)alkyl, or R3 and R4 are linked together...

20060229238 - Sustained release of microcrystalline peptide suspensions: The invention relates to a fluid, milky microcrystalline aqueous suspension of a peptide or peptidomimetic and a counter-ion of a strong proton donor in water, wherein the peptide or peptidomimetic and counter-ion are present in amounts and at a molar ratio sufficient to form the suspension upon mixing and without...

20060229237 - Treatment of gastrointestinal distress: A composition and method for treating and/or preventing acute and chronic gastrointestinal distress including nausea, vomiting, lactose intolerance, obstructive symptoms, diarrhea, mucositis, bleeding, weight loss, and malnutrition in a subject who is immunocompromised or receives a planned course of chemotherapy and/or radiotherapy. The method comprises administering a histone deacetylase inhibitor...

20060229243 - Aequorin-containing compositions and methods of using same: Compositions containing aequorin and methods for their use in preventing and/or alleviating symptoms and disorders related to calcium imbalance are provided by the present invention....

20060229242 - Composition comprising a pulmonary surfactant and a pde2 inhibitor: The invention relates to the combined administration of a pulmonary surfactant and a PDE2 inhibitor for the treatment of a disease in which pulmonary surfactant malfunction and/or phosphodiesterase 2 (PDE2) activity is detrimental....

20060229240 - Conformationally constrained parathyroid hormone (pth) analogs with lactam bridges: The present invention relates to methods of treatment of mammalian conditions characterized by decreases in bone mass with conformationally constrained parathyroid hormone (PTH) analogs and derivatives of those analogs containing PTH polypeptide derivatives containing at least one Glu or Lys substitution at position 6 and/or 10, some with installed lactam...

20060229244 - Engineered bacteriocins and bacteriocin combinations and methods for treating bacterial based infections: A method for treating bacterial infections in a patient is provided. The method includes the step of administering a therapeutically effective amount of a single naturally-occurring or engineered bacteriocin, or combinations thereof, designed to have high specific activity against the bacterial infection to the patient so that a rate of...

20060229241 - Hypoxia induced mitogenic factor: We found that FIZZ1/RELMα is inducible by hypoxia in lung. The hypoxia-upregulated expression of FIZZ1/RELMα was located in the pulmonary vasculature, bronchial epithelial cells, and type II pneumocytes. Recombinant FIZZ1/RELMα protein stimulates rat pulmonary microvascular smooth muscle cell (RPSM) proliferation dose-dependently. Therefore, we renamed this gene as hypoxia-induced mitogenic factor...

20060229245 - Lyophilized hgf preparations: The invention relates to a lyophilized HGF preparation prepared by lyophilizing an aqueous solution containing HGF, and a lyophilized HGF preparation containing a stabilizer, sodium chloride, a buffer, and/or a surface active agent. According to the invention, HGF can be stabilized, and it can be stored for a long period....

20060229239 - Novel curcuminoid-factor viia constructs as suppressors of tumor growth and angiogenesis: The fluorinated curcuminoid (3,5-bis-(2-fluorobenzylidene)-piperidin-4-one-acetate is about ten times more effective at arresting the growth of tumor cells than cisplatin. The present invention provides methods to deliver a cytotoxic compound, such as a curcuminoid, specifically to cancer cells and to the vascular endothelial cells that nourish solid tumors. The method involves...

20060229246 - Peptide-enhanced transfections: The present invention provides compositions useful for transfecting eukaryotic cells comprising nucleic acid complexes with peptides, wherein the peptide is optionally covalently coupled to a nucleic acid-binding group, and cationic lipids or dendrimers as transfection agents. The invention also provides transfection compositions in which a peptide is covalently linked to...

20060229247 - T. cruzi-derived neurotrophic agents and methods of use therefor: The invention relates to T. cruzi trans-sialidase (TS) and to the neurotrophic and IL-6 secretion-inducing activities of the protein. TS, neurotrophic variants and/or neurotrophic peptides based upon the sequence of TS can be administered to a mammal to directly or indirectly provide neurotrophic support for neurons. A mammalian neurotrophic factor...

20060229248 - Use of glp-1 compound for treatment of critically ill patients: Use of medicament for life saving treatment of critically ill patients and method of treatment. The medicament comprises a GLP-1 compound which effectively controls the blood glucose level....

20060229249 - Peptide substrates of a proteolytic adam33 polypeptide and assays using the same: The present invention discloses peptide substrates of a proteolytic ADAM33 polypeptide. The present invention also discloses methods of identifying additional substrates of a proteolytic ADAM33 polypeptide. Furthermore, the present invention discloses methods of identifying compounds that inhibit the proteolytic activity of a proteolytic ADAM33 polypeptide....

20060229250 - Ghrelin associated peptide and its uses: The invention relates to polypeptides referred to herein as obestatin. Obestatin, analogs and mimetics thereof act in signaling pathways, and are shown to modulate hypertension and other cardiovascular parameters, and gastric emptying....

20060229251 - Treatment of t cell disorders: The present invention relates to a method for treating a T cell disorder in a subject involving disrupting sex steroid signaling to the thymus and introducing into the subject bone marrow or haemopoietic stem cells (HSC)....

20060229252 - Antimicrobial hexapeptides: The invention encompasses hexapeptides consisting of alternating hydrophobic residues (B) at positions 2, 4, and 6, hydrophilic, hydrophilic, charged residues (X) at positions 1 and 3, and a naphthylalanine (Nal), an aliphatic or aromatic residue (O) at position five, represented generally by the formula XBXBOB, which exhibit antimicrobial activity against...

20060229253 - Pentapeptide compounds and uses related thereto: Pentapeptide compounds are disclosed. The compounds have biological activity, e.g., cytotoxicity. Prodrugs having targeting groups and pentapeptide moieties, as well as precursors thereof are also disclosed. For example, precursors having a reactive linker that can serve as a reaction site for joining to a targeting agent, e.g., an antibody, as...

20060229254 - Compounds having prolyl oligopeptidase inhibitory activity: wherein X, R1, R2 and R3 are as defined in the disclosure, or a pharmaceutically acceptable salt or ester thereof, useful as a prolyl oligopeptidase inhibitor. The compounds can be used for the treatment of diseases or conditions where prolyl oligopeptidase inhibitors are indicated to be effective, for example for...

20060229256 - Enternal administration of arginine and glutamine for abnormal vascular proliferation: The subject invention provides a method and compositions for preventing and/or treating abnormal vascular proliferation in a human infant where the method involves enterally administering arginine and glutamine to the infant in about equimolar amounts to provide a total amount of arginine and glutamine that is effective to prevent or...

20060229255 - Identification of n-alkylglycine trimers for induction of apoptosis: N-alkylglycine trimers with the capacity to arrest the cell cycle in human cancer cells and to induce apoptosis useful for the therapy of cancer. Combination of said N-alkylglycine trimers with taxol....

20060229257 - Multivalent metal salts of boronic acids: Salts of a pharmaceutically acceptable divalent metal and an organoboronic acid drug. Examples of such metals are calcium, magnesium and zinc. The organoboronic acid drug may be a boropeptide protease inhibitor. The salts may be formulated in oral dosage form....

20060229259 - Ai-2 compounds and analogs based on salmonella typhimurium lsrb structure: This invention relates to crystals comprising apo-LsrB and holo-LsrB. The structure of holo-LsrB identifies a tetrahydroxytetrahydrofuran derived from 4,5-dihydroxy-2,3-pentanedione (DPD) as the active autoinducer-2 (AI-2) molecule in Salmonella typhimurium. The X-ray crystallographic data can be used in a drug discovery method. Additionally the invention provides AI-2 analogs based on this...

20060229258 - Steroidal compositions containing hydroxycarboxylic acids and methods of using the same: Pharmaceutical compositions suitable for topical administration comprising two active ingredients, a hydroxycarboxylic acid and prednicarbate, and a pyrrolidone carboxylate salt moisturizing agent. In a particular aspect, the two active ingredients in the present inventive compositions have a purity of at least 90% and a concentration of degradation product(s) less than...

20060229260 - Substituted fused heterocyclic c-glycosides: This invention relates to substituted fused heterocyclic C-glycosides, compositions containing them, and methods of using them, for example, for the treatment or prophylaxis of diabetes and Syndrome X....

20060229261 - Acarbose methods and formulations for treating chronic constipation: The present invention is directed to a method for treating chronic constipation in a subject in need of such treatment comprising administering to the subject a dosage formulation comprising a therapeutically effective amount of acarbose, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable ingredient to control...

20060229262 - Pharmaceutical composition for treatment of infection with drug resistant bacterium and disinfectant: The present invention provides a pharmaceutical composition or a method for treatment of infections with a drug resistant bacterium including a flavonoid as an active ingredient, and also, a pharmaceutical composition or a method for treatment of infections with a drug resistant bacterium and a disinfectant including a flavonoid which...

20060229263 - Avermectin b1 monosaccharide derivatives: A compound of formula (I) wherein the bond between carbon atoms 22 and 23 may be a single or a double bond; R1 is C1-C12alkyl, C3-C8cycloalkyl, or C2-C12alkenyl; R2 and R3 are, for example, independently of each other hydrogen, C1-C12alkyl, C3-C12cycloalkyl, C2-C12alkenyl, C2-C12alkynyl, aryl or heteroaryl; and, where applicable, to...

20060229264 - Crystalline 6-n-pyridylmethylaminoindolocarbazole compounds: c

20060229265 - Nicotinamide riboside and analogues thereof: Provided herein are sirtuin-modulating compounds and methods of use thereof. The sirtuin-modulating compounds may be used for increasing the lifespan of a cell, and treating and/or preventing a wide variety of diseases and disorders including, for example, diseases or disorders related to aging or stress, diabetes, obesity, neurodegenerative diseases, cardiovascular...

20060229269 - Emergence of a r-type ca²+ channel (cav 2.3) contributes to cerebral artery constriction following subarachnoid hemorrhage: The invention relates to methods and products for treatment of a neurological defect such as a subarachnoid hemorrhage or cerebral vasospasm. Specifically, R-type voltage-gated calcium channel inhibitors and related compositions and kits are described....

20060229273 - High affinity oligonucleotide ligands to growth factors: Methods are described for the identification and preparation of high-affinity nucleic acid ligands to TGFβ, PDGF and hKGF. Included in the invention are specific RNA and ssDNA ligands to TGFβ1 and PDGF identified by the SELEX method. Also included in the invention are specific RNA ligands to hKGF identified by...

20060229272 - Human g-protein coupled receptor, hgprbmy11, and variants thereof: The present invention provides novel polynucleotides encoding HGPRBMY11 polypeptides, fragments and homologues thereof. The present invention also provides polynucleotides encoding variants of the HGPRBMY11 polypeptide, HGPRBMY11v1 and HGPRBMY11v2. Also provided are vectors, host cells, antibodies, and recombinant and synthetic methods for producing these polypeptides. The invention further relates to diagnostic...

20060229267 - Methods and compositions for the inhibition of gene expression: The present invention relates to methods and compositions for the inhibition of gene expression. In particular, the present invention provides oligonucleotide-based therapeutics for the inhibition of oncogenes involved in cancers....

20060229271 - Methods for treating infectious disease exacerbated asthma: The invention relates to methods of treating infectious disease exacerbated asthma. In particular, the methods are useful for treating viral exacerbated asthma using CpG oligonucleotides....

20060229270 - Methods of treating proteinuria by reducing double-stranded dna antibodies: The invention provides methods of treating proteinuria in an individual such as human by administering an effective amount of an agent that reduces the level of anti-dsDNA antibodies (such as a dsDNA epitope as in the form of an epitope-presenting carrier or an epitope-presenting valency platform molecule like LJP 394)...

20060229266 - Silencing of tgf-beta receptor type ii expression by sirna: The present application is directed to siRNA-based silencing of the type II receptor of TGFβ. siRNAs that target this receptor abrogate the receptor protein and transcript, TGFβ-mediated processes such as fibronectin assembly and cell migration also are inhibited and the molecules of the invention are efficacious in reducing the inflammatory...

20060229268 - Small interference rna (sirna) molecules for modulating superoxide dismutase (sod): The invention pertains to using double stranded ribonucleic acid molecules such as small interfering RNA (siRNA) molecules to target an SOD gene to interfere with gene expression and SOD protein production. Method are disclosed for inhibiting expression of a target protein in a subject with a neurological disorder by introducing...

20060229274 - Weight reduction and inhibition of hypertriglyceridemia medicine containing atp as effective ingredient: A weight reduction and inhibition of Hypertriglyceridemia medicine contain ATP as an effective ingredient, and more particularly to one that takes advantage of a cyclic adenosine monophosphate (Cyclic AMP) produced from the decomposed ATP in human body to promote the increase of lipase, thus to activate the metabolism and decomposition...

20060229275 - Production method of 2-deoxy-l-ribofuranosyl chloride compound: 2-Deoxy-L-ribofuranosyl chloride compounds may be produced on an industrial scale by dehalogenating a 2-deoxy-2-halo-L-arabinofuranose compound to give a 2-deoxy-L-ribofuranose compound, and then reacting this compound with a chlorinating agent....

20060229276 - Use of glycosoaminoglycans for the prevention and treatment of sepsis: The present invention discloses an unexpected use of glycosoaminoglycans such as low molecular weight heparin in the prevention and treatment of sepsis. Low molecular weight heparin is capable of preventing mortality and prolonging survival in a mouse model of S. aureus-induced septic death. Two other glycosaminoglycans, namely chondroitin sulfate A...

20060229279 - Artemisinins with improved stability and bioavailability for therapeutic drug development and application: A stable form of artemisinin wherein an artelinic acid or artesunic acid is complexed with cyclodextrin analogs, preferably, β-cyclodextrin. The complexed cyclodextrin artemisinin formulation shields the peroxide portion of the artemisinin backbone from hydrolytic decomposition rendering it stable in solution. Artelinic acid and cyclodextrin are placed into contact with one...

20060229278 - Mitoquinone derivatives used as mitochondrially targeted antioxidants: This invention relates to pharmaceutically acceptable amphiphilic antioxidant compounds, compositions and dosage forms comprising said compounds, and methods and uses reliant on said compounds. The compounds, compositions, dosage forms, uses and methods are useful in, for example, the treatment of diseases or conditions associated with oxidative stress....

20060229277 - Stabilized pharmaceutical compositions comprising an hmg-coa reductase inhibitor: The present invention relates to pharmaceutical compositions containing an HMG-CoA reductase inhibitor which are protected from destabilization in acidic environments by utilizing an inclusion complexing agent, and further relates to their preparation and to their use in the treatment of hypercholesterolemia and hyperlipidemia....

20060229280 - Endothelin antagonists: e

20060229281 - Cycloalkyl-hydroxyl compounds and compositions for cholesterol management and related uses: The present invention relates to novel cycloalkyl-hydroxyl compounds, compositions comprising hydroxyl compounds, and methods useful for treating and preventing a variety of diseases and conditions such as, but not limited to aging, Alzheimer's Disease, cancer, cardiovascular disease, diabetic nephropathy, diabetic retinopathy, a disorder of glucose metabolism, dyslipidemia, dyslipoproteinemia, hypertension, impotence,...

20060229282 - 7, 8 and 9-substituted tetracycline compounds: 7, 8 and 9-substituted tetracycline compounds, methods of treating tetracycline responsive states, and pharmaceutical compositions containing the 7, 8 and 9-substituted tetracycline compounds are described....

20060229283 - Cholesterol as an antibiotic for streptococcus pneumoniae: Topical application of cholesterol has been found to be effective in preventing, treating or ameliorating the damage to the cornea caused by Streptococcus pneumoniae. Topical administration of cholesterol caused a significant decrease in the inflammation of the eye. In addition, cholesterol was surprisingly found to be a bactericide to Streptococcus...

20060229284 - Enhanced occlusive effect photodynamic therapy: This invention discloses methods of treating neovasculature diseases of the eye through the administration of a photosensitizing agent and subsequent exposure to light of specific wavelength sufficient to photoactivate the photosensitizing agent to occlude one or more vessels in the neovasculature for an extended period of time. Diseases treatable under...

20060229285 - Crystal of intermediate for carbapenem: i

20060229286 - Compound inhibiting dipeptidyl peptidase iv: wherein R1 and R2 each represents hydrogen, an optionally substituted C1-6 alkyl group, or —COOR5 whereupon R5 represents hydrogen or an optionally substituted C1-6 alkyl group, or R1, R2, and a carbon atom together represent a 3- to 6-membered cycloalkyl group, R3 represents hydrogen or an optionally substituted C6-10 aryl...

20060229287 - Derivatives of [6,7-dihydro-5h-imidazo[1,2-a]imidazole-3-sulfonyl]-azetidine-carboxylic acids, esters and amides: Derivatives of 6,7-dihydro-5H-imidazo[1,2-a]imidazole-3-sulfonyl]-azetidine-carboxylic acids, esters and amides which exhibit good inhibitory effect upon the interaction of CAMs and Leukointegrins and are thus useful in the treatment of inflammatory disease....

20060229289 - 1h-benzimidazole-4-carboxamides substituted with a quaternary carbon at the 2-position are potent parp inhibitors: r

20060229288 - Inhibitors of phosphodiesterases in infertility: The present invention is directed to methods of increasing oocyte production in a mammal. More specifically, the specification describes methods and compositions for inducing follicular maturation using a PDE inhibitor. The inhibitor may be used alone at high doses. Alternatively, the follicular maturation is achieved by combining a low dose...

20060229290 - Staurosporine derivatives for hypereosinophilic syndrome: The present invention relates to the use of staurosporine derivatives for the preparation of a drug for the treatment of FIP1L1-PDGFRα-induced myeloproliferative diseases, especially for the curative and/or prophylactic treatment of hypereosinophilic syndrome and hypereosinophilic syndrome with resistance to imatinib, and to a method of treating hypereosinophilic syndrome and hypereosinophilic...

20060229291 - Concentrated, aqueous solutions of p-methoxybenzoic acid for use in cosmetic and dermatologic formulations: The present invention is related to concentrated aqueous solutions of p-methoxybenzoic acid and their production....

20060229292 - Method of treating childhood disorders: e

20060229293 - Compositions for the treatment of hepatitis c and methods for using compositions for the treatment of hepatitis c: The present invention pertains to a composition comprising Ibogaine, an indole alkaloid, its active salts and its principal metabolite noribogaine, a demethylated form of ibogaine, for the treatment of hepatitis C and hepatitis C related complications, administered in single or multiple dose regimens effective to reduce somatic complaints, liver enzyme...

20060229295 - Amide derivatives: There is provided a pharmaceutical drug, particularly a novel compound useful for prophylaxis or a therapeutic treatment of various diseases involving infections with viruses of the herpesvirus family, specifically various herpesvirus infections such as varicella (chicken pox) via varicella zoster virus, varicella zoster via recurrent infection with latent varicella zoster...

20060229296 - 2-phenyl-1-[4-(2-aminoethoxy)-benzyl]-indoles as estrogenic agents: e

20060229294 - Benzisothiazoles useful for treating or preventing hcv infection: The present invention relates to benzisothiazoles and pharmaceutical compositions thereof that inhibit replication and/or proliferation of HCV virus. The present invention also relates to the use of the benzisothiazoles and pharmaceutical compositions comprising the compounds to treat or prevent HCV infections....

20060229297 - (thio) carbamoyl-cyclohexane derivatives as d3/d2 receptor antagonists: wherein R1 and R2 represent independently a substituent selected from hydrogen, alkyl, aryl, cycloalkyl, aroyl, or R1 and R2 may form a heterocyclic ring with the adjacent nitrogen atom; X represents an oxygen or sulphur atom; n is an integer of from 1 to 2, and/or geometric isomers and/or stereoisomers...

20060229298 - Melanin concentrating hormone receptor ligands: substituted 1-benzyl-4-aryl piperazine analogues: Melanin concentrating hormone receptor ligands (especially 1-benzyl-4-aryl-piperazines, 1-benzyl-4-aryl-piperidines and related compounds), capable of modulating MCH receptor activity, are provided. Such ligands may be used to modulate MCH binding to MCH receptors in vivo or in vitro, and are particularly useful in the treatment of a variety of metabolic, feeding and...

20060229299 - 5ht2c receptor antagonists in the treatment of schizophrenia: The present invention relates to the use of certain 5-HT2C receptor antagonists in the manufacture of medicaments for the treatment of mental disorders, in particular aspects of schizophrenia, cognitive impairment and suicidality, as well as to methods for determining the suitability of compounds for such a use....

20060229300 - Method for the preparation of enantiomerically pure mirtazapine: The invention provides a method for the preparation of enantiomerically pure mirtazapine, said method comprising a step of ring closure of a compound of formula (II) wherein X is a leaving group, said step comprising treatment with an acid, whereby mirlazapine with enantiomeric excess is formed by the ring closure...

20060229301 - Spiro-piperidine compounds and medicinal use thereof: wherein R1 represents hydrogen, an aliphatic hydrocarbon group which may have a substituent(s) or a cyclic group which may have a substituent(s); and ring A represents a 5- to 8-membered cyclic group which may have a substituent(s), a salt thereof, an N-oxide thereof, a quaternary ammonium salt thereof or a...

20060229303 - Substituted quinobenzoxazine analogs: e

20060229302 - Tricyclic indole derivatives and their use in the treatment of alzheimer's disease: The present invention to novel hydroxyethylamine compounds having Asp2 (β-secretase, BACE1 or Memapsin) inhibitory activit, processes for their preparation, to compositions containing them and to their use in the treatment of diseases characterised by elevated β-amyloid levels or β-amyloid deposits, Particularly Alzheimer's disease....

20060229304 - (r)-chiral halogenated substituted fused heterocyclic amino compounds useful for inhibiting cholesterol ester transfer protein activity: The invention relates to substituted aryl and heteroaryl (R)-Chiral Halogenated 1-Substitutedamino-(n+1)-Alkanol compounds useful as inhibitors of cholesteryl ester transfer protein (CETP; plasma lipid transfer protein-I) and compounds, compositions and methods for treating atherosclerosis and other coronary artery diseases. Novel high yield, stereoselective processes for the preparation of the chiral substituted...

20060229305 - Tetrahydronaphthalene derivatives, process for their production and their use as anti-inflammatory agents: e

20060229306 - 4-aminothieno[2,3-d]pyrimidine-6-carbonitrile derivatives as pde7 inhibitors: New 4-aminothieno[2,3-d]pyrimidine-6-carbonitrile derivatives having the chemical structure of general formula (I), and pharmaceutically acceptable salts thereof are disclosed, as well as processes for their preparation and to pharmaceutical compositions containing them and their use in the treatment, prevention or suppression of pathological conditions, diseases and disorders susceptible of being improved...

20060229307 - Substituted-1-phthalazinamines as vr-1 antagonists: The present invention provides a compound of formula (I): in which Ar and R1 are phenyl or a heteroaromatic group, R2 is generally hydrogen, R3 is hydrogen or alkyl and X, Y and Z are generally CH or N as VR-1 antagonists; or a pharmaceutically acceptable salt thereof; pharmaceutical compositions...

20060229308 - Substituted pyrirmidin-4-ylamine analogues as vanilloid receptor ligands: Substituted pyrimidyl-4-ylamine analogues are provided, of the Formula: (I) wherein variables are as described herein. Such compounds are ligands that may be used to modulate Vanilloid receptor activity in vivo or in vitro, and are particularly useful in the treatment of conditions associated with pathological receptor activation in humans, domesticated...

20060229309 - Novel isophthalates as beta-secretase inhibitors: or a stereoisomer thereof; or a pharmaceutically acceptable salt thereof, wherein W, R3, R5 and R6 as defined herein, their pharmaceutical compositions and methods of use. These novel compounds inhibit the processing of amyloid precursor protein (APP) by β-secretase and, more specifically, inhibit the production of Aβ-peptide. The present disclosure...

20060229310 - Antibacterial compounds: Antibacterial compounds, processes for making them and intermediates used in the processes, compositions containing them, and methods for treatment of bacterial infections using them are disclosed....

20060229311 - Isatine derivatives with neurotrophic activity: The present invention relates to novel isatin derivatives, pharmaceutical compositions comprising the isatin derivatives of the invention, methods of preparing the isatin derivatives of the invention, their use in the treatment of neurodegenerative diseases and for the regeneration or prevention of degeneration of lesioned and damaged neurons, and methods of...

20060229312 - Quinoline and quinazoline derivatives having affinity for 5ht1-type receptors: e

20060229313 - Arylpiperazines and arylpiperidines and their use as metalloproteinase inhibiting agents:

20060229314 - Thienopyridinone derivatives as macrophage migration inhibitory factor inhibitors: including forms such as stereoisomers, free forms, pharmaceutically acceptable salts or esters thereof, solvates, or combinations of such forms, wherein n, R1, R2, R3, X, and Y are as defined herein. Compositions comprising an inhibitor of macrophage migration inhibitory factor in combination with a pharmaceutically acceptable carrier are also provided,...

20060229315 - 3-substituted quinoline-4-carboxamide derivatives as nk-3 and nk-2 receptor antagonists: A compound of formula (I) below or a pharmaceutically acceptable salt or solvate thereof:...

20060229316 - Novel antiinfective compounds, process for their preparation and pharmaceutical compositions containing them: The present invention describes novel antiinfective compounds, process for their preparation and pharmaceutical compositions containing them....

20060229317 - Substituted heterocyclic compounds: e

20060229318 - Piperazine compounds:

20060229319 - Enantiomers of 1-[(4-chlorophenyl) phenylmethyl)-4-[(4-methylphenyl)sulfonyl] piperazine: A method is disclosed for the treatment of an allergic condition associated with a cutaneous reaction induced by histamine. There is administered to a patient in need of such treatment the levorotatory dihydrochloride of 2-[2-[4-[(4-chlorophenyl)phenylmethyl]-1-piperazinyl]ethoxy] acetic acid....

20060229320 - Enantiomers of 1-[(4-chlorophenyl) phenylmethyl]-4-[(4-methylphenyl) sulfonyl] piperazine: The invention provides a method for the treatment of allergic conditions by administering to a patient an effective amount of dextrorotatory dihydrochloride of 2-[2-[4-[(4-chloro-phenyl)phenylmethyl]-1-piperazinyl]ethoxy]acetic acid. The treatment is conducted in the absence of levorotatory dihydrochloride of 2-[2-[4-[(4-chlorophenyl)phenylmethyl]-1-piperazinyl]ethoxy]acetic acid....

20060229322 - Anhydrous crystalline form of valacyclovir hydrochloride: Valacyclovir hydrochloride in anhydrous crystalline form having substantially the following d-spacing pattern (in angstroms) (see (I))....

20060229321 - Rosuvastatin in pre demented states: Provided is a method of preventing dementia in a patent comprising administering to a patient at risk of developing dementia an effective amount of rosuvastiatin or its pharmaceutically acceptable salt....

20060229324 - Quinazolin-4-one derivatives: wherein X represents a group represented by the formula —N═C(R5)— or the formula —NH—CH(R5)—, R1, R2, R3, and R4 represent a hydrogen atom, a halogen atom, a C1 to C6 alkyl group, or a hydroxy group, R5 represents a C1 to C6 alkyl group or a C6 to C10 aryl...

20060229323 - (3,4-dihydro-quinazolin-2-yl)-indan-1-yl-amines: e

20060229325 - N-aryl-sulfoximine-substituted pyrimidines as cdk-and/or vegf inhibitors, their production and use as pharmaceutical agents:

20060229326 - Pyridine-3-carboxamide derivatives as cb1 inverse agonists:

20060229327 - Therapeutic nucleosides: The use of a 1,3-oxathiolane nucleoside analogue and pharmaceutically acceptable derivatives thereof for the treatment of hepatitis B virus infections is disclosed. Pharmaceutical formulations are also provided....

20060229328 - 2-substituted pyrimidines: R3 is cyano, CO2Ra, C(═O)NRzRb, C(═O)—N—ORb, C(═S)—NRaRb, C(═NORa)NRzRb, C(═NRa)NRzRb, C(═O)NRa—NRzRb, C(═N—NRzRc)NRaRb, C(═O)Ra, C(═NORb)Ra, C(═N—NRzRb)Ra, CRaRb—ORz, CRaRb—NRzRc, ON(═CRaRb), O—C(═O)Ra, NRaRb′, NRa(C(═O)Rb), NRa(C(═O)ORb), NRa(C(═O)—NRzRb), NRa(C(═NRc)Rb), NRa(N═CRcRb), NRa—NRzRb, NRz—ORa, NRa(C(═NRc)—NRzRb), NRa(C(═NORc)Rb), processes for preparing these compounds, compositions comprising these compounds and their pesticidal use are described....

20060229330 - 4-aminopyrimidine-5-one derivatives: Novel intermediate compounds are disclosed. These compounds are useful in the synthesis of 4-aminopyrimidine-5-one derivatives that inhibit cyclin-dependent kinases, in particular cyclin-dependent kinase 4 (Cdk4). The 4-aminopyrimidine-5-one derivatives and their pharmaceutically acceptable salts have antiproliferative activity and are useful in the treatment or control of cancer, in particular solid tumors....

20060229329 - Pyrimidine derivatives possessing cell-cycle inhibitors activity: Compounds of the formula (I), and pharmaceutically acceptable salts and in vivo hydrolysable esters thereof are described. Also described are processes for their preparation and their use as medicaments, particularly medicaments for producing a cell cycle inhibitory (anti cell proliferation) effect in a warm blooded animal, such as man....

20060229331 - Ketoprofen compositions and methods of making them: A wide variety of pharmaceutically and commercially acceptable dosage forms of ketoprofen are prepared by dissolving ketoprofen in pharmaceutically acceptable solvents....

20060229332 - Crystalline form of a quinolinone-carboxamide compound: The invention provides a crystalline hydrochloride salt of 1-isopropyl-2-oxo-1,2-dihydroquinoline-3-carboxylic acid {(1S,3R,5R)-8-[(R)-2-hydroxy-3-(methanesulfonyl-methyl-amino)propyl]-8-azabicyclo[3.2.1]oct-3-yl}amide or a solvate thereof. The invention also provides pharmaceutical compositions comprising such crystalline salt forms, methods of using such crystalline salt forms to treat diseases associated with 5-HT4 receptor activity, and processes useful for preparing such crystalline salt forms....

20060229333 - Quinoline and isoquinoline derivatives, a process for their production and their use as inflammation inhibitors: e

20060229334 - Biphenyl derivatives: wherein R1, R2, R3, R4, R5, R6, R7, W, a, b and c are as defined in the specification, or a pharmaceutically acceptable salt or solvate or stereoisomer thereof. The biphenyl derivatives of this invention possess both β2 adrenergic receptor agonist and muscarinic receptor antagonist activity and therefore, such biphenyl...

20060229335 - Diarylamine and arylheteroarylamine pyrazole derivatives as modulators of 5ht2a: One aspect of the present invention relates to certain diarylamine and arylheteroarylamine pyrazole derivatives of Formula (A) and pharmaceutical compositions that modulate the activity of the human 5HT2A serotonin receptor. Compounds and pharmaceutical compositions are directed to methods useful in the prophylaxis or treatment of reducing platelet aggreagation, sleep disorders,...

20060229336 - Ccr5 antagonists as therapeutic agents: The present invention relates to compounds of formula (I) or a pharmaceutically acceptable derivatives thereof, useful in the treatment of prophylazis of CCR5-related diseases and disorders, for example, in the inhibition of HIV replication, the prevention or treatment of HIV infection, and in the treatment of the resulting acquired immune...

20060229337 - Certain substituted amides, method of making, and method of use thereof: and pharmaceutically acceptable salts, solvates, chelates, non-covalent complexes, prodrugs, and mixtures thereof is described herein. Pharmaceutical compositions comprising at least one chemical entity of the invention, together with at least one pharmaceutically acceptable vehicle chosen from carriers adjuvants, and excipients, are described. Methods of treating patients suffering from certain diseases...

20060229338 - 2,3'-bipyridines derivatives as selective cox-2 inhibitors: The present invention relates to 2,3′-bipyridines of formula (I), processes for their preparation, pharmaceutical compositions containing them, and their medical uses....

20060229339 - Novel use of substituted aminomethyl chromans: Compounds of formula I in which R has a meaning as indicated in claim 1, or one of their optical isomers or pharmaceutically acceptable salts, used for the treatment of extrapyramidal movement disorders and/or adverse effects in extrapyramidal movement disorders and/or for the treatment of extrapyramidal symptoms (EPS) induced by...

20060229340 - Composition for improving cognition and memory: The invention relates to a pharmacologically active combination, having utility in treating insomnia patients, which comprises: (a) at least one first active ingredient selected from melatonin, other melatonergic agents, melatonin agonists and melatonin antagonists; and (b) at least one second active ingredient selected from nicotine and nicotine receptor agonists; to...

20060229341 - Peptide deformylase inhibitors: Novel PDF inhibitors and novel methods for their use are provided....

20060229342 - Tnf-a production inhibitors: v

20060229343 - Pyrrolidine oxadiazole-and thiadiazole oxime derivatives being oxytocin receptor antagonists:

20060229344 - Method of treating amyotrophic lateral sclerosis: There is disclosed a method for treating Amyotrophic Lateral Sclerosis (ALS), comprising administering an effective amount of an anti-viral agent. Specifically, the anti-viral agent is directed to RNA type viruses. More specifically, the anti-viral agent is pleconaril and pharmacologically acceptable salts to treat ALS and other neurodegenerative diseases....

20060229345 - Compositions comprising epothilones and their use for the treatment of carcinoid syndrome: wherein A represents O or NRN, wherein RN is hydrogen or lower alkyl, R is hydrogen or lower alkyl, R′ is methyl, methoxy, ethoxy, amino, methylamino, dimethylamino, aminomethyl or methylthio, and Z is O or a bond, or a pharmaceutically acceptable salt thereof, alone or in combination with at least...

20060229346 - Method for treating vascular hyperpermeable disease: The present invention provides a method for treating a vascular hyperpermeable disease (except macular edema), which method comprises administering to a patient in need thereof a vascular adhesion protein-1 (VAP-1) inhibitor in an amount sufficient to treat said patient for said disease. The agents are 2-acylamino thiazole compounds....

20060229347 - Treatment of eczemas: The present invention relates to a novel principle of treating dermatological diseases comprising inhibiting several crucial steps in the inflammatory cascade including at least the inhibition of one or more of the enzymes Protein tyrosine kinase Syk, Protein tyrosine kinase ZAP-70 and phosphodiesterase IV (PDE-IV). The invention provides medicaments and...

20060229349 - 7-fluoro-1,3-dihydro-indol-2-one oxazolidinones as antibacterial agents: e

20060229348 - Oxindole oxazolidinone as antibacterial agent:

20060229350 - Losartan potassium crystalline form alpha: Losartan potassium crystalline Form α, a process for its preparation, a pharmaceutical composition therefrom, its use in therapy and in a purification process of losartan potassium....

20060229351 - 2-substituted-1 h-benzimidazile-4-carboxamides are parp inhibitors: s

20060229352 - Intermediate compounds for the preparation of trans-5-chloro-2-methyl-2,3,3a,12b-tetrahydro-1h-dibenz[2,3:6,7]oxepino[4,5-c]pyrrole:

20060229353 - Substituted heterocycles: The present invention relates to substituted heterocycles, processes for their preparation, and their use in medicaments, especially for the treatment of inflammatory disease, i.e. asthma, or cancer....

20060229355 - 3.3'-diindolylmethane compositions inhibit angiogenesis: The invention provides antiangiogenic compositions and methods of use. The general methods deliver an antiangiogen to a patient determined to be in need thereof, comprising the steps of: (a) administering to the patient a predetermined amount of an antiangiogenic, optionally substituted DIM; and (b) detecting in the patient a resultant...

20060229354 - Use of isatin in stimulating red blood cell production and treatment of anemia: The present invention concerns small chemical compounds—Isatin and its derivatives, and a novel, safer and more convenient methods for the treatment of anemia resulting from various underlying conditions or diseases. The invention provides new methods to stimulate red cell production, and the new methods to prevent the development of anemia....

20060229356 - Use of indomethacin and derivatives as broad-spectrum antiviral drugs and corresponding pharmaceutical compositions: Methods of treating viral disorders comprising administering indomethacin (INDO) and its derivatives and salts as antiviral drugs....

20060229357 - compounds: t

20060229358 - Pharmaceutical composition containing flavonoids: A pharmaceutical composition is provided, where the pharmaceutical composition contains formula (I), (II), or (III) flavonoids which possess selective phosphodiesterase 4 or 4/3 inhibition, as a main ingredient. Especially, this composition is used in the treatment of asthma, chronic obstructive pulmonary disease (COPD), or chronic inflammation, and has bronchodilatory effects....

20060229359 - Tocopherol-modified therapeutic drug compounds: Tocopherol-modified therapeutic drug compounds; emulsion, microemulsion, and micelle formulations that include the compounds; methods for making the compounds and formulations; methods for administering the compounds and formulations; and methods for treating conditions using the compounds and formulations....

20060229360 - Nontoxic potentiation/sensitization of cancer therapy by supplementary treatment with combined vitamins c and k3: A combination of Vitamin C and a quinone used as a supplemental treatment for a cancer patient. The combination may be administered before, during and after the patient undergoes a conventional cancer treatment protocol. The combination may be administered orally, intravenously, or intraperitoneally. Oral administration may be in the form...

20060229361 - Prodrugs of gaba analogs, compositions and uses thereof: The present invention provides prodrugs of GABA analogs, pharmaceutical compositions of prodrugs of GABA analogs and methods for making prodrugs of GABA analogs. The present invention also provides methods for using prodrugs of GABA analogs and methods for using pharmaceutical compositions of prodrugs of GABA analogs for treating or preventing...

20060229362 - Selective androgen receptor modulators and methods of use thereof: This invention provides a class of androgen receptor targeting agents. The agents define a new subclass of compounds, which are selective androgen receptor modulators (SARM)....

20060229363 - Substituted heteroaryl- and phenylsulfamoyl compounds: The present invention is directed at substituted heteroaryl and phenylsulfamoyl compounds, pharmaceutical compositions containing such compounds and the use of such compounds as peroxisome proliferator activator receptor (PPAR) agonists. PPAR alpha activators, pharmaceutical compositions containing such compounds and the use of such compounds to elevate certain plasma lipid levels, including...

20060229364 - Antiviral compositions and methods of use: Antiviral compositions, especially those useful when applied topically, particularly to mucosal tissues (i.e., mucous membranes), including, in particular, an antiviral lipid component, such as a fatty acid ester, fatty ether, or alkoxide derivative thereof. Such compositions provide effective topical antimicrobial activity and are accordingly useful in the treatment and/or prevention...

20060229365 - Aminotetralin derivatives as a medicament for the treatment and prevention of myocardial ischemic conditions: The use of 5,6-dihydroxy-2-methylaminotetralin (CHF 1035) and of 5,6-diisobutyroyloxy-2-methylaminotetralin (CHF 1024) for the preparation of a medicament for the treatment and prevention of myocardial ischemic conditions....

20060229366 - Method for preventing or treating respiratory infections in infants: The present invention is directed to a novel method for preventing or treating respiratory infections in infants. The method comprises administration of a therapeutically effective amount of DHA and ARA to the infant....

20060229367 - Flow path conditioner system: Compositions (3) and methods of using such compositions (3) to condition, clean, or disinfect the flow path of a conduit (8) of a microfluidic devices (16), such as flow cytometers or liquid chromatographs....

20060229368 - Medical application of oxidized monoterpenes: Preferred compositions used to inhibit the growth of bacteria, fungi and yeast include perillyl aldehyde as an active ingredient. Other active ingredients include perillyl alcohol. The compositions are formed as gels, creams, liquids and dry formulations....

  
10/05/2006 > 152 patent applications in 95 patent subcategories.

20060223740 - Absorption enhancers such as e.g. bht, bha or propyl gallate: The invention provides a pharmaceutical composition comprising a mixture of (a) an active macromolecular principle, and (b) an aromatic alcohol absorption enhancer chosen from butylated hydroxy toluene, butylated hydroxy anisole and analogues and derivatives thereof, wherein the aromatic alcohol absorption enhancer is present in an amount by weight greater than...

20060223741 - Method of treatment or prophylaxis: The present invention is directed to methods and agents that are useful in the prevention and amelioration of signs and symptoms associated with neuropathic conditions. More particularly, the present invention discloses the use of angiotensin II receptor 2 (AT2 receptor) antagonists for the treatment, prophylaxis, reversal and/or symptomatic relief of...

20060223742 - Clinical method for the immunomodulatory and vaccine adjuvant use of poly-iclc and other dsrnas: An improved understanding and method for the clinical adjuvant and immunomodulatory use of dsRNAs and ply-ICLC in particular, alone or in conjunction with other drugs and various vaccines designed to prevent or treat various microbial, viral, neoplastic, autoimmune diseases, and or degenerative diseases....

20060223743 - Metabolites of cyclosporin analogs: Isolated metabolites of the cyclosporine analog ISA247 are disclosed, including in vitro methods for their preparation. The metabolites comprise a chemical modification of ISA247, wherein the modification is at least one reaction selected from the group consisting of hydroxylation, N-demethylation, diol formation, epoxide formation, and intramolecular cyclization phosphorylation, sulfation, glucuronide...

20060223744 - Prostate specific antigens and uses thereof: o

20060223745 - Macrocyclic compounds having aspartic protease inhibiting activity and pharmaceutical uses thereof: The present invention relates to macrocyclic compounds of formula (I), wherein R1, is (C1-8)alkyl, (C1-4)alkoxy(C1-4)alkyl, hydroxy(C1-6)alkyl, (C1-4)alkylthio(C1-4)alkyl, (C1-6)alkenyl, (C3-7)cycloalkyl, (C3-7)cycloalkyl(C1-4)alkyl, piperidinyl or pyrrolidinyl, R2 and R4, independently, are hydrogen or optionally substituted (C1-8)alkyl, (C3-7)cycloalkyl, (C3-7)cycloalkyl(C1-4)alkyl, aryl, aryl(C1-4)alkyl, heteroaryl or heteroaryl(C1-4)alkyl, or R2 and R4, together with the nitrogen to which...

20060223746 - Methods and compositions for the treatment of diseases of the eye: Methods and compositions for prophylaxis and/or treatment of diseases of the eye of a patient resulting angiogenesis in the eye using antagonists of the integrin receptors αvβ3 and/or αvβ5. The compositions can be nanoparticles and are administered to the eye by injection into the sclera of the eye....

20060223747 - Therapeutic agent for soft tissue sarcoma: A therapeutic agent for soft tissue sarcoma (particularly synovial sarcoma) contains a histone deacetylase inhibitor (particularly compound of formula I) as an active ingredient...

20060223750 - Agents and methods for enhancing photodynamic therapy: A chemical conjugate for administration to a patient undergoing photodynamic therapy includes a photoactive compound coupled to a leakage reducing agent that is structured to reduce leakage of the photoactive compound from a patient's vasculature. The leakage reducing agent may be a bulking agent to reduce, for example, sterically reduce,...

20060223748 - Biologically active substance of a vasoactive intestinal peptide for treating interstitial lung infections: The invention describes for the first time the preclinical/cellular and clinical relevance of VIP, PACAP as well as of substances with the same biological activity as VIP and PACAP for the treatment of interstitial lung infections such as idiopathic pulmonary fibrosis, hypersensitive pneumonia or diffused panbronchiolitis. VIP and PACAP are...

20060223754 - Human tslp polynucleotides: The invention is directed to purified and isolated novel TSLP polypeptides, the nucleic acids encoding such polypeptides, processes for production of recombinant forms of such polypeptides, antibodies generated against these polypeptides, fragmented peptides derived from these polypeptides, and the uses of the above....

20060223753 - Igf-i and igf-2 chimeric polypeptides and therapeutic uses thereof: A chimeric protein comprising an IGF1 and an IGF2 component and optionally a fusion component (F) and/or a signal sequence, exhibiting improved activity relative to the native IGF1 or IGF2 polypeptide. The fusion component (F) may be a multimerizing component, a targeting ligand, or another active or therapeutic compound....

20060223749 - Inhibition of ship to enhance stem cell harvest and transplantation: The instant invention teaches the inhibition of SHIP expression, or function, for the increased efficacy of autologous stem cell transplants. In another embodiment, interference with SHIP function can be used to temporarily expand and mobilize the hematopoietic stem cell compartment to assist with leukapheresis, to promote hematopoietic recovery after myeloablation...

20060223751 - Polypeptides having antimicrobial activity and polynucleotides encoding the same: The present invention relates to isolated polypeptides having antimicrobial activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides....

20060223752 - Transport peptides such as c-terminal erns peptide and analogues thereof: The invention relates to peptides derived from or similar to the Erns protein of pestiviruses for type-specific diagnosis of infection, for eliciting antibiotic activity, and for transport of substances into a cell. For these purposes, the invention provides, among other things, an isolated, synthetic or recombinant protein or peptide module...

20060223755 - Peptide inhibitors of toxins derived from ll-37: The present invention relates to a group of peptidic compounds which have affinity for toxins and especially for bacterial toxins, such as lipopolysaccharide or lipoteichoic acid. These compounds can inhibit or neutralize the toxins. In addition, the present invention relates to the use of these compounds as therapeutic or diagnostic...

20060223756 - Endothelial cell specifically binding peptides: The present invention relates to peptides that specifically bind to endothelial cells. The peptides can be incorporated into gene delivery vector particles and can also direct therapeutic agents, including proteins such as growth factors and cytokines as well as small molecules. The vector particles, peptides, or small molecules can be...

20060223758 - Therapeutic agents and methods of use thereof for the modulation of angiogenesis: The present invention provides angiogenesis inhibitor compounds comprising a MetAP-2 inhibitory core coupled to a peptide, as well as pharmaceutical compositions comprising the angiogenesis inhibitor compounds and a pharmaceutically acceptable carrier. The present invention also provides methods of treating an angiogenic disease, e.g., cancer, in a subject by administering to...

20060223757 - Zinc finger binding domains for gnn: Zinc finger-nucleotide binding polypeptides having binding specificity for target nucleotides containing one or GNN triplets are provided. Compositions containing such polypeptides and the use of such polypeptides and compositions for regulating gene expression are also provided....

20060223760 - Compositions and methods for treatment of cancer: The present invention relates to pyrroloquinolinyl-pyrrole-2,5-dione compounds and pyrroloquinolinyl-pyrrolidine-2,5-dione compounds, and methods of preparation of these compounds. The present invention also relates to pharmaceutical compositions comprising pyrroloquinolinyl-pyrrole-2,5-dione compounds and pyrroloquinolinyl-pyrrolidine-2,5-dione compounds. The present invention provides methods of treating a cell proliferative disorder, such as a cancer, by administering to a...

20060223759 - Substituted 1,2-ethylenediamines, methods for preparing them and uses thereof: e

20060223761 - Methods and compounds for inhibiting beta-amyloid peptide release and/or its synthesis: Disclosed are compounds which inhibit β-amyloid peptide release and/or its synthesis, and, accordingly, have utility in treating Alzheimer's disease Also disclosed pharmaceutical compositions comprising a compound which inhibits β-amyloid peptide release and/or its synthesis as well as methods for treating Alzheimer's disease both prophylactically and therapeutically with such pharmaceutical compositions....

20060223763 - C-glycoside compounds for stimulating the synthesis of glycosaminoglycans: C-glycoside compounds are suited for stimulating the synthesis of glycosaminoglycans containing a D-glucosamine and/or N-acetyl-D-glucosamine residue, advantageously hyaluronic acid, and/or proteoglycans, advantageously proteoglycans containing hyaluronic acid, by fibroblasts and/or keratinocytes....

20060223762 - Treatment of migraine: A method for treating migraine in non-epileptic subjects which involves administering to subjects an effective amount of a pharmaceutical composition comprising a sulfamate of the following formula:...

20060223764 - Classes of compounds that interact with gpcrs: A method of inhibiting or effecting the activity of a GPCR which comprises contacting a GPCR with a compound of general formula 1, or a pharmaceutically acceptable salt thereof...

20060223765 - Method for inhibiting and/or treating vaginal infection: A method for inhibiting and/or treating infection in a vagina is provided. The method comprises exposing one or more microbes to a treatment composition. The microbes are selected from the group consisting of Gardnerella, Candida, and Trichomonas, and the treatment composition comprises an effective amount of a saccharide-based nonionic surfactant....

20060223766 - Epimerization of 4'-c bond and modification of 14-ch3-(co)-fragment in anthracyclin antibiotics: A method of synthesizing R1, R2-substituted-4′ (ax. or eq.)-OH anthracyclines and their corresponding salts of Formula (1) from daunorubicin or N-Trifluoroacetyl-4-R1-derivatives of daunorubicin, wherein R1 is defined as H, OH, and 4′-HO is defined as ax[ial]. The method includes producing N-Trifluoroacetyl daunorubicin and treating the N-Trifluoroacetyldaunorubicin or N-Trifluoroacetyl-4-R1-derivatives of daunorubicin,...

20060223778 - Circular nucleic acid vectors, and methods for making and using the same: Circular nucleic acid vectors that provide for persistently high levels of protein expression are provided. The circular vectors of the subject invention are characterized by being devoid of expression-silencing bacterial sequences, where in many embodiments the subject vectors include a unidirectional site-specific recombination product hybrid sequence in addition to an...

20060223777 - Highly functional short hairpin rna: The present invention provides improved hairpin and fractured hairpin constructs for use in gene silencing through the RNA interference pathway. An exemplary short hairpin polynucleotide for use in gene silencing can include a polynucleotide having from about 42 nucleotides to about 106 nucleotides configured for being processed by Dicer. The...

20060223770 - Irna agents targeting vegf: The features of the present invention relate to compounds, compositions and methods useful for modulating the expression of vascular endothelial growth factor (VEGF), such as by the mechanism of RNA interference (RNAi). The compounds and compositions include iRNA agents that can be unmodified or chemically-modified....

20060223779 - Method of screening for inhibitors of human fatty acid-coa ligase 4: The present invention provides a method of screening for potential cancer chemotherapeutic and chemopreventive agents which act by modulating the activity of the Fatty Acid-CoA Ligase 4 (FACL4) gene product in humans. This invention also provides methods of administering such agents to treat cancer by inhibiting the activity of the...

20060223776 - Microgel particles for the delivery of bioactive materials: Novel microgels, microparticles and related polymeric materials capable of delivering bioactive materials to cells for use as vaccines or therapeutic agents. The materials are made using a crosslinker molecule that contains a linkage cleavable under mild acidic conditions. The crosslinker molecule is exemplified by a bisacryloyl acetal crosslinker. The new...

20060223771 - Nuclear factor kappab inducing factor: The present invention is directed to nuclear factor κB (NFκB)-inducing factor polypeptides (NFIF polypeptides) which are capable of inducing NFκB. The present invention includes within its scope NFIF polypeptides, including NFIF-14b and NFIF-7a, DNA, including cDNA, encoding these polypeptides, and expression vectors capable of expressing NFIF polypeptides. Also included are...

20060223775 - Nucleotide sequence for treating cancer and infection: A nucleotide sequence comprising the nucleotide sequence of a virus belonging to the group of autonomous parvoviruses, and at least one effector nucleotide sequence which encodes an effector polypeptide capable of effecting the destruction or the normalization of cancer cells or cells infected by virus, bacteria, or intra-cellular infectious parasites....

20060223768 - Regulation of gene expression: The present invention relates to a method of regulating apoptosis. The method comprises the step of introducing into a cell an RNA construct comprising a nucleotide sequence which is homologous to mRNA within said cell. The mRNA within the cell includes genetic information of a gene element involved in the...

20060223773 - Rnai-mediated inhibition of frizzled related protein-1 for treatment of glaucoma: RNA interference is provided for inhibition of Frizzled Related Protein-1 mRNA expression, in particular, for treating patients having glaucoma or at risk of developing glaucoma....

20060223774 - Tissue-specific and pathogen-specific toxic agents, ribozymes, dnazymes and antisense oligonucleotides, and methods of use thereof: The present invention relates to the discovery, identification and characterization of toxic agents which are lethal to pathogens and methods for targeting such toxic agents to a pathogen or pathogen infected cells in order to treat and/or eradicate the infection. In particular, the present invention relates to toxic agents which...

20060223769 - Vaccines using nucleic acid-lipid complexes: This invention relates to a vaccine and a method for immune activation which is effective for eliciting both a systemic, non-antigen specific immune response and a strong antigen-specific immune response in a mammal. The method is particularly effective for protecting a mammal from a disease including cancer, a disease associated...

20060223767 - Vector for gene therapy and method of quantifying target protein in mammal or cultured cells with the administration of the vector for gene therapy: Disclosed is a vector for gene therapy, by which the blood level of a desired protein can be monitored at high sensitivity when a gene therapy is conducted, wherein the label peptide does not have a physiological activity and has no immunogenicity in many mammals. The vector for gene therapy...

20060223772 - Vectors comprising guinea pig cmv regulatory elements: The invention comprises novel polynucleotides, and related vectors, host cells, methods, and compositions, containing transcriptional enhancers providing very high levels of expression of operably-linked expressible nucleic acid sequences in eukaryotic cells. Advantageously the enhancers may be used in combination with their naturally-associated promoters and/or other genetic elements that increase transcription....

20060223780 - Method for administration of capecitabine: There is provided a new dosage regimen for capecitabine which maximizes anti-tumor activity while maintaining acceptable toxicity levels....

20060223781 - Process for induction of intramolecular migration of sulfates, phosphates, and other oxyanions: This present invention provides methods for structural modification of a molecule containing a hydroxyl group and an oxyanion amide or oxyanion ester group on adjacent or nearby atomic positions. The oxyanion, such as sulfate and phosphate, can be transferred to the hydroxyl group when the molecule is treated with a...

20060223782 - 2-methylene-19-nor-(23s)-25-dehydro-1alpha-hydroxyvitamin d3-26,23-lactone and 2-methylene-19-nor-(23r)-25-dehydro-1alpha-hydroxyvitamin d3-26,23-lactone: Compounds of formula 1A and 1B are provided where X1 and X2 are independently selected from H or hydroxy protecting groups. Such compounds may be used in preparing pharmaceutical compositions and are useful in treating a variety of biological disorders....

20060223783 - 3,4-disubstituted coumarin and quinolone compounds: The present invention relates to 3,4-disubstituted coumarin and quinolone derivatives and processes for their preparation. The invention also related to methods for treating infection of Hepatitis C virus by administering a 3,4-disubstituted coumarin or quinolone derivative....

20060223784 - Method and compositions for temporarily incapacitating subjects: A method for modifying at least one non-ester-containing parent compound, and the compounds produced using such method, which compounds are deployed to temporarily incapacitate at least one subject are disclosed. The modified compounds are rapidly metabolized to inactive and non-toxic metabolites when exposure to the modified compounds is halted. One...

20060223785 - Andrographolide derivatives to treat viral infections: The present invention provides a methods and compositions for treating a host afflicted with a viral infection, particularly a Flaviviridae infection, including hepatitis C infection, comprising administering an effective antiviral amount of a derivative of andrographolide alone or in combination or alternation with another antiviral compound....

20060223786 - Transdermal pain control method and device: Compositions comprising skin-permeable pharmaceutically effective amounts of an opioid agonist; an N-methyl-D-aspartate receptor antagonist and an anti-inflammatory may be incorporated into formulations and devices suitable for transdermal delivery of the active ingredients to alleviate pain....

20060223787 - Modified release formulations and methods of treating inflammatory bowel disease: Methods and formulations for treating inflammatory bowel disease are disclosed. The methods and formulations include, but are not limited to, methods and formulations for delivering effective concentrations of 4-aminosalicylic acid and/or 5-aminosalicylic acid, and pharmaceutically acceptable salts and pro-drugs thereof, to affected areas of the intestine, i.e., distal gut. The...

20060223788 - Analgesic composition for topical use: An analgesic composition, is disclosed which comprises a mixture of piroxicam, dexamethasone, ketamine, lidocaine injection, dimethyl sulfoxide, gabapentin and Vanicream™, preferably in the form of a cream or ointment. The composition is applied topically for the relief of pain of arthritis, neuropathy, post-herpetic (shingles) conditions, sore muscles, tendons and ligaments,...

20060223789 - Antibacterial substituted 7-acylamino-3-(methylhydrazono) methyl-cephalosporins and intermediates:

20060223790 - Modulation of microglial by nicotinic medications: A method of treating a subject suffering from a neurodegenerative disease by modulating microglial activation with a therapeutically effective amount of a cholinergic agonist and a cholinesterase inhibitor. In one embodiment of the invention, the cholinergic agonist is nicotine and the cholinesterase is galantamine (a relatively weak acetylcholinesterase inhibitor and...

20060223791 - O-desmethylvenlafaxine and bazedoxifene combination product and uses thereof: A combination product containing at least two active compounds, O-desmethylvenlafaxine or a pharmaceutically acceptable salt thereof and bazedoxifene or a pharmaceutically acceptable salt thereof is described. Also described are methods of making and using this combination product to treat a variety of conditions associated with low circulating estrogen levels or...

20060223792 - Phenyl and pyridyl lta4h modulators: Leukotriene A4 hydrolase (LTA4H) inhibitors, compositions containing them, and methods of use for the inhibition of LTA4H enzyme activity and the treatment, prevention or inhibition of inflammation and inflammatory conditions....

20060223793 - Use of dopamine d3 receptor ligands for the production of drugs for treating renal function disorders: The invention relates to the use of dopamine D3 receptor ligands for the production of drugs for treating renal function disorders....

20060223795 - Novel diazabicyclononene derivatives: The invention relates to novel 3,9-diazabicyclo[3.3.1]nonene derivatives and related compounds and their use as active ingredients in the preparation of pharmaceutical compositions. The invention also concerns related aspects including processes for the preparation of the compounds, pharmaceutical compositions containing one or more of those compounds and especially their use as...

20060223794 - Novel olanzapine forms and related methods of treatment: The invention provides novel soluble olanzapine forms. These forms include salts, co-crystals, and solvates of olanzapine. The invention also provides novel pharmaceutical compositions comprising these novel soluble forms and related methods of treatment. Compositions and methods of the invention of the invention are useful in the treatment of psychosis and...

20060223796 - Novel compounds for use in weight loss and appetite suppression in humans: Phenolic compounds with a phenolic molecule to which are covalently linked an oxygen-containing group, a nitrogen or another oxygen containing group, and a C1-C4 alkoxy group, obtainable from monocotyledonous plants, or by chemical synthesis, have been found to act as weight loss agents, appetite suppressants, mood enhancers and adjunctive therapy...

20060223797 - Alkynyl pyrrolopyrimidines and related analogs as hsp90-inhibitors: Alkynyl pyrrolo[2,3-d]pyrimidines and related analogs are described and demonstrated to have utility as Heat Shock Protein 90 (HSP90) inhibiting agents used in the treatment and prevention of various HSP90 mediated disorders. Methods of synthesis and use of such compounds are also described and claimed....

20060223800 - Pyrazolopyridines and pyrazolopyridazines adn antidiabetics: or a derivative thereof wherein Y is CH or N; R1 is unsubstituted or substituted alkyl, unsubstituted or substituted cycloalkyl, unsubstituted or substituted alkenyl, unsubstituted or substituted cycloalkenyl, unsubstituted or substituted aryl, aralkyl wherein the aryl and the alkyl moieties may each independently be unsubstituted or substituted, aralkenyl wherein the...

20060223799 - Pyrrolo[2,3-d]imidazoles for the treatment of hyperproliferative disorders: or a pharmaceutically acceptable salt or N-oxide thereof, are useful in the treatment of tumors and cancers....

20060223798 - Tetrahydrothiopyrano pyrazole cannabinoid modulators:

20060223802 - Derivatives of n-[phenyl(pyrrolidine-2-yl)methyl]benzamide and n-[(azepan-2-yl)phenylmethyl]benzamide, preparation method thereof and application of same in therapeutics: are useful for treating behavioral disorders associated with dementia, psychoses, in particular schizophrenia (deficient form and productive form) and acute or chronic extrapyramidal symptoms induced by neuroleptics; for the treatment of various forms of anxiety, panic attacks, phobias, and compulsive obsessive disorders; for treating various forms of depression, including psychotic...

20060223801 - Pyrrol derivatives with antibacterial activity: Compounds of Formula (1) and their pharmaceutically acceptable salts are described: Formula (1) Processes for their preparation, pharmaceutical compositions containing them, their use as medicaments and their use in the treatment of bacterial infections are also described....

20060223805 - Arylalklcarbamate derivatives, preparation method thereof and use of same in therapeutics: m

20060223806 - Microbicidal composition based on formaldehyde donor compounds and antioxidants: Microbicidal composition for product preservation, including a microbicidal composition which comprises a) at least one formaldehyde donor compound and b) at least one antioxidant chosen from gallic esters, phenol derivatives, L-ascorbic acid, and salts and derivatives thereof, and tocopherols and derivatives thereof, and to the use thereof for the preservation...

20060223804 - Nk1 antagonists: c

20060223803 - Process for resolving aimines that are useful for the treatment of disorders associated with insulin resistance syndrome: The present invention is directed towards a process for resolving a racemic amino compound derived from dihydro-1,3,5-triazines. The invention is also directed towards the enantiomers of amino derivatives of dihydro-1,3,5-triazines and to their use for the preparation of medicaments, in particular for the treatment of diabetes and malaria....

20060223809 - Novel compounds: The invention relates to thienopyridazinones of formula (I): wherein: R1 is C1-6 alkyl, C2-6 alkenyl or C3-6 cycloalkyl which is optionally substituted by C1-6 alkyl, each of the above being optionally substituted by one or more halogen atoms; R2 is C1-6 alkyl; R3 is a group CO-G or SO2-G where...

20060223808 - Spirocyclic thrombin receptor antagonists: represents an optional double bond, the dotted line is optionally a bond or no bond, resulting in a double bond or a single bond, as permitted by the valency requirement and wherein An, En, Mn, Un, Gn, Jn, Kn, R9, R10, R11, R32, R33, B and Het are herein defined...

20060223807 - Therapeutic methods for type i diabetes: The invention relates to the treatment and prevention of type I diabetes. More specifically, the invention relates to compounds that treat or prevent the body's immune system from destroying β-cells (i.e., insulin-producing cells in the pancreatic islets of Langerhans) by inhibition of JNK2, selective inhibition of JNK2, or inhibition of...

20060223810 - Bicyclic pyrazole compounds as antibacterial agents: Antibacterial compounds, compositions containing them, and methods of use for the inhibition of bacterial activity and the treatment, prevention or inhibition of bacterial infection....

20060223811 - Triglycerine depressant composition: A blood triglyceride depressant composition which comprises pravastatin and one or more members selected from the group consisting of (1) pantethine, (2) inositol hexanicotinate, (3) a combination drug containing a riboflavin compound, a tocopherol compound and an ascorbic acid compound, and (4) a combination drug containing a tocopherol compound and...

20060223812 - Treating neurodegenerative conditions: The present invention relates to the use of compounds capable of inhibiting protein aggregate formation and capable of depolymerising protein aggregates for the preparation of a pharmiaceutical composition for treating neurodegenerative conditions such as Alzheimer disease....

20060223814 - Nk-2 antagonist basic linear compounds and formulations containing them: The present invention describes compounds with formula (I) having linear structure basic properties useful as NK-2 antagonists; pharmaceutical compositions containing said compounds are also described and processes for their preparation....

20060223813 - Piperazine derivatives and methods of use: The invention provides 2-carboxamide piperazine compounds of formula I, R3. I N\′ N˜′ R2I(0)z- o R4 I wherein R′, R2, R3 and R4 are as defined in the claims and methods of treatment and pharmaceutical compositions that utilize or comprise one or more such compounds. Compounds of the invention are...

20060223815 - Therapeutic agents comprising an anti-angiogenic agent in combination with an src-inhibitor and their therapeutic use: The invention relates to the use of an anti-angiogenic agent in combination with an inhibitor of the Src family of non-receptor tyrosine kinases in the manufacture of a medicament for use in the substantially normotensive treatment in a warm-blooded mammal such as a human being of a disease state associated...

20060223817 - Crystalline imatinib base and production process therefor: Provided is crystalline imatinib base form I and processes for producing crystalline imatinib base form I, which is suitable for preparing imatinib salts such as, e.g., the mesylate salt. Also provided is a process for producing a salt of imatinib from crystalline imatinib base form I....

20060223816 - Imatinib mesylate alpha form and production process therefor: Provided is a process for preparing crystalline imatinib mesylate in substantially pure α-form, which preferably includes crystallizing imatinib mesylate from an organic solvent containing imatinib and methanesulfonic acid, and seed crystals of imatinib mesylate α-form, wherein the seed crystals are added before imatinib mesylate begins to precipitate from the mixture....

20060223818 - N-phenyl-2-pyrimidine-amine derivatives: o

20060223819 - Quinoline derivatives as nk-3 antagonists: Certain compounds of formula (I) below or a pharmaceutically acceptable salt or hydrate thereof: a process for preparing such compounds, a pharmaceutical composition comprising such compounds and the use of such compounds and composition in medicine....

20060223820 - Crystalline aripiprazole salts and processes for preparation and purification thereof: Provided are novel crystalline carboxylic acid salts of aripiprazole, methods of using such salts, and processes for producing such salts....

20060223822 - Dehydrophenylahistins and analogs thereof and the synthesis of dehydrophenylahistins and analogs thereof: as are methods for making such compounds, wherein said methods comprise reacting a diacyldiketopiperazine with a first aldehyde to produce an intermediate compound; and reacting the intermediate compound with a second aldehyde to produce the class of compounds with the generic structure, where the first aldehyde and the second aldehydes...

20060223823 - Dehydrophenylahistins and analogs thereof and the synthesis of dehydrophenylahistins and analogs thereof: as are methods for making such compounds, wherein said methods comprise reacting a diacyldiketopiperazine with a first aldehyde to produce an intermediate compound; and reacting the intermediate compound with a second aldehyde to produce the class of compounds with the generic structure, where the first aldehyde and the second aldehydes...

20060223821 - Piperidinyl piperazine derivatives useful as inhibitors of chemokine receptors: as inhibitors of the CCR5 receptors, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment, prevention, inhibition, or amelioration of one or more diseases associated with CCR5 using such compounds or...

20060223824 - Serotonergic agents:

20060223825 - Piperazinyl substituted cyclohexane-1,4-diamines: and pharmaceutically acceptable forms thereof, as α1a/α1d adrenoreceptor modulators for the treatment of benign prostatic hypertrophy and lower urinary tract symptoms. The present invention also relates to pharmaceutical compositions comprising said new compounds, new processes to prepare these new compounds and new uses as a medicine as well as methods...

20060223827 - Bioreductively activated stilbene prodrugs: A compound of formula (1), or a pharmaceutically acceptable salt thereof, wherein Ar is a substituted heteroaryl group bearing at least one nitro or azido group or is a group of formula (2) or (3); R1 is hydrogen, optionally substituted alkyl, optionally substituted aryl or optionally substituted heteroaryl; R2 is...

20060223826 - Indole derivatives as somatostatin agonists or antagonists: The present invention provide a compound of the formula (I) wherein ring A represents an aromatic ring optionally having substituents; B, Y and Ya are the same or different and each represents a bond, etc.; R1 and R2 are the same or different and each represents a hydrogen atom, etc.;...

20060223828 - Substituted chroman derivatives: wherein aryl is a heteromatic ring containing one or two heteroatoms selected from N, O and S and which may be mono- or di-substituted with R4 and/or R5; and n is 0-4; as (R)-enantiomers, (S)-enantiomers or racemates in the form of a free base or a pharmaceutically acceptable salt or...

20060223829 - Hydroxysteroid dehydrogenase inhibitors: e

20060223830 - Indanyl-piperazine compounds:

20060223831 - Bromide and its crystal: The 1-(2-methoxyethyl)-2-methyl-4,9-dioxo-3-(pyrazin-2-ylmethyl)-4,9-dihydro-1H-naphtho[2,3-d]imidazol-3-ium bromide of the invention and its crystals, particularly α- and β- form Crystals, have no hygroscopic property, have excellent stability and therefore are useful as production materials of medicines. Particularly, the β- form Crystal is most stable and markedly useful as a bulk for medicines....

20060223832 - Fused heterocyclic succinimide compounds and analogs thereof, modulators of nuclear hormone receptor function: Fused cyclic compounds, methods of using such compounds in the treatment of nuclear hormone receptor-associated conditions such as cancer and immune disorders, and pharmaceutical compositions containing such compounds....

20060223833 - Thiazolidinones, their production and use as pharmaceutical agents: s

20060223835 - 2' and 3'- substituted cyclobutyl nucleoside analogs for the treatment of viral infections and abnormal cellular proliferation: Provided are cyclobutyl nucleosides and methods for their use in treatment of infections including Retroviridae (including HIV), Hepadnaviridae (including HBV), or Flaviviridae (including BVDV and HCV) infection, or conditions related to abnormal cellular proliferation, in a host, including animals, and especially humans....

20060223834 - Diketo acids on nucleobase scaffolds as inhibitors of flaviviridae: A new class of diketo acids constructed on nucleobase scaffolds, designed as inhibitors of HCV replication through inhibition of HCV NS5B RNA polymerase, is described. These compounds are useful in the prevention or treatment of infection by HCV and in the treatment of other Flaviviridae infections, either as the compounds,...

20060223836 - New phenylalanine derivatives: Specified phenylalanine derivatives and analogues thereof have an antagonistic activity to α4 integrin. They are used as therapeutic agents for various diseases concerning α4 integrin....

20060223837 - Biaryl derived amide modulators of vanilloid vr1 receptor: The invention is directed to novel vanilloid receptor type 1 (VR1) ligands. More specifically, the invention relates to novel biaryl-derived amides that are potent antagonists or agonists of VR1. Pharmaceutical and veterinary compositions and methods of treating mild to severe pain and various diseases using compounds of the invention are...

20060223838 - Methods and compositions for the treatment of hyperlipidemia: Methods and compositions containing a berberine compound or berberine related or derivative compound are provided for the prevention and treatment of hyperlipidemia, elevated cholesterol, and/or cardiovascular disease in mammalian subjects. The methods and compositions of the invention are effective for prevention and treatment of atherosclerosis, coronary artery disease, angina pectoris,...

20060223839 - 5-(1',1'-cycloalkyl/alkenyl)methylidene 1,2-dihydro-5h-chromeno-[3,4-f]-quinolines as selective progesterone receptor modulator compounds: The present invention is directed to compounds, pharmaceutical compositions and methods for modulating processes mediated by Progesterone Receptor. Also provided are methods of making such compounds and pharmaceutical compositions....

20060223841 - Stable pharmaceutical compositions of desloratadine and processes for preparation of polymorphic forms of desloratadine: Provided are stable pharmaceutical compositions of desloratadine. Also provided are processes for preparing polymorphs of desloratadine...

20060223840 - Substituted piperidine compounds and methods of their use: Certain 4-aryl-piperidine compounds, including N-substituted 9β-substituted-5-(3-substituted-phenyl)morphans and N-substituted octahydro-4a-(3-hydroxyphenyl)-10a-methyl-benzo[g]isoquinolines, pharmaceutical compositions, and methods of their use, inter alia, as opioid antagonists are disclosed....

20060223842 - 2-aryl-acetic acids, their derivatives and pharmaceutical compositions containing them: Selected 2-arylacetic acids, their derivatives and pharmaceutical compositions that contain these compounds are useful in inhibiting chemotactic activation of neutrophils (PMN leukocytes) induced by the interaction of Interleukin-8 (IL-8) with CXCR1 and CXCR2-membrane receptors. The compounds are used for the prevention and treatment of pathologies deriving from said activation. In...

20060223843 - Substituted 1,5-naphthyridine azolinones: Substituted 1,5-naphthyridine azolinones inhibit Cdk1 and are selective against Cdk2 and Cdk4. These compounds and their pharmaceutically acceptable salts have antiproliferative activity and are useful as anti-cancer agents....

20060223845 - Clopidogrel base suitable for pharmaceutical formulation and preparation thereof: Provided is clopidogrel base suitable for pharmaceutical formulation, and processes for its preparation....

20060223844 - Mitotic kinesin inhibitors: The present invention relates to bicyclic tetrahydropyridine compounds that are useful for treating cellular proliferative diseases, for treating disorders associated with KSP kinesin activity, and for inhibiting KSP kinesin. The invention also related to compositions which comprise these compounds, and methods of using them to treat cancer in mammals....

20060223846 - Aza-bridged-bicyclic amino acid derivatives as alpha4 integrin antagonists: and pharmaceutically acceptable salts thereof. The compounds are useful α4 integrin receptor antagonists and, in particular, α4β1 and α4β7 integrin receptor antagonists. The invention is further directed to methods for use of the instant compounds for treating integrin mediated disorders including, but not limited to, inflammatory disorders, autoimmune disorders and...

20060223847 - Anti-coronavirus drug: The present invention provides an anti-coronavirus agent including as an active ingredient as exemplified by nelfinavir and salts thereof, an anti-SARS agent including the anti-coronavirus agent, and a method of treating SARS using the anti-SARS agent....

20060223849 - Benzazole derivatives, compositions, and methods of use as beta-secretase inhibitors: The present invention is directed to benzazole compounds that inhibit β-site amyloid precursor protein-cleaving enzyme (BACE) and that may be useful in the treatment or prevention of diseases in which BACE is involved, such as Alzheimer's disease. The invention is also directed to pharmaceutical compositions comprising these compounds and the...

20060223848 - Caspase inhibitors containing isoxazoline ring: The present invention relates to an isoxazoline derivative as an inhibitor against various caspases, a process for preparing the same, and a therapeutic composition for preventing inflammation and apoptosis comprising the same...

20060223850 - 8-(3-biaryl)phenylquinoline phosphodiesterase-4 inhibitors: Novel substituted 8-phenylquinolines represented by Formula (I), wherein the phenyl group at the 8-position contains an aryl or heteroaryl substituent in the meta position, are PDE4 inhibitors....

20060223851 - Triamide-substituted heterobicyclic compounds: v

20060223852 - Pyrazoles:

20060223853 - Substituted heterocyclic compounds for treating multidrug resistance:

20060223854 - Tetrahydroquinoline derivatives useful as serine protease inhibitors: or a stereoisomer or pharmaceutically acceptable salt form thereof, wherein the variables A, B, L1, L2, X1, X2, X3, X4, R4, R5, R13, R14, R15 and R16 are as defined herein. The compounds of Formula (I) are useful as selective inhibitors of serine protease enzymes of the coagulation cascade and/or...

20060223855 - Methods and compositions for treating amyloid-related diseases: Methods, compounds, pharmaceutical compositions and kits are described for treating or preventing amyloid-related disease....

20060223856 - Piperidinyl piperidine derivatives useful as inhibitors of chemokine receptors: as inhibitors of the CCR5 receptors, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment, prevention, inhibition, or amelioration of one or more diseases associated with CCR5 using such compounds or...

20060223858 - Biphenyl derivatives: wherein R1, R2, R3, R4, R5, R6, R7, W, a, b and c are as defined in the specification, or a pharmaceutically acceptable salt or solvate or stereoisomer thereof. The biphenyl derivatives of this invention possess both β2 adrenergic receptor agonist and muscarinic receptor antagonist activity and therefore, such biphenyl...

20060223859 - Biphenyl derivatives: wherein R1, R2, R3, R4, R5, R6, R7, W, a, b and c are as defined in the specification, or a pharmaceutically acceptable salt or solvate or stereoisomer thereof. The biphenyl derivatives of this invention possess both β2 adrenergic receptor agonist and muscarinic receptor antagonist activity and therefore, such biphenyl...

20060223860 - Biphenyl derivatives: wherein R1, R2, R3, R4, R5, R6, R7, W, a, b and c are as defined in the specification, or a pharmaceutically acceptable salt or solvate or stereoisomer thereof. The biphenyl derivatives of this invention possess both β2 adrenergic receptor agonist and muscarinic receptor antagonist activity and therefore, such biphenyl...

20060223857 - Combination of a serotonin reuptake inhibitor and a glycine transporter type 1 inhibitor for the treatment of depression: The present invention relates to the use of a compound, which is a serotonin reuptake inhibitor, and a compound, which is a GlyT-1 inhibitor for the preparation of a pharmaceutical composition for the treatment of depression, anxiety disorders and other affective disorders. In particular the present invention relates to treatment...

20060223861 - Derivatives of n-[phenyl(alkylpiperidine-2-yl)methyl]benzamide, preparation method thereof and application of same in therapeutics: are useful for treating behavioral disorders associated with dementia, psychoses, in particular schizophrenia (deficient form and productive form) and acute or chronic extrapyramidal symptoms induced by neuroleptics; for the treatment of various forms of anxiety, panic attacks, phobias, and compulsive obsessive disorders; for treating various forms of depression, including psychotic...

20060223862 - Diagnosis and treatment of human kidney diseases: Kidney disease is diagnosed by measuring urinary catalytic iron in humans. Progressive kidney disease is treated by administering an iron chelator to humans. In particular, the progression of kidney disease essentially can be halted and the severity of kidney disease can be reduced by the administration of iron chelators to...

20060223863 - Methods for treating hepatitis c: In accordance with the present invention, compounds that inhibit viral replication, preferably Hepatitis C Virus (HCV) replication, have been identified, and methods for their use provided. In one aspect of the invention, compounds useful in the treatment or prevention of a viral infection are provided. In another aspect of the...

20060223864 - Thiadiazoles as cxc- and cc- chemokine receptor ligands: and the pharmaceutically acceptable salts and solvates thereof. Examples of groups comprising Substituent A include heteroaryl, aryl, heterocycloalkyl, cycloalkyl, aryl, alkynyl, alkenyl, aminoalkyl, alkyl or amino. Examples of groups comprising Substituent B include aryl and heteroaryl. Also disclosed is a method of treating a chemokine mediated diseases, such as, cancer,...

20060223865 - Therapeutic combination: This invention relates to pharmaceutical combinations of amlodipine or a pharmaceutically acceptable acid addition salt thereof and atorvastatin or a pharmaceutically acceptable salt thereof, kits containing such combinations and methods of using such combinations to treat subjects suffering from angina pectoris, atherosclerosis, combined hypertension and hyperlipidemia and to treat subjects...

20060223867 - Cancer treatment with epothilones: The invention relates to the treatment of a proliferative disease, especially according to certain treatment regimens, with an epothilone, especially with epothilone A and more preferably epothilone B; as well as to the treatment of certain cancers with such an epothilone....

20060223866 - Methods and compositions for modulating sphingosine-1-phosphate (s1p) receptor activity: The present invention relates to compounds which modulate the activity of the S1P1 receptor, the use of these compounds for treating conditions associated with signaling through the S1P1 receptor, and pharmaceutical compositions comprising these compounds....

20060223869 - Compounds for the reduction of excessive food intake: The invention relates to the use of dopamine receptor agonists for preparing a pharmaceutical composition for the reduction of excessive food intake....

20060223868 - Heterocyclic amides exhibiting and inhibitory activity at the vanilloid receptor 1(vr1): e

20060223870 - Solid preparation comprising an insulin sensitizer, an insulin secretagogue and a polyoxyethylene sorbitan fatty acid ester: A solid preparation useful as a diabetes-treating agent or the like and excellent in the dissolution properties of an insulin sensitizer and an insulin secretagogue, which comprises an insulin sensitizer, an insulin secretagogue and a polyoxyethylene sorbitan fatty acid ester is provided....

20060223871 - Thiophene-and thiazolesulfonamides as antineoplastic agents: s

20060223872 - Insecticidal phthalamide derivatives:

20060223873 - Isoxazole derivatives and methods of treating nitric oxide mediated diseases: A series of isoxazole derivatives and methods of suppressing, inhibiting, or preventing disorders mediated by nitric oxide (NO) and/or proinflammatory cytokines, such as TNF-α (tumor necrosis factor alpha), IL-1 (interlukin-1), and IL-6, are described....

20060223874 - Heterocyclic reverse transcriptase inhibitors: The present invention provides compounds for treating or preventing an HIV infection, or treating AIDS or ARC comprising administering a compound according to formula I where R1, R2 and R3, are as defined herein....

20060223875 - Methods and compositions for production, formulation and use of 1-aryl-3-azabicyclo[3.1.0]hexanes: The invention provides novel 1-aryl-3-azabicyclo[3.1.0]hexanes that are active for modulating biogenic amine transport, along with compositions and methods for using these compounds to treat central nervous system disorders. Certain 1-aryl-3-azabicyclo[3.1.0]hexanes are provided that have at least one substituent on the aryl ring. In other embodiments 1-aryl-3-azabicyclo[3.1.0]hexanes are provided that have...

20060223876 - Indoloquinone tumor radiation sensitization: This invention generally relates to Indoloquinone caused tumor radiation therapy sensitization. More specifically, this invention relates to the discovery of indoloquinones as a radiation sensitizer (radiation therapy adjuvant) due to its ability to selectively target hypoxic cells and to damage the DNA of these hypoxic cells. Indoloquinones do so with...

20060223877 - Methods of treatment utilizing certain melatonin derivatives: A method for treating anxiety disorders, affective disorders, intracranial injury, spinal cord injury, neurodegenerative diseases, sclerosis, migraine, fibromyalgia and cerebrovascular disease, using melatonin derivatives is disclosed. A specific melatonin derivative for use in the disclosed process is 13-methyl-6-chloromelatonin (otherwise referred to as (R)-N-[2-(6-chloro-5-methoxy-1H-indol-3-yl)propyl]acetamide)....

20060223878 - Formulations containing insect repellent compounds: Dihydronepetalactone, a minor natural constituent of the essential oil of catmints (Nepeta spp.) such as Nepeta cataria, has been identified as an effective insect repellent compound. Synthesis of dihydronepetalactone may be achieved by hydrogenation of nepetalactone, the major constituent of catmint essential oils. This compound, and compositions thereof, which also...

20060223879 - Non-steroidal farnesoid x receptor modulators: The efficient regulation of cholesterol synthesis, metabolism, acquisition, and transport is an essential component of lipid homeostasis. The farnesoid X receptor (FXR) is a transcriptional sensor for bile acids, the primary product of cholesterol metabolism. Accordingly, the development of potent, selective, small molecule agonists, partial agonists, and antagonists of FXR...

20060223880 - Methods of protecting against radiation injury: Administration of a modulator of cell cycle checkpoint activation, which is preferably β-lapachone, or a pharmaceutically acceptable salt, prodrug, metabolite, analog or derivative thereof, protects normal cells against radiation injury. The invention includes methods of preventing radiation damage. The invention also provides methods for treating conditions such as cancer with...

20060223881 - Use of gamma- tocopherol and its oxidative metabolite llu-alpha in the treatment of disease: The present invention is generally related to the discovery of the therapeutic benefit of administering γ-tocopherol and γ-tocopherol derivatives. More specifically, the use of γ-tocopherol and racemic LLU-α, (S)-LLU-α, or γ-tocopherol derivatives as antioxidants and nitrogen oxide scavengers which treat and prevent high blood pressure, thromboembolic disease, cardiovascular disease, cancer,...

20060223882 - Amorphous simvastatin: Amorphous simvastatin is prepared by rapidly removing solvent from a solution comprising simvastatin. The solution can also comprise a pharmaceutically acceptable carrier, to form a dispersion of amorphous simvastatin in the carrier....

20060223883 - Novel hydroxylated enantiomers of (-) 3a,6,6,9a-tetramethylperhydronaphtho[2,1-b]furan as perfuming agents derived from a fungal fermentation process.: (−) 3a,6,6,9a-tetramethylperhydronaphtho[2,1-b]furan (ambrox) is a strong aromatic compound used widely in a variety of perfumery applications and is highly prized for its musky odor. We report novel polar metabolites of (−)3a,6,6,9a-tetramethylperhydronaphtho[2,1-b]furan prepared by a novel process of microbial fermentation using a fungi, Fusarium lini, of unique structures that would be...

20060223884 - Compounds and compositions for use in the prevention and treatment of obesity and related syndromes: The invention relates to 4-hydroxyisoleucine, isomers, analogs, lactones, salts, and prodrugs thereof, to processes for their preparation, and to pharmaceutical compositions comprising the same. More particularly, the invention relates to the use of those compounds in the prevention and treatment of obesity and related syndromes....

20060223885 - Derivatives of n-phenyl (piperidine-2-yl) methyl benzamide, preparation method thereof and applications of same in therapeutics: are useful for treating behavioral disorders associated with dementia, psychoses, in particular schizophrenia (deficient form and productive form) and acute or chronic extrapyramidal symptoms induced by neuroleptics; for the treatment of various forms of anxiety, panic attacks, phobias, and compulsive obsessive disorders; for treating various forms of depression, including psychotic...

20060223886 - Derivatives of n-[heteroaryl(piperidine-2-yl) methyl]benzamide, preparation method thereof and application of same in therapeutics: are useful for treating behavioral disorders associated with dementia, psychoses, in particular schizophrenia (deficient form and productive form) and acute or chronic extrapyramidal symptoms induced by neuroleptics; for the treatment of various forms of anxiety, panic attacks, phobias, and compulsive obsessive disorders; for treating various forms of depression, including psychotic...

20060223887 - Method for treating acute pancreatitis: Disclosed is a method for treating acute pancreatitis in a subject. The method comprises the step of administering to the subject an effective amount of an ester of an alpha-ketoalkanoic acid or an amide of an alpha-ketoalkanoic acid....

20060223888 - Valproic acid analogues and pharmaceutical composition thereof: Analogues of valproic acid useful in treating neuroaffective disorders including convulsions, bipolar disorder, and migraine headache are disclosed. The analogues are halide liver substituted analogues, cyclic analogues, and conjugated diene analogues of valproic acid. Pharmaceutical compositions or prodrugs containing the analogues or pharmaceutically acceptable salts thereof are disclosed. Methods of...

20060223889 - Veterinary aqueous injectable suspensions containing florfenicol: This invention relates to pharmaceutical compositions for veterinary use in form of aqueous injectable suspensions comprising Florfenicol or Florfenicol in form of a substantially water-insoluble complex, co-crystal or salt, sterile and micronised, in a concentration up to 500 mg/ml. The suspensions enable parenteral antimicrobial therapies in animals, with limited numbers...

20060223890 - N-arylsulfonyl-3-substituted indoles having serotonin receptor affinity, process for their preparation and pharmaceutical composition containing them: N-arylsulfonyl-3-substituted indole compounds, derivatives, analogs, tautomeric forms, stereoisomers, geometric forms, N-oxides, polymorphs and pharmaceutically acceptable salts....

20060223891 - Use of alverine, alone or in combination with a tricyclic antidepressant or an antidepressant which is a specific inhibitor of serotonin reuptake for treatment of depression: The present invention relates to the utilisation of Alverine or its metabolites, alone or in combination with a tricyclic antidepressant or a specific inhibitor antidepressant of serotonin recapture, for the preparation of pharmaceutical compositions for the treatment of depression....

Previous industry: Perfume compositions
Next industry: Colloid systems and wetting agents; subcombinations thereof; processes of


######

RSS FEED for 20091112: - PDF
Integrate FreshPatents.com into your RSS reader/aggregator or website to track weekly updates.
For more info, read this article.

######

Thank you for viewing Drug, bio-affecting and body treating compositions patents on the FreshPatents.com website. These are patent applications which have been filed in the United States. There are a variety ways to browse Drug, bio-affecting and body treating compositions patent applications on our website including browsing by date, agent, inventor, and industry. If you are interested in receiving occasional emails regarding Drug, bio-affecting and body treating compositions patents we recommend signing up for free keyword monitoring by email.



###

FreshPatents.com Support

Results in 2.7825 seconds

filepatents (1K)

* Easy, fast online form
* Protect your Inventions
* US Patent Office filing

Provisional Patent
Utility Patent

- - - - - - - - - - - - - - - - - - - - - -

filetrademarks (1K)

* Fast online form
* Protect your Name/Design
* US Government filing

Trademark Services

- - - - - - - - - - - - - - - - - - - - - -

PATENT INFO