|
FREE patent keyword monitoring and additional FREE benefits. |
![]() |
|
|
USPTO Class 514 | Browse by Industry: Previous - Next | All 10/2006 | Recent | 08: Feb | Jan | | 07: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | | 06: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | Drug, bio-affecting and body treating compositions inventions 10/06Recently published patent applications awaiting approval from the USPTO. Recent week's RSS XML file available below.Listing format for abstract view: USPTO application #, Title, Abstract excerpt,Patent Agent. Listing format for list view: USPTO National Class full category number, title of the patent application. 10/26/2006 > patent applications in patent subcategories. 20060241015 - Cancer genes: The present invention relates to all facets of novel polynucleotides, the polypeptides they encode, antibodies and specific binding partners thereto, and their applications to research, diagnosis, drug discovery, therapy, clinical medicine, forensic science and medicine, etc. The polynucleotides are differentially expressed in prostate and breast cancers and are therefore useful... 20060241016 - Extraction process: A process for isolating low molecular weight (“LMW”) peptides from tissue in situ comprising the steps: a) homogenizing the tissue; b) mixing the homogenized tissue with an organic solvent to form a fully-wetted slurry; c) standing or agitating the slurry to denature the proteins in situ within the tissue; d)... 20060241017 - Novel compounds with high therapeutic index: The present invention is directed to novel therapeutic compounds comprised of an amino acid bonded to a medicament or drug having a hydroxy, amino, carboxy or acylating derivative thereon. These high therapeutic index derivatives have the same utility as the drug from which they are made, and they have enhanced... 20060241018 - Linkers for radiopharmaceutical compounds: A new and improved method for extending the half life of pharmaceutical compounds for use in diagnostic imaging or therapy uses a novel linker to attach a diagnostic or therapeutic moiety to a targeting peptide or another diagnostic or therapeutic moiety. The resulting compound may have the general formula M-N-O-P-Q,... 20060241019 - Long lasting insulin derivatives and methods thereof: The present invention relates to an insulin derivative comprising an insulin molecule and a reactive group for covalently bonding a blood component, wherein preferably the insulin molecule is human natural insulin molecule and the reactive group is coupled to an amino acid of the insulin molecule at a position selected... 20060241021 - Methods of treating cognitive dysfunction by modulating brain energy metabolism: Methods for treating cognitive dysfunction by modulating brain energy metabolism are discussed.... 20060241020 - Protein tyrosine phosphatase inhibitors: The invention relates to phosphopeptides inhibiting protein tyrosine phosphatases, and their uses.... 20060241025 - Biodegradable glucosamine-muramyl peptides for apoptosis modulation: The present invention includes apoptosis modulating glucosamine-muramyl-peptides, obtained by specific endopeptidase digestion of gram positive bacteria, methods of preparation of thereof and medical food compositions for management and treatment of conditions caused by TNF alpha cytotoxicity.... 20060241024 - Intermediate for preparing glycopeptide derivatives: This invention provides 9-fluorenylmethoxycarbonyl compounds that are useful as intermediates for preparing glycopeptide antibiotics.... 20060241023 - Methods for alleviating deleterious effects of 3-deoxyglucosone: Disclosed is a class of compounds which inhibit the enzymatic conversion of fructose-lysine into fructose-lysine-3-phosphate in an ATP dependent reaction in a recently discovered metabolic pathway. According to the normal functioning of this pathway, fructose-lysine-3-phosphate (FL3P) is broken down to form free lysine, inorganic phosphate and 3-deoxyglucosone (3DG), the latter... 20060241022 - Selectin targeting bioconjugates: The present invention provides novel compositions comprising one or more selectin binding molecule covalently linked to a hydrophilic polymer, pharmaceutical compositions thereof, and methods for their use in treating anti-inflammatory disorders.... 20060241026 - Novel cyclic peptides and use thereof as anti-microbial agents: The invention relates to compounds selected from: peptides having formula (1): C(s)—X1—X2—X3—X4—X5—X6—X7-C(s), wherein the two cysteine residues are linked by means of a disulphide bridge which is represented by symbol C(s) and X1, X2, X3X4, X5, X6 and X7 denote amino acids selected from a determined list; and derivatives of... 20060241039 - Amino acid-substituted coagulation factor v: There is provided FV derivatives that reduce blood clotting activity, by reducing thrombin generation, when compared to wild-type FV. In particular, the FV of the present invention comprises single-point and multi-point mutations, encompassed by aspartic acid 79 to glutamic acid 119. The derivatives can be used to treat patient with... 20060241031 - Assay: An assay method for an anti-bacterial agent comprising: (a) providing as a first component protein SIC; (b) providing as a second component an antibacterial peptide; (c) contacting the first component with a test substance in the presence of the second component; and (d) determining the interaction or activity of the... 20060241043 - Bacillus cry9 family members: The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of Bacillus thuringiensis encoding δ-endotoxins having pesticidal activity against insect pests, including Lepidoptera. Particular embodiments of the invention provide isolated nucleic acids encoding pesticidal proteins, pesticidal compositions, expression cassettes, and transformed microorganisms and plants comprising a nucleic... 20060241044 - Bacillus cry9 family members: The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of Bacillus thuringiensis encoding δ-endotoxins having pesticidal activity against insect pests, including Lepidoptera. Particular embodiments of the invention provide isolated nucleic acids encoding pesticidal proteins, pesticidal compositions, expression cassettes, and transformed microorganisms and plants comprising a nucleic... 20060241042 - Calcineurin activators: A calcineurin activator, comprising the following protein (a) or (b) as an active ingredient and having the action of increasing intracellular calcium ion concentration through the influx of calcium ions into eukaryotic cells: (a) a killer protein (KLKP), being composed of 3 subunits consisting of amino acid sequences represented by... 20060241037 - Compositions comprising trefoil factor family peptides and/or mucoadhesives and proton pump ihhibitor prodrugs: Disclosed are methods of preventing or treating a disease or adverse condition affecting the gastrointestinal tract of a mammal which comprise orally administering to a mammal a therapeutically effective amount of a prodrug of a proton pump inhibitor and an effective amount of a trefoil family factor peptide, mucoadhesive agent,... 20060241047 - Fsh formulation: This invention relates to FSH or a FSH variant containing an alpha and beta subunit contained in formulations, and articles of manufacture. The invention provides advantageous new proteins and nucleic acids, multi-use pharmaceutical solutions, formulations and products of said proteins and nucleic acids where none approved for commercial use had... 20060241041 - Fvii or fviia gla domain variants: Gla domain variants of human Factor VII or human Factor VIIa, comprising 1-15 amino acid modifications relative to human Factor VII or human Factor VIIa, wherein a hydrophobic amino acid residue has been introduced by substitution in position 34; or having an amino acid substitution in position 36; and use... 20060241027 - Hiv inhibiting proteins: The invention relates to proteins comprising HIV fusion inhibiting peptides, such as T-20 and/or T-1249 peptides (including, but not limited to, fragments and variants thereof), which exhibit anti-retroviral activity, fused to albumin (including, but nbot limited to fragments or variants of albumin). These fusion proteins are herein collectively referred to... 20060241029 - Hypocretin administration as a treatment for obesity: The invention provides compositions and methods for treatment and prophylaxis of weight disorders. Such methods entail administering to an individual a therapeutically or prophylactically effective dosage regime of a hypocretin or an agonist thereof, and monitoring the condition of the individual responsive to the administering.... 20060241030 - Irs modulators: This invention is directed to a general method for the chronic treatment, potential cure, or prevention of various metabolic and related diseases in people, including diabetes, by modulating IRS2 activity in cells and tissues in the body. IRS1 and IRS2 are part of the insulin or insulin-like growth factor signaling... 20060241046 - Linear gamma-carboxyglutamate rich conotoxins: The invention relates to linear y-carboxyglutamate rich conotoxins, derivatives or pharmaceutically acceptable salts thereof, and uses thereof, including the treatment of neurologic and psychiatric disorders, such as anticonvulsant agents, as neuroprotective agents or for the management of pain. The invention further relates to nucleic acid sequences encoding the conopeptides and... 20060241033 - Markers for pre-cancer and cancer calls and the method to interfere with cell proliferation therein: A novel family of human mitochondrial RNAs, referrred to as chimeric RNAs, which are differentially expressed in normal, pre-cancer and cancer cells, are described. Oligonucleotides targeted to the chimeric RNAs are provided. The described oligonucleotides or their analogs can be used for cancer diagnostics and cancer therapy as well as... 20060241034 - Means for preventing and treating cellular death and their biological applications: Inhibitors for preventing, blacking/silencing caspase-2 activity in cell death.... 20060241045 - Method for producing preparation containing bioactive substance: A method for producing a preparation containing a bioactive substance, characterized in that it comprises forming a solid material containing the bioactive substance and a polymer, and contacting the solid material with a high pressure gas. The method allows the production of a preparation which is suppressed in excessive initial... 20060241040 - Methods of treating disorders associated with toll-like receptor 4 (tlr4) signalling: Described herein are methods and compositions for treating, preventing, and diagnosing disorders associated with TLR4 signalling, e.g., gram negative bacterial infection and sterile inflammations such as rheumatoid arthritis.... 20060241032 - Rgd-enriched gelatine-like proteins with enhanced cell binding: The invention concerns a cell support comprising an RGD-enriched gelatine that has a more even distribution of RGD sequences than occurring in a natural gelatine and with a minimum level of RGD sequences. More precise the percentage of RGD sequences related to the total number of amino acids is at... 20060241036 - Soluble human interleukin 18 receptor-alpha, method of assaying the same, assay kit and medicinal composition: [PROBLEMS] To confirm the presence of a solubilized human IL-18 receptor-α by a novel ELISA method and provide an assay kit and a medicinal composition containing the solubilized human IL-18 receptor-α as the active ingredient. [MEANS FOR SOLVING PROBLEMS] A solubilized human interleukin-18 receptor-α, a method of assaying the solubilized... 20060241038 - Therapeutic agent for abeta related disorders: The present invention provides a pharmaceutical composition comprising at least one member selected from a compound capable of enhancing Aβ37 production, a compound capable of inhibiting Aβ40 and Aβ42 production and enhancing Aβ37 production, and salts of the compounds and hydrates thereof.... 20060241028 - Use of compounds having the biological activity of vasoactive intestinal peptide for the treatment of sarcoidosis: The present invention relates to peptides which arm highly biologically and pharmacologically active as therapeutic drug for the treatment of diseases related to sarcoidosis. The peptides which can be used according to the invention for the treatment of said disease comprise at least one specific highly conservative amino acid residue... 20060241035 - Use of dg153 secreted protein products for preventing and treating pancreatic disease and/or obesity and/or metabolic syndrome: The present invention discloses proteins secreted by the developing pancreas, and polynucleotides, which identify and encode these proteins. The invention also relates to the use of these sequences in the diagnosis, study, prevention, and treatment of pancreatic diseases (e.g. diabetes), obesity, and/or metabolic syndrome.... 20060241050 - Inhibiting furin with polybasic peptides: Small, polybasic peptides are disclosed that are effective as furin inhibitors, e.g. hexa- to nona-peptides having L-Arg or L-Lys in most positions. Removing the peptide terminating groups can improve inhibition of furin. High inhibition was seen in a series of non-amidated and non-acetylated polyarginines. The most potent inhibitor identified to... 20060241048 - Modified therapeutic agents: The invention provides a modified therapeutic agent, said modified agent comprising three or more membrane binding elements with low membrane affinity covalently associated with the agent which elements are capable of interacting independently and with thermodynamic additivity, with components of cellular or artificial membranes exposed to extracellular fluids wherein at... 20060241049 - Use of thrombin-derived peptides for the therapy of chronic dermal ulcers: Disclosed is a method of promoting healing of a chronic dermal skin ulcer, such as a diabetic ulcer, on a subject. The method comprises the step of contacting the chronic dermal skin ulcer with an effective amount of an agonist of the non-proteolytically activated thrombin receptor.... 20060241052 - Facially amphiphilic polymers and oligomers, compositions thereof, and use thereof in methods of treating cancer: The present invention discloses compositions of facially amphiphilic polymers and oligomers and their use in methods for treating or reducing cancers in humans or animals.... 20060241051 - Metastin derivatives and use thereof: The present invention provides a metastin derivative in which the amino acids comprising metastin were modified by alternative chemical substituents resulting in metastin derivitives, having excellent blood stability and exhibiting cancer metastasis inhibiting action or cancer growth inhibiting action.... 20060241053 - Compounds and their analgesic applications: Application of peptides with analgesic properties as the active ingredient in devices for the direct application of medication to the site of their expected analgesic activity, particularly in the central nervous system.... 20060241054 - Growth hormone-releasing peptides in the treatment of prevention of atherosclerosis and hypercholesterolemia: According to the invention there is provided a method of treatment or prophylaxis of atherosclerosis, hypercholesterolemia or a cardiovascular disease associated with atherosclerosis, which method comprises administration of one or more Growth Hormone Releasing Peptides (GHRPs) to a patient in need of such treatment or prophylaxis. There are also provided... 20060241055 - Peptides promoting cell adherence, growth and secretion: The present invention provides specific peptides identified as having cell adhesion, growth, expression or secretion-enhancing activities. Many of the peptides of the invention may be produced in large quantity by such means as chemical synthesis or recombinant DNA methodology. They may be non-specifically adsorbed, or chemically attached to a surface... 20060241056 - Potent and specific immunoproteasome inhibitors: Compounds and methods of selectively inhibiting an immunoproteasome are described. Also described are methods of treating a cancer, an inflammation, and/or an autoimmune disease and methods of suppressing endogenous antigenic peptide generation by administering to a subject in need of treatment thereof a therapeutic amount of an immunoproteasome specific inhibitor.... 20060241057 - Peptidyl allyl sulfones: The present disclosure provides compositions for inhibiting proteases, methods for synthesizing the compositions, and methods of using the disclosed protease inhibitors. Aspects of the disclosure include peptidyl allyl sulfone compositions that inhibit proteases, for example cysteine proteases, either in vivo or in vitro.... 20060241058 - Acetyl l-carnitine for prevention of painful peripheral neuropathy in patients with type 2 diabetes: Acetyl L-carnitine, or of one of its pharmaceutically acceptable salts, is useful for the prevention of painful peripheral neuropathy in patients suffering from type 2 diabetes, in which symptoms are pain, paraesthesia or hyperaesthesia. The acetyl L-carnitine is administered orally at a dose of at least 3 grams/day.... 20060241059 - Treatments for viral infections: The present invention relates to improved methods and compositions for treating viral infections and other diseases and conditions that induce a cytokine storm. More particularly, the present invention relates to novel compositions comprising quercitin, and an anti-convulsant, such as phenytoin, in combination with mulivitamins as an anti-viral composition and methods... 20060241060 - 10-substituted macrolide antibiotics: The invention provides antibiotic 10-desmethyl macrolides.... 20060241061 - Stable aqueous solution of natamycin fungicide: The present invention provides an aqueous composition comprising—water; —a water miscible solvent; —and a polyene fungicide which is dissolved in the water and water miscible solvent. The present invention further provides a method for the production of the composition of the invention. The composition of the invention may be used... 20060241062 - Method involving pde4, compositions, and the screening thereof, for the treatment of degenerative ocular pathologies: The invention relates to the field of biology, genetics and medicine. In particular, the invention relates to novel methods for the detection, characterization and/or treatment (or management) of neurodegenerative pathologies. The invention also relates to methods for the identification or screening of compounds active in the aforementioned pathologies. The invention... 20060241063 - Novel uses of neuraminidase inhibitors in infectious diseases: The present invention relates to methods of decreasing the infectivity, morbidity and rate of mortality, in treating diseases associated with a variety of pathogenic organisms, specifically diseases involving one or more pathogens that require neuraminidase as a virulence factor. In addition, the present invention uses biology based therapy to treat... 20060241064 - Nucleoside compounds for treating viral infections: Disclosed are compounds, compositions and methods for treating viral infections caused by a Flaviviridae family virus, such as hepatitis C virus.... 20060241065 - Ring-expanded nucleosides and nucleotides: The present invention relates to compositions comprising analogues of purine nucleosides containing a ring-expanded (“fat”) heterocyclic ring, in place of purine, and an unmodified or modified sugar residue, pharmaceutically acceptable derivatives of such compositions, as well as methods of use thereof. In particular, these compositions may be utilized in the... 20060241070 - Antisense oligonucleotides directed to ribonucleotide reductase r2 and uses thereof in the treament of cancer: The present invention provides antisense oligonucleotides directed to a mammalian ribonucleotide reductase R2 gene and combinations of the antisense oligonucleotides with one or more chemotherapeutic agents for use in the treatment of cancer.... 20060241066 - Decoy composition for treating and preventing inflammatory disease: It is intended to efficiently treat an inflammatory disease without causing side effects. This object can be achieved by providing a medicinal composition for treating and preventing an inflammatory disease and disorders, and disorders caused by the disease and disorders which contains at least one decoy of NF-κB or an... 20060241071 - Functional synthetic molecules and macromolecules for gene delivery: The present invention describes a synthetic non-viral vector composition for gene therapy and the use of such compositions for in vitro, ex vivo and/or in vivo transfer of genetic material. The invention proposes a pharmaceutical composition containing 1) a non-cationic amphiphilic molecule or macromolecule and its use for delivery of... 20060241073 - Means and methods for counteracting fatty acid accumulation: The invention provides a method for, at least, in part, counteracting a disease involving accumulation of a fatty acid, the method comprising administering a compound which is capable of inducing and/or upregulating omega-oxidation of the fatty acid, or whose metabolite is capable of inducing and/or upregulating omega-oxidation of the fatty... 20060241067 - Methods for inhibiting angiogenesis, cell migration, cell adhesion, and cell survival: The invention relates to methods for detecting and inhibiting angiogenesis, cell migration, cell adhesion, and/or cell survival in endothelial and non-endothelial cells as well as in normal and tumor cells. The invention further relates to methods for screening test compounds for their ability to inhibit angiogenesis, cell migration, cell adhesion,... 20060241074 - Methods for treatment of pain: The present invention relates to a method for the treatment or prevention of pain by administering to an animal an agent that decreases the activity of the complement cascade.... 20060241076 - Modified oligoribonucleotide analogs with enhanced immunostimulatory activity: The invention provides immunostimulatory compositions and methods for their use. In particular, the immunostimulatory compositions of the invention include RNA-like polymers that incorporate an immunostimulatory sequence motif and at least one chemical modification to confer improved stability against nuclease degradation and improved activity. Specific modifications involving phosphate linkages, nucleotide analogs,... 20060241068 - Novel actin-associated cytosekeltone protein lacs: The present invention provides the novel actin-related cytoskeletal protein LACS and genes encoding the protein.... 20060241072 - Oligomeric compounds for use in gene modulation: The present invention provides modified oligomeric compounds and compositions of oligomeric compounds for use in the RNA interference pathway of gene modulation. The modified oligomeric compounds include siRNA and asRNA having at least one affinity modification. The present invention also provides methods for modulating gene expression using the modified oligomeric... 20060241075 - Rna interference mediated inhibition of desmoglein gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating Desmoglein (e.g, DSG1, DSG2, DSG3, and/or DSG4) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways of... 20060241069 - Treatment of hyperproliferative disease: A short interfering RNA (siRNA) duplex that includes complementary sense and anti-sense sequences corresponding to at least part of the A3 adenosine receptor (A3AR) mRNA sequence, a double-stranded RNA (dsRNA) construct that can be converted within a cell into a siRNA duplex and a transcript system that can induce transcription... 20060241077 - Methods and compositions for ameliorating or inhibiting decline in memory or intelligence or improving same: The present invention is directed to methods of ameliorating hippocampal dysfunction and improving or inhibiting decline in intelligence or cognitive or hippocampal-dependent memory of a subject and of increasing synthesis and release of neurotransmitters, neurite outgrowth, and levels of neurofilament proteins in the brain and CNS of a subject, comprising... 20060241078 - Pharmaceutical compositions comprising a contraceptive agent in solution and a teratogen: The present invention relates to pharmaceutical compositions comprising an estrogen and a progestin in solution, and a teratogen suspended in the estrogen and progestin solution. The present invention also relates to methods of making and using the pharmaceutical compositions described herein.... 20060241079 - Use of beta glucans for the treatment of osteoporosis and other diseases of bone resorption: The invention provides methods of using beta glucans to treat conditions associated with bone loss or low bone density as well as methods for promoting bone growth in situations where enhanced bone growth is desirable. In the invention methods beta glucans are administered so as to enhance the development of... 20060241080 - Glycerophospholipids containing omega-3 and omega-6 fatty acids and their use in the treatment and improvement of cognitive functions: Disclosed herein is a lipid preparation, said preparation comprising a phosphatidylserine moiety, and poly-unsaturated fatty acid (PUFA) acyl groups, particularly long-chain poly-unsaturated fatty acid (LC-PUFA) acyl groups such as omega-3 and/or omega-6 acyl groups, wherein said PUFA is covalently bound to said glycerophospholipid. Said lipid preparations are particularly useful in... 20060241081 - Novel compounds and methods for therapy: s 20060241082 - Modulating vesicular monoamine transporter trafficking and function: a novel approach for the treatment of parkinson's disease: Disclosed are compositions and methods for treating Parkinson's disease.... 20060241083 - Novel heteroaryl phosphonates as cardioprotective agents: This invention teaches a-substituted phosphonates, their preparation, pharmaceutical compositions thereof, biologically acceptable salts thereof, and methods for treating various disorders using such compositions.... 20060241084 - Inhibition of vascular endothelial growth factor: This invention relates to therapeutic organic compounds and inhibition of secretion of vascular endothelial growth factor (VEGF) and its effects, including angiogenesis.... 20060241085 - Compounds having anti-proliferative properties: There is a provided a method of inhibiting the occurrence of one of more of the following conditions: —the proliferation of monocytes/macrophages; or —the proliferation of smooth muscle cells; or —the expression of CD36 receptors; or —the uptake of oxidized LDL, the method comprising the step of administering an effective... 20060241086 - Calcium salt of myo-inositol 1,6:2,3:4,5 tripyrophosphate as an allosteric effector of hemoglobin: The present invention relates to various salts of inositol tripyrophosphate including the calcium, lithium, beryllium, magnesium, potassium, strontium, barium, rubidium and cesium salts of inositol tripyrophosphate, compositions comprising these salts, methods of making the various salts, and methods of use of the above salts. Methods of use include administering the... 20060241087 - Phosphonates useful as modulators of t $g(g)9$g(d)2 lymphocyte activity: The invention concerns novel phosphonate derivatives, preparation method, use thereof as ligands modulating T γ9δ2 lymphocyte activity and pharmaceutical compositions comprising them.... 20060241089 - Dipyridamole, acetylsalicylic acid, and angiotensin ii antagonist pharmaceutical compositions: A pharmaceutical composition comprising a therapeutically effective amount of: (a) dipyridamole or a pharmaceutically acceptable salt thereof; (b) acetylsalicylic acid; and (c) an angiotensin II antagonist, kits containing these three compounds, and methods for preventing stroke or reducing the risk of stroke or secondary stroke in a patient in need... 20060241088 - Oxylipins from long chain polyunsaturated fatty acids and methods of making and using the same: Disclosed are novel oxylipins, referred to herein as docosanoids, that are derived from C22 polyunsaturated fatty acids, and method of making and using such oxylipins. Also disclosed is the use of docosapentaenoic acid (C22:5n-6) (DPAn-6), docosapentaenoic acid (C22:5n-3) (DPAn-3), and docosatetraenoic acid (DTAn-6: C22:4n-6) as substrates for the production of... 20060241090 - Use of 2-methylene-19-nor-20(s)-1alpha,25dihydroxyvitamin d3 to increase the life expectancy of human beings: This invention provides pharmaceutical uses for 2-methylene-19-nor-20(S)-1α,25-dihydroxyvitamin D3. Administration of this compound increases the life expectancy of human beings, especially elderly human beings. In particular, it increases the survival rate of females lacking estrogen, especially post-menopausal females, and reduces mortality resulting from spontaneous development of malignant tumors in both males... 20060241092 - Contraceptive regimens for lower-weight women: The present invention discloses methods of providing contraception to a female based on the body weight of the female. According to the methods provided, the body weight of the female is determined and a contraceptive regimen is selected based on the female's body weight. The selected contraceptive regimen is then... 20060241091 - Extended estrogen dosing contraceptive regimen: A method of contraception that provides for sequentially administering to a female of child bearing age: (a) a first composition containing a progestin in an amount equivalent to about 0.3 to about 1.5 mg norethindrone acetate and an estrogen in an amount equivalent to about 5 to about 20 mcg... 20060241093 - Use of dhea derivatives for enhancing physical performance: A method is disclosed for administering a DHEA derivative or a physiologically acceptable salt, ester or ether thereof for one of decreasing body weight, reducing adipose tissue, increasing endurance, as an anti-aging compound and generating production of red blood cells.... 20060241094 - Compositions that modulate the activity of estrogen receptors and estrogen-related receptors and methods for use: Disclosed are compositions for treating an estrogen receptor (ER) or estrogen related receptor (ERR) mediated disorder, comprising a therapeutically effective amount of a compound selected from the group consisting of Compound Nos. 1-9, 7-2, 7-4, 7-5, 7-7, 7-8, 8-2 and 3-15 set forth herein or a pharmaceutically acceptable salt thereof,... 20060241095 - Orally bioavailable low molecular weight metalloporphyrins as antioxidants: The invention relates to compounds which are orally bioavailable water soluble metalloporphyrins. These compounds, e.g. represented by Structural Formula (I): wherein R1 and R2 are each independently lower alkyl, cycloalkyl, halogen substituted alkyl or substituted or unsubstituted phenyl groups, are synthetic catalytic scavengers of reactive oxygen chemical species. The invention... 20060241096 - Agent for preventing or treating organ functional disorders and organ dysfunction: The present invention provides an agent for preventing or treating organ functional disorders, an agent for preventing or treating organ dysfunction and an agent for preventing or treating obesity and deuteropathy thereof, each of which comprises a compound having an effect of increasing ubiquinone or a salt thereof or a... 20060241098 - Pesticidal n-substituted azacyclic derivatives: Pesticidal compositions comprising a pesticidally effective amount of an N-substituted azacyclic derivative of the formula (I); wherein R, an N-substituted azacycle, and V, Q, X, T and U are defined, as well as their agriculturally acceptable salts, in admixture with at least one agriculturally acceptable extender or adjuvant are disclosed.... 20060241097 - Pesticidal substituted 1,2,5-thiadiazole derivatives: Insecticidal and acaricidal compositions comprising an insecticidally or acaricidally effective amount of a 1,2,5-thiadiazole of the formula (I); wherein R, Q and m are as defined in admixture with at least one agriculturally acceptable extender or adjuvant are disclosed. In addition, methods of controlling insects and acarids comprising applying said... 20060241100 - Acylaminobicyclic heteroaromatic compounds and uses thereof: s 20060241099 - Use of 2-thia-dibenzo[e,h]azulenes for the manufacture of pharmaceutical formulations for the treatment and prevention of central nervous system diseases and disorders: The present invention relates to the use of compounds from the group of 2-thia-dibenzo[e,h]azulenes and of their pharmacologically acceptable salts and solvates for the manufacture of a pharmaceutical formulation for the treatment and prevention of diseases, damages and disorders of the central nervous system (CNS) caused by disorders of the... 20060241101 - Novel benzimidazole derivatives and pharmaceutical compositions comprising these compounds: The present invention relates to novel benzimidazole derivatives of the formula (I) as defined in the description and in the claims, pharmaceutical compositions containing these compounds, and methods of treatment therewith. The compounds of the invention are useful in the treatment of central nervous system diseases and disorders, which are... 20060241102 - Medicinal compositions: The present invention provides pharmaceutical compositions, which are useful for treatment of depression and the like, and which comprises a compound having an adenosine A2A receptor antagonistic activity such as (E)-8-(3,4-dimethoxystyryl)-1,3-diethyl-7-methyl-3,7-dihydro-1H-purine-2,6-dione or a pharmaceutically acceptable salt thereof and an antidepressant drug (for example, a tricyclic antidepressant, a tetracyclic antidepressant, a... 20060241103 - Inhibitors of ftsz and uses thereof: The invention relates to inhibitors of FtsZ polymerization and uses thereof.... 20060241104 - Oxalamide derivatives as kinase inhibitors: e 20060241105 - Pesticidal 1-ayl-3-amidoxime-pyrazole derivatives: 20060241107 - Androgen receptor modulators and methods of use thereof: Compounds of structural formula (I) as herein defined are disclosed as useful in a method for modulating the androgen receptor in a tissue selective manner in a patient in need of such modulation, as well as in a method of agonizing the androgen receptor in a patient, and in particular... 20060241106 - Isoxazole compounds as inhibitors of heat shock proteins: Isoxazoles of formula (A) or (B) are inhibitors of HSP90 activity, and useful for treatment of, for example cancers: (A), (B) wherein R1, is a group of formula (IA): —Ar1-(Alk1)p-(Z)r-(Alk2)s-Q, wherein in any compatible combination Ar1 is an optionally substituted aryl or heteroaryl radical, Alk1 and Alk2 are optionally substituted... 20060241108 - Substituted phenoxazines and acridones as inhibitors of akt: The invention provides compositions and methods that modulate the activity of AKT family kinase proteins, including AKT1, AKT2 and AKT3 (also referred to as PKBα, PKBβand PKBγ). Specifically, the invention provides a number of phenoxazine and acridone compounds that inhibit AKT phosphorylation and kinase activity. The invention provides compositions for... 20060241109 - Pgd2 receptor antagonists for the treatment of inflammatory diseases: e 20060241111 - Aroyl semicarbazide derivatives against thromboembolic diseases: Novel compounds of the formula (I) in which Het, R1, R2 and R3 have the meaning indicated in Patent claim 1, are inhibitors of coagulation factor Xa and can be employed for the prophylaxis and/or therapy of thromboembolic diseases and for the treatment of tumours.... 20060241110 - Compounds, compositions, and methods: Certain substituted urea derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, are useful in the treatment of systolic heart failure including congestive heart failure.... 20060241112 - Kinase inhibitors: r 20060241113 - Polyarylcarboxamides useful as lipid lowering agents: 20060241114 - Derivatives of azasugars as anticancer agents: Certain derivatives of azasugars, useful in the treatment of cancer, are presented. This invention also relates to pharmacological compositions containing the compounds of present invention and treatment of cancer, including tumor or other neoplasm, with an azasugar.... 20060241116 - 3-heteroaryl-3,5-dihydro-4-oxo-4h-pyridazino[4,5-b]indole-1-carboxamide derivatives, their preparation and therapeutic use: in which X represents a hydrogen or halogen atom; R1 represents a hydrogen atom or a (C1-C4)alkyl group; R2 and R3 each represent, independently of one another, a hydrogen atom or a (C1-C4)alkyl group or else R2 and R3 form, with the nitrogen atom which carries them, a pyrrolidinyl, piperidinyl,... 20060241115 - Compounds and methods of use: Selected compounds are effective for prophylaxis and treatment of diseases, such as HGF mediated diseases. The invention encompasses novel compounds, analogs, prodrugs and pharmaceutically acceptable salts thereof, pharmaceutical compositions and methods for prophylaxis and treatment of diseases and other maladies or conditions involving, cancer and the like. The subject invention... 20060241117 - Therapeutic agents useful for treating pain: where Ar1, Ar2, X, Z1, Z2, R3, and m are as disclosed herein or a pharmaceutically acceptable salt thereof (a “Pyridylene Compound”); compositions comprising an effective amount of a Pyridylene Compound; and methods for treating or preventing pain or other conditions in an animal comprising administering to an animal in... 20060241118 - Hydroxamate sulfonamides as cd23 shedding inhibitors: A class of piperazine and related heterocyclic derivatives, substituted at the 4-position by a substituted aryl or heteroaryl moiety, and at the 1-position by an ethylsulfonyl group which in turn is substituted at the 2-position by a hydroxamic acid moiety and also by a range of alternative substituents, being potent... 20060241119 - Thio-substituted tricyclic and bicyclic aromatic methanesulfinyl derivatives: wherein Ar, Y, R1 and q are as defined herein; and their use in the treatment of diseases, including treatment of sleepiness, promotion of wakefulness, treatment of Parkinson's disease, cerebral ischemia, stroke, sleep apneas, eating disorders, stimulation of appetite and weight gain, treatment of attention deficit hyperactivity disorder (“ADHD”), enhancing... 20060241120 - Cannabinoid receptor ligands and uses thereof: Compounds of Formula (I) that act as cannabinoid receptor ligands and their uses in the treatment of diseases linked to the mediation of the cannabinoid receptors in animals are described herein.... 20060241121 - Substituted piperazines as cb1 antagonists: m 20060241122 - Combination therapy for the treatment of neoplasms: The invention features compositions, methods, and kits for the treatment of neoplasms.... 20060241123 - Substituted piperidine and piperazine derivatives as melanocortin-4 receptor modulators: The present invention relates to novel substituted piperidine and piperazine derivatives as melanocortin-4 receptor (MC-4R) modulators. MC-4R agonists of the invention can be used for the treatment of disorders and diseases such as obesity, diabetes, and sexual dysfunction, whereas the MC-4R antagonists are useful for the treatment of disorders and... 20060241124 - Combinations comprising paroxetine and 2- (s) - (4-fluoro-2-methyl-phenyl) -piperazine-1-carboxylic acid [1- (r)- (3,5-bis-trifluoro-2-methyl-phenyl) -ethyl]-methyl amide for treatment of depression and/or anxiety: The present invention relates to therapeutic combinations comprising paroxetine or physiologically acceptable salts or solvates thereof and 2-(S)-(4-Fluoro-2-methyl-phenyl)-piperazine-1-carboxylic acid [1-(R)-(3,5-bis-trifluoromethyl-phenyl)-ethyl]-methyl-amide or physiologically acceptable salts or solvates thereof, to pharmaceutical compositions containing said combinations and their use in the treatment of depression and/or anxiety.... 20060241125 - Compounds useful in therapy: e 20060241126 - Pyrimidinone derivatives and their use in the treatment of atherosclerosis: 20060241127 - Heteroaryloxy-substituted phenylaminopyrimidines as rho-kinase inhibitors: The invention relates to heteroaryloxy-substituted phenylaminopyrimidines, to methods for the production thereof, and to the use of the same for producing medicaments for the treatment and/or prophylaxis of diseases, especially cardiovascular diseases. The inventive compounds inhibit Rho-Kinase.... 20060241128 - Substituted 6-(2-halogennphenyl)-triazolopyrimidines: e 20060241130 - Anti-inflammatory compositions and uses thereof: Methods of treating medical conditions associated with inflammation employing compounds capable of inhibiting an activity and/or a formation of an oxidant associated with the inflammation, pharmaceutical composition and inhalation devices containing such compounds are provided. Further provided are methods of identifying drug candidates for treating inflammation-associated medical conditions by inhibiting... 20060241129 - Novel class of cytodifferentiating agents and histone deacetylase inhibitors, and methods of use thereof: wherein each of R1 and R2 is, substituted or unsubstituted, aryl, cycloalkyl, cycloalkylamino, naphtha, pyridineamino, piperidino, t-butyl, aryloxy, arylalkyloxy, or pyridine group; wherein A is an amido moiety, —O—, —S—, —NH—, or —CH2—; and wherein n is an integer from 3 to 8. The present invention also provides a method... 20060241131 - Pyrrolo[2,3-d]pyrimidine compounds: wherein R1, R2 and R3 are as defined above, which are inhibitors of the enzyme protein kinases such as Janus Kinase 3 and as such are useful therapy as immunosuppressive agents for organ transplants, xeno transplation, lupus, multiple sclerosis, rheumatoid arthritis, psoriasis, Type I diabetes and complications from diabetes, cancer,... 20060241133 - Electrically variable pneumatic structural element: There is disclosed the use of a compound of formula (I): or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for the treatment of age-related cognitive decline or mild cognitive impairment, in particular with a view to preventing or delaying the onset of Alzheimer's disease.... 20060241132 - Spiro derivatives and adhesion molecule inhibitors comprising the same as active ingredient: Since the spiro acid derivatives according to the present invention are excellent in the effect of inhibiting cell adhesion via adhesion molecules, especially adhesion molecule VLA-4, they are useful as therapeutic drugs against various inflammatory diseases. For example, provided are the spiro derivative and the adhesion molecule inhibitor which includes... 20060241134 - Pharmaceutical combinations of a proton pump inhibitor and a compound which modifies gastrointestinal motility: The invention relates to the combination of certain active compounds from the acid pump antagonist class and compounds which modify gastrointestinal motility.... 20060241135 - Opiod receptor agonist compounds and their use in treatment of pain: Structurally novel opioid receptor agonists are provided, and the use of these agonists in treatment of chronic and/or acute pain.... 20060241136 - Pharmaceutical composition combining tenatoprazole and a histamine h2-receptor antagonist: The invention relates to a novel pharmaceutical combination. The inventive pharmaceutical composition, which is intended for the treatment of pathologies linked to gastric hyperacidity, comprises a combination of tenatoprazole and one or more histamine H2-receptor antagonists preferably selected from cimetidine, ranitidine, famotidine and nizatidine. The invention is particularly suitable for... 20060241137 - Triazole compounds and the therapeutic use thereof: The invention relates to triazole compounds of general formula (I), wherein A, B, R1, R2, R3 and R4 have the meaning cited in claim 1. The invention also relates to a pharmaceutical agent containing at least one compound of general formula (I) in addition to the use of the compound... 20060241138 - Heterocyclic amide derivatives for the treatment of diabetes and other diseases: e 20060241139 - Treatment of dna damage related disorders: The present invention provides methods and compositions for prophylaxis and treatment of a variety of disorders including DNA damage related disorders, cancer, ischemia, oxidative stress, atherosclerosis, and stroke using a chloroquine compound.... 20060241140 - Imidazolamino compounds: The invention relates to novel imidazolamino compounds. Also disclosed are methods of treating cancer by using one of these compounds and pharmaceutical compositions containing one of these compounds.... 20060241141 - Use of pyridin-2-ylmethylamine derivatives for the production of a medicament for the treatment of chronic pain symptoms of neuropathological or psychogenic origin: This invention relates to a treatment of chronic pain symptoms, especially of neuropathological or psychogenic origin, with pyridin-2-yl methylamine derivatives or pharmaceutically acceptable additive salts thereof.... 20060241142 - Naphthamide derivatives and their use: i 20060241143 - Combination of paroxetine and 2-methoxy-5-(5-trifluoromethyl-tetrazol-1-yl-benzyl)-(2s-phenyl-piperidin-3s-yl)-amine for treatment of depression and/or anxiety: The present invention relates to therapeutic combinations comprising paroxetine or physiologically acceptable salts or solvates thereof and 2-methoxy-5-(5-trifluoromethyl-tetrazol-1-yl-benzyl)]-(2S-phenyl-piperidin-3S-yl)-amine or physiologically acceptable salts or solvates thereof, to pharmaceutical compositions containing said combinations and their use in the treatment of depression and/or anxiety.... 20060241144 - Method for treating apathy syndrome: The present invention provides a method of treating apathy syndrome in a human subject. The human subject is first evaluated to determine whether one or more behavioral characteristics of apathy are observed. If such characteristics are observed, the subject is treated with a 2-oxopyrrolidine compound, such as nefiracetam, piracetam, aniracetam,... 20060241146 - Nitrogen-containing 5-membered ring compound: e 20060241145 - Piperidine derivative crystal, process for producing the same, and use: 20060241148 - Fluorinated pyridine n-oxide thrombin modulators and process for n-oxidation of nitrogen containing heteroaryls: 20060241147 - Pyridine derivatives useful for inhibiting sodium/calcium exchange system: 20060241149 - Chemical compounds: Pyridinyl-benzoheterocycyl kinase inhibitor compounds are disclosed. Also disclosed are methods of making such compounds as well as methods of using the same in the treatment of diseases.... 20060241150 - P38 kinase inhibitor compositions and methods of using the same: Methods of treating an individual who has been identified as having been infected with HIV are disclosed. Methods of treating an individual who is suspected of having been exposed to HIV are disclosed. Some methods disclosed comprise the step of administering to the individual an amount of a p38 inhibitor... 20060241151 - Pyrid-2-one derivatives and methods of use: Selected compounds are effective for treatment of diseases, such as cell proliferation or apoptosis mediated diseases. The invention encompasses novel compounds, analogs, prodrugs and pharmaceutically acceptable derivatives thereof, pharmaceutical compositions and methods for prophylaxis and treatment of diseases and other maladies or conditions involving stroke, cancer and the like. The... 20060241152 - Imidazoline derivatives having cb1-antagonistic activity: l 20060241153 - Benzamides and related inhibitors of factor xa: Novel benzamide compounds including their pharmaceutically acceptable isomers, salts, hydrates, solvates and prodrug derivatives having activity against mammalian factor Xa are described. Compositions containing such compounds are also described. The compounds and compositions are useful in vitro or in vivo for preventing or treating coagulation disorders.... 20060241154 - Benzotropolone derivatives and modulation of inflammatory response: v 20060241155 - Tnf-alpha production inhibitors: 20060241156 - Preparation of epothilone derivatives: 20060241157 - Heterocyclic ppar modulators: The present invention is directed to compounds represented by the following structural formula, Formula I: wherein: (a) X is selected from the group consisting of a single bond, O, S, S(O)2 and N; (b) U is an aliphatic linker; (c) Y is selected from the group consisting of O, C,... 20060241158 - Zolmitriptan crystal forms: The invention encompasses novel crystalline forms of zolmitriptan herein defined as Form B, D, C, E, F, G, H, I, J, K, M, N, O, P, Q, R, S, or Amorphous and to methods of making thereof. The invention also encompasses methods of making zolmitriptan crystalline Form A.... 20060241159 - Zolmitriptan crystal forms: The invention encompasses novel crystalline forms of zolmitriptan herein defined as Form B, D, C, E, F, G, H, I, J, K, M, N, O, P, Q, R, S, or Amorphous and to methods of making thereof. The invention also encompasses methods of making zolmitriptan crystalline Form A.... 20060241160 - Zolmitriptan crystal forms: The invention encompasses novel crystalline forms of zolmitriptan herein defined as Form B, D, C, E, F, G, H, I, J, K, M, N, O, P, Q, R, S, or Amorphous and to methods of making thereof. The invention also encompasses methods of making zolmitriptan crystalline Form A.... 20060241161 - Process for preparing losartan potassium with improved flowability: Provided is a method of improving the flowability of losartan potassium powder having an initial Hausner ratio of 1.45 or more, which method includes reslurrying the losatrtan potassium in a reslurry solvent.... 20060241162 - Optically active (r)-hydantoin derivative: (R)-(+)-5-hydroxy-1-methylhydantoin is an optically active substance having an excellent suppressive action of the progression of renal failure. At an administration to a model animal of renal failure, (R)-(+)-5-hydroxy-1-methylhydantoin significantly suppresses an increase of creatinine in blood as compared with the S-form and the racemate, and shows an excellent suppressive action... 20060241163 - Optically active (s)-hydantoin derivative: (S)-(−)-5-hydroxy-1-methylhydantoin is useful as a drug having high safety. Since the compound of the present invention, (S)-(−)-5-hydroxy-1-methylhydantoin, rarely changes to the metabolite having high toxicity compared with the R-form and the racemate, it is preferred as an agent for renal failure especially when used for chronic renal insufficiency in a... 20060241164 - Pharmacological treatment for sleep apnea: The present invention relates generally to pharmacological methods for the prevention or amelioration of sleep-related breathing disorders via administration of agents or combinations of agents that possess serotonin-related pharmacological activity.... 20060241165 - Method and kit for regulation of microvascular tone: Methods and kits for regulating arterial microvascular tone in which a COX-2 inhibitor and a cannabinoid receptor agonist are co-administered to a subject.... 20060241166 - Sapphyrins and uses thereof: The present invention relates to compounds of Formula (I): their pharmaceutical composition and their utility in treating neoplasm.... 20060241167 - Crystalline form of fluvastatin sodium: A novel crystalline form of Fluvastatin sodium hydrate is described, referred to hereinafter as polymorphic Form G. Furthermore, processes for the preparation of this crystalline form and pharmaceutical compositions comprising this crystalline form are reported.... 20060241168 - Antidepressant: wherein ring A: an optionally substituted benzene ring; ring B: an optionally substituted 5- to 7-membered nitrogen-containing heterocycle; R4: an aliphatic hydrocarbon group substituted with an aromatic group and further optionally substituted, or an acyl group containing an aromatic group; R5: H, C1-6 alkyl or acyl; R4c: an aromatic group,... 20060241169 - Crystalline forms of [r-(r*.r*)]-2-(4-fluorophenyl)-beta,delta-dihydroxy-5-(1-methylethyl)-3-phenyl-4-[(phenylamino)carbonyl]-1h-pyrrole-1-heptanoic acid calcium salt (2:1): Novel crystalline forms of [R-(R*,R*)]-2-(4-fluorophenyl)-β,δ-dihydroxy-5-(1-methylethyl)-3-phenyl-4-[(phenylamino)carbonyl]-1H-pyrrole-1-heptanoic acid hemi calcium salt designated Form V, Form VI, Form VII, Form VIII. Form IX, Form X, Form XI, Form XII, Form XIII, Form XIV, Form XV, Form XVI, Form XVII, Form XVIII, and Form XIX are characterized by their X-ray powder diffraction, solid-state NMR,... 20060241170 - Methods and formulations of taxanes: In accordance with the present invention, there are provided compositions and methods useful for the in vivo delivery of a pharmaceutically active agent, wherein the agent is associated with a polymeric biocompatible material.... 20060241171 - Novel physiologically active substances: (wherein, R3, R6, R7 and R21 are the same as or different from one another and each represents a hydroxyl group etc.), a pharmacologically acceptable salt thereof or a hydrate of them. The compound (I) of the present invention suppresses angiogenesis, in particular, suppresses VEGF production in a hypoxic condition... 20060241172 - Benzodioxane and benzodioxolane derivatives and uses thereof: wherein each of R1, R2, R3, R4, y, n, m, and Ar are as defined, and described in classes and subclasses herein, which are agonists or partial agonists of the 2C subtype of brain serotonin receptors. The compounds, and compositions containing the compounds, can be used to treat a variety... 20060241173 - Compound: The present invention relates to sulphamate compounds that are an inhibitor of both oestrone sulphatase activity and aromatase activity.... 20060241175 - Vehicle for topical delivery of anti-inflammatory compounds: A vehicle for topical delivery which contains a liquid eutectic mixture of hydrophobic compounds.... 20060241174 - Vitamin e tocotrienols inhibition of intracellularly obligate pathogen chlamydia and methods of use: This invention reveals the beneficial use of vitamin E tocotrienols for inhibition of chlamydial infections. Chlamydial infection levels in mouse macrophages treated with tocotrienol were decreased >50%, with concomitant aberrant pathogen development. The number of large and small inclusions in tocotrienol-versus-control cells was decreased 3-fold and 2-fold, respectively. When treated... 20060241176 - Dihydrobenzofuran derivatives and uses thereof: i 20060241177 - Novel compounds, pharmaceutical compositions containing same, and methods of use for same: Pharmaceutical composition comprising a pharmaceutical diluent and a compound of formula IX: R29═H, or C1-C20 alkyl, cycloalkyl, alkenyl, aryl, arylalkyl, or alkylaryl, ═CHR31, —C(O)OR31, —C(O)R31, —CH2C(O)OR31, CH2C(O)NHR31, where R31 is H or C1-C10 alkyl, cycloalkyl, or alkenyl; R30═C1-C20 alkyl, cycloalkyl, alkenyl, aryl, arylalkyl, or alkylaryl; X5═—OR32, or NHR32, Where R32... 20060241178 - Compositions and methods for treating lung cancer: The invention is directed to methods and compositions of inhibiting lung tumorigenesis. Such method involves the administration of an isothiocyanate conjugate at the post-initiation stage of tumor growth, while avoiding the drawbacks of toxicity of the parent compounds.... 20060241179 - Biphenylcarboxylic amide derivatives as p38 kinase inhibitors: e 20060241180 - Selective androgen receptor modulators and methods of use thereof: This invention provides a class of androgen receptor targeting agents (ARTA). The compounds are selective androgen receptor modulators (SARM) useful for, inter-alia, suppressing spermatogenesis, treating a subject having a hormone related condition, treating a subject suffering from prostate cancer, delaying the progression of prostate cancer, preventing the recurrence of prostate... 20060241181 - Alpha-ketoglutarates of active ingredients and compositions containing same: Novel stable and pharmacologically acceptable salts of L-carnitine and lower alkanoyl L-carnitines with alpha-ketoglutaric acid are disclosed as well as the compositions useful as dietary and dietetic supplements, nutraceuticals or drugs containing same.... 20060241182 - Antibiotic, functional cosmetic and functional food containing levulinic acid and their derivatives: The present invention relates to antibiotics, functional cosmetics and functional foods comprising levulinic acid or its derivatives as effective ingredients. More particularly, the present invention relates to antibiotics comprising levulinic acid or its derivatives having antibiotic activities against various microorganisms including Gram positive bacteria, Gram negative bacteria, yeast and drug-resistant... 20060241183 - Compositions and methods of using d-dopa to treat parkinson's disease: A method of treating Parkinson's disease by administering the racemic mixture of D,L-DOPA in combination with both peripheral amino acid decarboxylase and catechol, O-methyltransferase (COMT) inhibitors in pharmaceutically acceptable salts forms and effective doses for the treatment of Parkinson's disease. Alternatively, D-DOPA is administered in combination with both peripheral amino... 20060241184 - Medicament for treatment of nocturia: A method for therapeutic treatment of nocturia which comprises administering to a mammal, including a human in need of such treatment, a therapeutically effective amount of loxoprofen or a pharmacologically acceptable salt thereof.... 20060241185 - Antibiotics targeting mreb: The identification of MreB as essential for bacterial chromosome segregation provides a new target for antibiotic action. The MreB function is useful in the development of screening assays for new antibiotics, which may use, for example, genetic mutants in MreB, tests of MreB mediated chromosome segregation, and the like. In... 20060241186 - Alkylating agent combinations in the treatment of cancer: This application provides compositions and methods useful in the treatment of certain cancers. In part, this application is based on the recognition that certain molecules that target abasic lesions or AP sites in DNA improve, augment, or potentiate the chemotherapeutic efficacy of certain anticancer agents.... 20060241187 - Compound with antitumor activity and preparation method therefor: The present invention provides the diaminophenyladamantane derivatives with antitumor activities and the preparation method therefore. The method includes a step of reacting an aromatic diol with at least one 5-halo-2-nitrophenol in the presence of at least one inorganic base in an organic solvent with a relatively high boiling point.... 20060241188 - Treatment of pervasive developemental disorders with norepinephrine reuptake inhibitors: Provided are methods and medicaments for treating a Pervasive Developmental Disorder, comprising administering to a patient in need of such treatment an effective amount of a selective norepinephrine reuptake inhibitor.... 20060241189 - Sertraline hydrochloride polymorphs: The present invention is directed to forms II, III, V, VI, VII, VIII, IX and X of sertraline hydrochloride and novel methods for their preparation. According to the present invention, sertraline hydrochloride polymorph II may be produced by slurrying sertraline hydrochloride polymorph VI in aprotic organic solvent. Sertraline hydrochloride polymorphic... 20060241191 - Crystalline levosalbutamol sulphate and polymorphic forms thereof: The invention provides three polymorphic forms of crystalline levosalbutamol sulphate designated herein as Forms I, II and III. Crystalline levosalbutamol sulphate Form I is characterised by a powder XRD pattern with peaks at 10.8, 11.9, 13.0, 18.3, 28.5±0.2 degrees 2 theta. Crystalline levosalbutamol sulphate Form II is characterised by a... 20060241190 - Keratolytic composition with anti-allergic anti-inflammatory properties: A product with an enhanced medicinal and cosmetic composition with a specific utility of “Psoriasis, Eczema and like skin disorders application” is characterized by the fact that it comprises active agents and ingredients as vanilla extract, ammonium chloride, potassium chloride and quaternary ammonium compound having formulated at a specific pH... 10/19/2006 > 181 patent applications in 114 patent subcategories.20060234904 - Method for preparing polymorphism of irinotecan hydrochloride: A method for preparing a novel crystalline polymorphic irinotecan hydrochloride which is excellent in the solubility in water and reduced in the content of impurities is provided. A method for preparing c-type crystals of irinotecan hydrochloride having diffraction peaks (2θ) at 9.15°, 10.00°, 11.80°, 12.20°, 13.00° and 13.40° in the... 20060234907 - Albumin solution and process for the production thereof: (c) optionally one or more stabilizers selected from the group of sugars, amino acids and sugar alcohols are added, with the proviso that no indole stabilizer and no C6-C10 fatty acid is employed as said stabilizer, whereupon (d) said second albumin solution to which a stabilizer has optionally been added... 20060234909 - Compositions and methods for increasing drug efficiency: ) 20060234911 - Method of reversing epithelial mesenchymal transition: A method of reversing epithelial mesenchymal transition, comprising the step of treating a fibrotic disease patient or cancer disease patient with an amount of kinase inhibitor capable of reversing EMT, wherein the kinase inhibitor comprises a TGF-βI kinase inhibitor and a Rho kinase inhibitor or a TGF-βI inhibitor and a... 20060234905 - Method of stimulating growth and resistance to diseases of aquatic organisms: The invention is related with the chemical synthesis for increase the growth rate in marketable fish and crustacean The aim of this invention is supply GHRP-6 to induce directly or indirectly the release of growthing hormone or like, to produce the increase of circulating growthing hormone level in the blood... 20060234908 - Methods for improving the structure and function of arterioles: The present invention relates to the unexpected finding that vessels smaller than even the smallest arteries (i.e. arterioles) thicken, become dysfunctional and cause end organ damage to tissues as diverse as the brain and the kidney. This invention provides a method to improve the structure and function of arterioles and... 20060234912 - Methods for modulating neuronal responses: The invention provides, in part, methods and reagents for modulating neuronal apoptosis and for modulating synaptic plasticity.... 20060234910 - Methods for the treatment of insulin resistance and disease states characterized by insulin resistance: The MINOR and TR3 genes are disclosed to be insulin responsive genes differentially expressed as a function of insulin resistance and Type 2 Diabetes in humans and a variety of well characterized animal models. The present disclosure shows that MINOR and TR3 have a functional role in insulin resistance. Therefore,... 20060234906 - Structure of a complex of retinoblastoma protein bound to e2f, and uses thereof: The present invention provides the crystal structure of pRb/E2F(409-426) as well as uses of the structure in identifying agents which modulate the binding between pRb and E2F and/or a pRb/E2F(409-426) complex, and thus are useful as pharmaceutical agents in the prevention or treatment of proliferative diseases.... 20060234914 - Fragments of proinsulin c-peptide: The present invention relates to peptides being the N-terminal fragment of human proinsulin C-peptide and having the sequence EAEDLQVGQVEL (SEQ ID No: 2) or a fragment or peptide derivative thereof retaining the functional ability of the N-terminal fragment to contribute to C-peptide activity, wherein said fragment or peptide derivative comprises... 20060234913 - Oral insulin therapy: Pharmaceutical dosage forms for oral administration to a patient for the treatment of diabetes, comprising insulin and a delivery agent that facilitates insulin transport in a therapeutically effective amount to the bloodstream and that result in a lower incidence of vascular diseases associated with the repeated administration of insulin are... 20060234915 - Compositions and methods for delivering carbon monoxide (co) and nitric oxide (no) to tissue using heme proteins as carriers: The present invention relates to compositions and methods for delivering nitric oxide (NO) or carbon monoxide (CO) to cells using heme proteins as carriers. In one embodiment, the present invention relates to the use of modified hemoglobin to deliver NO or CO to cells... 20060234916 - Cardioprotective agent: A problem of the present invention is to provide an agent which allows effective protection of cardiac damage in a case where a variety of symptoms such as arrhythmia, cardiac desmoplasia and heart-failure are likely to accompany with hypertension, hypercardia, myocardial infarction, arteriosclerosis, diabetic and non-diabetic renal diseases, and re-stenosis... 20060234918 - Methods for treating and preventing cancers that express the hypothalamic-pituitary-gonadal axis of hormones and receptors: Methods are provided for treating HPG axis-positive cancers, preventing or slowing proliferation of cells of HPG axis-positive cancer origin, preventing HPG axis-positive cancers in a patient at risk of contracting such cancers, preventing or inhibiting an upregulation of the cell cycle in HPG axis-positive cancer-derived cells in a patient, and... 20060234917 - Truncated baff receptors: The disclosure provides a non-naturally occurring BAFF-R glycoprotein having a deletion in the extracellular domain which results in an altered 0-linked glycosylation pattern. The disclosure also provides methods and pharmaceutical compositions for treating B-cell- and T-cell-mediated disorders.... 20060234920 - New antitumoral compounds: The present invention is directed to new kahalalide antitumoral compounds, in particular to analogues of kahalalide F, useful as antitumoral, antiviral, antifungal agents and in the treatment of psoriasis.... 20060234922 - Remedy for corneal failure: The present invention provides a new type of pharmaceutical agent that recovers corneal sensitivity after corneal surgery or improves the condition of dry eye. Application of a somatostatin receptor agonist is expected to provide an improvement effect on decreased corneal sensitivity after cataract surgery or LASIK surgery, decreased corneal sensitivity... 20060234923 - Template-fixed peptidomimetics as medicaments against hiv and cancer: Template-fixed β-hairpin peptidomimetics of the General Formula (I); wherein Z1 and Z2 are template-fixed chains of 4 and 6 or 5 and 7 α-amino acid residues which, depending on their positions in the chain are Gly, or Pro, or of certain types which, as the remaining symbols in the above... 20060234921 - Treatment of osteoarthritis: This invention relates to methods of treatment of osteoarthritis, and especially to treatment of this condition with cyclic peptidic and peptidomimetic compounds which have the ability to modulate the activity of G protein-coupled receptors. The compounds preferably act as antagonists of the C5a receptor, and are active against C5a receptors... 20060234919 - Use: The present invention relates to the use of substances with oxytocin for the preparation of pharmaceutical composition against inflamation. It also relates to a pharmaceutical composition comprising at least one substance with oxytocin activity against inflamation.... 20060234928 - Cell death-inducing fused gene acting specifically on cancer and gene product thereof: The present invention provides a protein having a potent cell-death inducing activity that is, a fused protein is in which a modified Bax protein fused with GFP at the N-terminus and is further fused with a homing signal peptide having a homing activity specific for endothelial cells in tumor angiogenesis;... 20060234934 - Composition and method for selective cytostasis: A method of inducing cytostasis in a population of HIV-infected cells is disclosed which comprises applying to a population of HIV-infected cells a cytostatically effective amount of an inhibitor comprising an isolated peptide having the amino acid sequence FCRFLLCPSRTSD or SQCEQEGGRCRFLLCPSRTSNIGKLGCEPLWKC CKRWGG, or a conservative variant thereof, whereby cell growth... 20060234925 - Embryo implantation inhibitor: For a pregnancy to be established, communication between conceptus and mother, and implantation of the conceptus on the uterine wall must occur. If a factor mediating the communication between conceptus and mother is investigated and the factor can be used to control the communication, it may be possible to develop... 20060234936 - Method for screening substances capable of inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells: There are provided PACAP which is a substance capable of inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells, a method for inhibiting the hyperplasia of pancreatic cells and/or the hypersecretion of insulin by pancreatic cells in a human by PACAP administration, a pharmaceutical composition... 20060234937 - Modulation of angiogenesis: Substances are provided that are capable of modulating angiogenesis mediated by Lmo2 or a functionally related polypeptide, which substance binds to Lmo2 and/or a functionally related polypeptide, or alters the expression of Lmo2 or a functionally related polypeptide in a cell. Assay methods are provided for identifying such substances.... 20060234935 - Mutants of the factor vii epidermal growth factor domain: The application relates to modified blood coagulation factor, sequencing encoding such modified factors, processes for their production, and related pharmaceutical compositions comprising such factors and their uses. More specifically, the application relates to mutations in the human FVII EGF-1 domain, wherein said mutations were analyzed for clotting activity, amidolytic activity... 20060234927 - Neuroprotective iron chelators and pharmaceutical compositions comprising them: Novel iron chelators exhibiting neuroprotective and good transport properties are useful in iron chelation therapy for treatment of a disease, disorder or condition associated with iron overload and oxidative stress, eg. a neurodegenerative or cerebrovascular disease or disorder, a neoplastic disease, hemochromatosis, thalassemia, a cardiovascular disease, diabetes, a inflammatory disorder,... 20060234924 - Novel proteins and dnas thereof: A novel sodium-dependent bile acid transporter protein, an Na+/H+ exchange transporter protein, a P-type ATPase protein and a vanilloid receptor protein, and polynucleotides encoding these proteins are useful in screening preventives/remedies for hyperlipemia, arteriosclerosis, genital diseases or digestive diseases; respiratory diseases, renal diseases or digestive diseases; pancreatic diseases, central nerve... 20060234926 - Nucleic acid ligands and uses therefor: The present invention relates to novel nucleic acid molecules or ligands or aptamers with affinities for specific target molecules, and uses of such molecules. The target molecules are fibrillar proteins in all forms of the protein that is to say its monomeric, pre-fibrillar, protofibrillar and mature fibrillar forms. The molecules... 20060234932 - Prolonged efficacy of islet neogenesis therapy methods with a gastrin/cck receptor ligand and an egf receptor ligand composition in subjects with preexisting diabetes: Compositions and methods are provided for achieving in vivo islet cell regeneration in subjects with preexisting diabetes. The methods comprise short term treatment with a composition having a gastrin/cholecystokinin receptor ligand and an EGF receptor ligand. Treatment with such a composition for a short term resulted in a prolonged period... 20060234929 - Rasgap derived peptide for selectively killing cancer cells: The present invention relates to a peptide consisting in the N2 sequence of the RasGAP protein, a fragment thereof, or a variant thereof which enhances the ability of a drug to selectively kill cells. Furthermore, it relates to a pharmaceutical composition comprising as an active substance a pharmaceutically effective amount... 20060234931 - Treatment of diseases with kinase inhibitors: The invention is directed to the identification and use of additional targets of BIRB 796, imatinib mesylate, and BAY 43-9006. The new targets of BIRB 796, imatinib mesylate, and BAY 43-9006 can be used to screen for suitable therapeutic compounds. Also, novel therapeutic and prophylactic uses for BIRB 796, imatinib... 20060234930 - Use of dg008,dg065,dg210 or dg239 secreted protein products for preventing and treating pancreatic diseases and/or obesity and/or metabolic syndrome: The present invention discloses proteins secreted by the developing pancreas, and polynucleotides, which identify and encode the proteins. The invention also relates to the use of these sequences in the diagnosis, study, prevention, and treatment of pancreatic diseases (e.g diabetes), obesity, and/or metabolic syndrome.... 20060234933 - Vasoactive intestinal polypeptide pharmaceuticals: Pharmaceutical compositions relating to vasoactive intestinal polypeptides and methods for the treatment of metabolic disorders, including diabetes, insulin resistance, metabolic acidosis and obesity are presented. Methods of using the vasoactive intestinal polypeptide compositions are also disclosed.... 20060234939 - Methods of using ziconotide to treat overactive bladder: The invention relates to methods of using Cav2.2 subunit calcium channel modulators to treat painful and non-painful lower urinary tract disorders and the related genitourinary tract disorders vulvodynia and vulvar vestibulitis in normal and spinal cord injured patients.... 20060234938 - Peptides impairing pbx dependent gene regulation: e 20060234940 - Secondary binding site of dipeptidyl peptidase iv (dp iv): The present application relates to the secondary binding site of dipeptidyl peptidase IV, its relationship amongst substrates and to the modulation of substrate specificity of dipeptidyl peptidase IV (DP IV, synonym: DPP IV, CD26, EC 3.4.14.5). The application relates further to compounds that bind to the secondary binding site of... 20060234941 - Peptide epitopes of vegfr-2/kdr that inhibit angiogenesis: The disclosure provides antigenic peptides of Vascular Endothelial Growth Factor Receptor 2(VEGFR-2)/KDR. Pharmaceutical compositions including the peptides and/or antigen presenting cells that exhibit the VEGFR-2/KDR peptides on their cell surface are also provided. Methods for eliciting an immune response and for inhibiting angiogenesis by administering such pharmaceutical compositions are provided.... 20060234943 - Biological active peptides comprising isoleucyl-valyl-threonyl-asparaginyl-threonyl-threonine (ivtntt): The peptide Isoleucyl-valyl-threonyl-asparaginyl-threonyl-threonine is disclosed with its use as a pharmaceutical composition. A method is also disclosed for making a pharmaceutical composition comprising providing an Isoleucyl-valyl-threonyl-asparaginyl-threonyl-threonine peptide and mixing said peptide with a pharmaceutical acceptable carrier.... 20060234944 - Beta-secretase inhibitors and methods of use: Compounds inhibit memapsin 2 β-secretase activity and selectively inhibit memapsin 2 β-secretase activity relative to memapsin 1 β-secretase activity. The compounds are employed in methods to inhibit memapsin 2 β-secretase activity, in the treatment of Alzheimer's disease, in the inhibition of hydrolysis of a β-secretase site of a β-amyloid precursor... 20060234945 - Ophthalmic therapeutic composition: An object is to find the minimum activity expression site of fibronectin, clarify the actions of this minimum unit in relation to ophthalmological fields, and provide a ophthalmological composition having this minimum unit as an effective component. This invention provides an ophthalmological composition, in particular, a corneal disorder treatment agent... 20060234947 - Peptides antibodies directed thereagainst and methods using same for diagnosing and treating amyloid-associated diseases: Peptides having at least 2 amino acids and no more than 15 amino acids are provided. The peptides comprise amino acid sequence X-Y or Y-X, wherein X is an aromatic amino acid and Y is any amino acid other than glycine. Also provided are pharmaceutical compositions and kits including such... 20060234946 - Use of telmisartan for the prevention and treatment of vascular headache: The present invention relates to a method for the prophylaxis of vascular headaches which do not originate from hypertension, especially migraine, the method comprising administration of telmisartan to a subject in need of such a treatment. The present invention relates also to a method for the prophylaxis of vascular headaches,... 20060234948 - Lignan-containing compositions: Compositions are provided that includes a lignan, and an additional compound such as an isoflavone, a tocopherol, a phytosterol, a polyphenol, a catechin, an anthocyanin, an astaxanthin, or a glucosamine. The compositions can be formulated as a dietary supplement, in tablet, powder or liquid form, or can be incorporated into... 20060234949 - Adduct of topiramate and tramadol hydrochloride and uses thereof: This invention relates to a new pharmaceutically useful compound which is a stoichiometrically 1:1 adduct of tramadol hydrochloride and topiramate, and to the manufacture and use thereof.... 20060234950 - Combination therapy for effecting weight loss and treating obesity: The present invention features a novel therapy for effecting weight loss which involves treating a subject with a sympathomimetic agent (e.g., phentermine or a phentermine-like drug) in combination with an anticonvulsant sulfamate derivative (e.g., topiramate) suc |