|
FREE patent keyword monitoring and additional FREE benefits. |
![]() |
|
|
USPTO Class 514 | Browse by Industry: Previous - Next | All 09/2006 | Recent | 08: Feb | Jan | | 07: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | | 06: Dec | Nov | Oct | Sep | Aug | Jul | Jun | May | Apr | Mar | Feb | Jan | Drug, bio-affecting and body treating compositions inventions 09/06Recently published patent applications awaiting approval from the USPTO. Recent week's RSS XML file available below.Listing format for abstract view: USPTO application #, Title, Abstract excerpt,Patent Agent. Listing format for list view: USPTO National Class full category number, title of the patent application. 09/21/2006 > 176 patent applications in 112 patent subcategories. 20060211599 - Reversibly heat-gelable aqueous composition: The present invention relates to a reversibly heat-gelable aqueous composition comprising a reversibly heat-gelable aqueous composition according to conventional technique, to which a thixotropic property-increasing substance is added. The thixotropic property-increasing substance is preferably at least one member selected from the group consisting of sugar alcohol, lactose, carmellose or pharmaceutically... 20060211600 - Stem cell-derived factors for treating pathologic conditions: Compositions and methods for cellular and tissue protection, repair, and regeneration are described. Mesenchymal cell-derived paracrine factors confer a therapeutic benefit to a variety of injured, compromised or diseased tissues such as myocardial tissue.... 20060211601 - Nitrosated and nitrosylated heme proteins: Nitrosylation of proteins and amino acid groups enables selective regulation of protein function, and also endows the proteins and amino acids with additional smooth muscle relaxant and platelet inhibitory capabilities. Thus, the invention relates to novel compounds achieved by nitrosylation of protein thiols. Such compounds include: S-nitroso-heme proteins, S-nitroso-t-PA, S-nitroso-cathepsin;... 20060211602 - Use of alanyl aminopeptidase inhibitors and pharmaceutical compositions containing said inhibitors: The present invention relates to the use of one inhibitor or of several inhibitors of alanyl aminopeptidases and/or of enzymes having a similar substrate specificity for the induction of the production of TGF-β1 and of the expression of TGF-β1 in and/or on Treg cells and relates to the use for... 20060211604 - Methods for treating inflammatory disorders using regulators of microvessel dilations: The invention relates to methods for treating inflammatory diseases. Methods for analyzing microcirculation structural changes are also provided.... 20060211605 - Mucosal repair by tff dimer peptides: The present invention relates to the use of trefoil factor 1 (TFF1) and trefoil factor 3 (TFF3) dimers and a pharmaceutical composition comprising TFF dimers for increasing the viscosity of mucin in mucus layers and the repair of damaged mucus layers in the gastrointestinal tract (mouth, oesophagus, stomach, small and... 20060211603 - Ramoplanin derivatives possessing antibacterial activity: Novel ramoplanin derivatives are disclosed. These ramoplanin derivatives exhibit antibacterial activity. As the compounds of the subject invention exhibit potent activities against gram positive bacteria, they are useful antimicrobial agents. Methods of synthesis and of use of the compounds are also disclosed.... 20060211606 - Peptides: This invention relates to biologically active polypeptides derived from the E peptide that forms the C-terminus of the insulin-like growth factor I (IGF-I) splice variant known as mechano growth factor (MGF). These peptides are modified to improve their stability compared to the naturally occurring E peptide.... 20060211607 - Somatostatin-dopamine chimeric analogs: Disclosed is a series of somatostatin-dopamine chimeric analogs which retain both somatostatin and dopamine activity in vivo. An example is: 6-n-propyl-8β-ergolinglmethylthioacetyl-D-Phe-c(Cys-Tyr-D-Trp-Lys-Abu-Cys)-Thr-NH2... 20060211612 - Angiogenesis using hepatocyte growth factor: Methods for enhancing angiogenesis in a mammal using hepatocyte growth factor (“HGF”) are provided. In the methods, HGF can be administered to mammals suffering from, for instance, vascular insufficiency or arterial occlusive disease. Articles of manufacture and kits containing HGF are also provided.... 20060211621 - Combined use of factor vii polypeptides and factor ix polypeptides: The invention concerns a pharmaceutical preparation comprising a factor VII or factor VII-related polypeptide and a factor IX or factor IX-related polypeptide. The invention also concerns use of a factor VII or factor VII-related polypeptide and a factor IX or factor IX-related polypeptide for manufacture of a medicament for pharmaceutical... 20060211622 - Isolated human nuclear hormone receptors, nucleic acid molecules encoding human nuclear hormone receptors, and uses thereof: The present invention provides amino acid sequences of peptides that are encoded by genes within the human genome, the nuclear hormone receptor peptides of the present invention. The present invention specifically provides isolated peptide and nucleic acid molecules, methods of identifying orthologs and paralogs of the nuclear hormone receptor peptides,... 20060211614 - Methods of inhibiting angiogenesis with fragments and homologs of troponin subunit 1: The present invention relates to methods of inhibiting angiogenesis associated with a disease or disorder with peptides homologous to amino acid residues 130-137 or 132-139 of human troponin subunit I.... 20060211613 - Methods useful in the treatment of bone resorption diseases: The invention relates to a combined pharmaceutical preparation comprising parathyroid hormone and a bone resorption inhibitor, said preparation being adapted for (a) the administration of parathyroid hormone during a period of approximately 6 to 24 months; (b) after the administration of parathyroid hormone has been terminated, the administration of a... 20060211617 - Methods, compositions and articles of manufacture for contributing to the treatment of solid tumors: Methods, compositions and articles of manufacture for contributing to the treatment of a solid cancerous tumor are disclosed. The methods, compositions and articles of manufacture can utilize an endothelin B agonist (ETB) to enhance the delivery of a chemotherapeutic agent to a solid tumor in mammals, including humans.... 20060211619 - Multivalent clostridial toxin derivatives and methods of their use: The present invention is directed to multivalent Clostridial neurotoxin derivatives having more than one binding domain directed to a cell surface feature of a target cell. Such modified neurotoxins are useful as therapeutic compositions to prevent exocytosis and secretion by the target cell. Conditions in which such compositions man be... 20060211609 - Novel agent for improving neurotransmission failure: A novel medicament for ameliorating neurotransmission dysfunction diseases is provided. A medicament for ameliorating neurotransmission dysfunction diseases comprising as a main active ingredient preferably a selenocysteine-containing protein such as Selenoprotein P or a selenocysteine-containing peptide that consists of said protein or a series of said peptides. A medicament suited for... 20060211610 - Peptide yy analogs: The invention provides analogs of PYY. The invention also provides compositions and methods useful for controlling biological activities such as cell proliferation, nutrient transport, lipolysis, and intestinal water and electrolyte secretion.... 20060211618 - Polynucleotides and polypeptides of the erythropoietin gene: The present invention relates to new polynucleotides deriving from the nucleotide sequence of the EPO gene and comprising new SNPs, new polypeptides derived from the natural EPO protein and comprising at least one mutation caused by the SNPs of the invention as well as their therapeutic uses.... 20060211620 - Polypeptides having antimicrobial activity and polynucleotides encoding same: The present invention relates to isolated polypeptides having antimicrobial activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.... 20060211616 - Purification of glucagon-like peptides: Method for purifying a glucagon-like peptide by reversed phase high performance liquid chromatography... 20060211615 - Surfactant peptide nanostructures, and uses thereof: This work describes a new class of short polypeptides that can self-assemble to form regular nanotubes with an average diameters of about 50 nm. These peptides (7 to 8 amino acids) have a structure very similar to those observed in surfactant molecules with a defined hydrophilic head group constituting of... 20060211611 - Therapies and compositions for controlling the stress mechanism and for stabilizing hemostasis in an organism: A theory has been presented that provides a simplified explanation of a cohesive mechanism of embryological development, hemostasis, coagulation, wound repair and tissue maintenance that operates continuously in the animal body to oppose the effects of stress. The theory endeavors to fit all known facts, and is based on the... 20060211608 - Use of a parathyroid hormone peptide analogs for the treatment of viginal atrophy: The invention features methods for the treatment of vaginal atrophy by administering a parathyroid hormone peptide or peptide analog and formulations thereof.... 20060211623 - Conopeptides: The invention relates to novel conopeptides and/or novel Luses of conopeptides. The conopeptides of the invention are analogs of α-Conotoxin MII that are selective for α6-containing nAChRs as described herein.... 20060211624 - Methods and compositions for the treatment of parkinson's disease and other alpha-synucleinopathies: The present invention provides novel methods for the treatment of Parkinson's disease and other α-synucleinopathies. The methods of the invention include treatment with inhibitors of transglutaminase, which can inhibit aggregation of α-synuclein. Also provided are screening assays for novel inhibitors of transglutaminase which may be used in the treatment of... 20060211625 - New hybrid oligomers, their preparation process and pharmaceutical compositions containing them: The present invention relates to compositions and methods for producing therapeutic oligomeric compounds. In one aspect the invention relates to methods for administering the oligomeric compounds for the treatment and prevention of disease, for example, a fungal infection, bacterial infection, or cancer, in a mammal. In particular, the invention relates... 20060211626 - Peptides and peptidomimetics useful for inhibiting the activity of prostaglandin f2alpha receptor: The invention relates to compositions which are useful for inhibiting prostaglandin F2α receptor. The compositions include, but are not limited to, linear peptides, peptide analogs, and peptidomimetics. Methods of using the compositions of the invention to treat preterm labor and dysmenorrhea are disclosed.... 20060211627 - Methods and compositions for derepression of iap-inhibited caspase: The invention provides isolated agents having novel chemical structures and possessing superior activity as derepressors of IAP inhibited caspase. The invention further provides a method of derepressing an IAP-inhibited caspase. The invention further provides assay methods employing labeled compounds of the invention, especially fluorescent labeled compounds.... 20060211629 - Inhibitors of serine proteases, particularly hcv ns3-ns4a protease: The present invention relates to compounds of formula I or formula Ia or pharmaceutically acceptable salts thereof, that inhibit serine protease activity, particularly the activity of hepatitis C virus NS3-NS4A protease. As such, they act by interfering with the life cycle of the hepatitis C virus and are useful as... 20060211628 - Treatment of multiple sclerosis with brain targeted anti oxidant compounds: A method of treating multiple sclerosis, the method comprises administering to a subject in need thereof a therapeutically effective amount of a compound, the compound having: (a) a combination of molecular weight and membrane miscibility properties for permitting the compound to cross the blood brain barrier of the organism; (b)... 20060211630 - Novel synthetic compounds, processes of manufacture and uses in the treatment of integrin-mediated disorders: This invention relates to nitroproline derivative compounds and procedures for their preparation and the preparation of pharmaceutical compositions containing the compounds. The invention also relates to the administration of compounds of the invention as agents for the treatment of mammalian diseases whose pathogenic and pathophysiological mechanisms depend on or are... 20060211633 - D-mannose contraceptives: The present invention concerns the use of D-mannose to prevent or inhibit uniting of sperm and egg/zygote in the conception process, both for specific target animals as well as general animal populations. It is emphasized that this abstract is provided to comply with the rules requiring an abstract that will... 20060211632 - Pxr agonists for cardiovascular disease: A method of treating or preventing coronary artery disease in an animal includes increasing blood serum apoA1 level in the animal by administering an effective amount of an agonist of the orphan nuclear receptor PXR. A method of identifying a substance useful for treating or preventing coronary artery disease in... 20060211631 - Transfusion preparation for peripheral intravenous administration and method of stabilizing vitamin b1: The infusion preparation for peripheral parenteral administration comprises an infusion (A) containing glucose with 80 to 200 g/L concentration, and an infusion (B) containing amino acid with 50 to 150 g/L concentration. The infusion (A) and the infusion (B) are separately put into a vessel that is divided with an... 20060211634 - Inhibitors of aminoglycoside 6'-n-acetyltransferases, compositions and uses thereof: e 20060211635 - Purifications of pomegranate ellagitannins and their uses thereof: Compositions of purified and biologically active ellagitannins are provided by separation from pomegranate husk using a method of extraction and purification using a solid polymeric adsorbent and the uses of the said compounds... 20060211636 - Macrolide antibiotics: The present invention relates to 11,12 γ lactone ketolides of formula (I) wherein R, R1, R2, R3 are as defined herein and pharmaceutically acceptable salts and solvates thereof, to process for their preparation and their use in therapy or prophylaxis of systemic or topical bacterial infections in a human or... 20060211640 - Antisense modulation of farnesoid x receptor expression: Antisense compounds, compositions, and methods are provided for modulating the expression of Farnesoid X Receptor (FXR). The compositions comprise antisense compounds, particularly antisense oligonucleotides, targeted to nucleic acids encoding FXR. Methods of using these compounds for modulation of FXR expression and for treatment of diseases associated with expression of FXR... 20060211638 - Exon 1 ss of pdgf alpha gene and utilization thereof: By using an antisense nucleotide, a ribozyme, a maxizyme, or an RNAi constructed based on the nucleotide sequence of exon 1 beta of the PDGF receptor alpha gene, which is expressed in specific cancer cells, or a polypeptide containing a portion thereof, translation of an mRNA transcribed from exon 1... 20060211646 - Formulations with anti-tumour action: The use of defibrotide as an anti-tumour agent, alone or in combination with other active ingredients with anti-tumour action, is described.... 20060211639 - Immunostimulatory nucleic acids and cancer medicament combination therapy for the treatment of cancer: The invention involves administration of an immunostimulatory nucleic acid in combination with a cancer medicament for the treatment or prevention of cancer in subjects. The combination of drugs are administered in synergistic amounts or in various dosages or at various time schedules. The invention also relates to kits and compositions... 20060211644 - Immunostimulatory oligonucleotides: The invention relates to a class of short CpG immunostimulatory oligonucleotides that are useful for stimulating an immune response. Preferably the short oligonucleotides are soft or semi-soft oligonucleotides.... 20060211637 - Methods of down regulating target gene expression in vivo by introduction of interfering rna: Methods and compositions are provided for down regulation of target gene expression in vivo by RNA interference. The methods are useful for target discovery and validation of gene-based drug development, and for treatment of human diseases.... 20060211641 - Modulation of immunostimulatory properties of oligonucleotide-based compounds by utilizing modified immunostimulatory dinucleotides: The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides immunomers and an immunostimulatory oligonucleotides for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunomers and an immunostimulatory oligonucleotides of... 20060211645 - Modulation of neurodegenerative diseases: Methods and compositions are disclosed for selectively interfering with protein synthesis in a central nervous system, meningial, or muscle cell by administrating a pharmacological agent. In particular, methods and compositions that interfere with SOD-1 protein synthesis are disclosed.... 20060211647 - Nonviral vectors for delivering polynucleotides: Methods and compositions for delivering polynucleotides are provided. One embodiment provides a non-viral vector comprising a recombinant polynucleotide-binding protein comprising a protein transduction domain operably linked to a targeting signal. Methods for modifying the genome of non-nuclear organelles are also provided.... 20060211643 - Polycations capable of forming complexes with nucleic acids: A polycation capable of forming a complex with a nucleic acid for carriage thereof. The polycation comprising at least one cyclic compound having a cavity. A polymer backbone is threaded into the cavity of the cyclic compound. A pair of bulky moieties cap the terminals of the polymer backbone to... 20060211642 - Rna inteference mediated inhibition of hepatitis c virus (hvc) gene expression using short interfering nucleic acid (sina): This invention relates to compounds, compositions, and methods useful for modulating Hepatitis C Virus (HCV) gene expression using short interfering nucleic acid (siNA) molecules. This invention also relates to compounds, compositions, and methods useful for modulating the expression and activity of other genes involved in pathways of HCV gene expression... 20060211648 - Naphthalimide compositions and uses thereof: A method of treatment of a host with a cellular proliferative disease, comprising contacting the host with a naphthalimide and an antiproliferative agent, each in an amount sufficient to modulate said cellular proliferative disease, is described. In some embodiments, the naphthalimide comprises amonafide (5-amino-2-[2-(dimethylamine)ethyl]-1H-benz[de-]isoquinoline-1,3-(2H)-dione). Antiproliferative agents of the invention comprise... 20060211649 - Use of cytisine for enhancing physical performance: A method of decreasing fat and adipose tissue, and increasing endurance and alertness in humans comprises administering cytisine in a daily dosage between about 0.1 and 8 mg. Cytisine may be administered once per day or in multiple doses, either alone or in combination with other compounds and mixtures.... 20060211650 - Reducing carbohydrate derivatives of adamantane amines, and synthesis and methods of use thereof: The present invention relates to reducing carbohydrate derivatives of adamantane amines of Formula A or pharmaceutically acceptable salts, solvates or derivatives thereof, wherein R1, R2, R3, and R4 are together or separately H, F, methyl or lower alkyl, alkenyl, or alkynyl groups, and Z is derived from a mono-, di-,... 20060211652 - Method of making a partially hydrolyzed fucoidan composition: Methods of making partially hydrolyzed fucoidan. Fucoidan from brown seaweeds is partially hydrolyzed and then mixed with other ingredients for use as a dietary supplement in beverage, capsule, or tablet form. The fucoidan is partially hydrolyzed with acid and heat. The partially hydrolyzed fucoidan can also be sulfonated. Other ingredients... 20060211651 - Persulfated oligosaccharide acting on selectins and chemokine: A persulfated saccharide compound capable of acting on selectin and chemokine. According to the present invention, there are provided a saccharide compound capable of interacting with L-selectin, P-selectin and chemokine; a pharmaceutical composition; and an agent for treating or preventing a disease of which sideration is associated with biological events... 20060211653 - Pharmaceutical compositions comprising aloe pectins, and methods for their production and use: Pectins having a combination of unexpectedly high molecular weights and low degrees of methylation have been isolated from Aloe vera plants, are superior gel pectins for forming calcium cross-lined gels. Such pectins can be obtained by extracting homogenized Aloe Vera plants or portions thereof. These pectins can be used to... 20060211654 - Pharmaceutical compositions of cholesteryl ester transfer protein inhibitor: A pharmaceutical composition comprises a solid amorphous dispersion of a cholesteryl ester transfer protein inhibitor and a concentration-enhancing polymer.... 20060211655 - Repellent: The present invention relates to the use of an arthropod-repelling component from the pyrethroid/pyrethrin class in combination with an agonist of the nicotinergic acetylcholine receptors of arthropods for repelling arthropods, preferably on animals, in an effective and sustainable manner.... 20060211656 - Aminopropanol derivatives as sphingosine-1-phosphate receptor modulators: e 20060211657 - Prodrugs of 2,4-pyrimidinediamine compounds and their uses: The present disclosure provides prodrugs of biologically active 2,4-pyrimidinediamine compounds, compositions comprising the prodrugs, intermediates and methods for synthesizing the prodrugs and methods of using the prodrugs in a variety of applications.... 20060211658 - Amino-propanol derivatives as sphingosine-1-phosphate receptor modulator: e 20060211659 - Novel compounds of the n-acylamino amide family, compositions comprising them and uses thereof: The invention concerns novel compounds of the N-acylamino-amide family, compositions, in particular cosmetic or pharmaceutical, containing them, and their use for treating body or face skin ageing, whether chronobiologic or light-induced, and in particular skin ageing caused by decrease of skin elasticity and/or by collagen degradation in the structure of... 20060211660 - Combination therapy for topical application in the treatment of dry eye syndrome: A topical ophthalmic composition comprising 17-β-estradiol or its derivatives and an androgen in pharmaceutically acceptable vehicle, and method of using same for the alleviation of kerato-conjunctivitis sicca KCS (dry eye syndrome DES).... 20060211661 - 24 hydroxyvitamin d, analogs and uses thereof: The invention provides 24-hydroxyvitamin D compounds and methods for their use in the treatment and prophylaxis of hyperparathyroidism and hyperproliferative diseases, and in the modulation of the immune and inflammatory responses as well as the treatment of bone depletive disorders.... 20060211662 - Combination therapy for topical application in the treatment of age-related macular degeneration and ocular hypertension: A topical drug composition for the treatment of age-related maculopathy, age-rlated macular degeneration, ocular hypertension, glaucoma or other eye disease resulting from increased intraocular pressure comprising a solution of anabolic androgenic agent and 17-β-estradiol suspended or dissolved in a suitable ophthalmic vehicle is disclosed. In the preferred embodiment, 17-β-estradiol, or... 20060211663 - Low dose estrogen interrupted hormone replacement therapy: A hormone replacement therapy, comprising a plurality of daily doses of a pharmaceutical preparation, the doses being administered continuously and consecutively in alternating phases of three daily doses, a relatively dominant estrogenic activity phase comprising three daily doses of a substance exhibiting estrogenic activity equivalent to about 1 mg per... 20060211666 - 2-phenyl-1-[4-(2-aminoethoxy)-benzyl]-indole and estrogen formulations: The present invention relates to new formulations containing one or more estrogens and 2-Phenyl-1-[4-(2-Aminoethoxy)-Benzyl]-Indole compounds which are useful as estrogenic agents, as well as pharmaceutical compositions and methods of treatment utilizing these compounds, which have the general structures below:... 20060211664 - Method for treating erectile dysfunction and increasing libido in men: The present invention relates to a transdermal hydroalcoholic testosterone gel formulation that overcomes the problems associated with other testosterone delivery mechanisms by providing, among other things, a desirable pharmacokinetic hormone profile with little or no skin irritation. In addition, the gel is used in conjunction with pharmaceuticals aimed at treating... 20060211665 - Reduction of postoperative pain medication: A procedure for reducing the pain from orthopedic surgery, such as hip or knee replacement by injecting a mixture of components into the site of trauma (surgical incision or tissue twisting/stretching) before closing the wound. The mixture includes a local anesthetic agent, epinephrine, morphine and a corticosteroid.... 20060211667 - Use of pregnane steroid derivatives for enhancing physical performance: wherein R1=H and R2=H, or R1 and R2 combined form a single bond; R3 is one of OH and O; R5 is one of an α-hydrogen and a β-hydrogen; R6 is one of α-methyl and H; R7 is one of α-methyl and H; R17 is one of H and OH;... 20060211668 - Use of ciclesonide for the treatment of inflammatory bowel diseases: The invention relates to the novel use of ciclesonide in the treatment of inflammatory bowel disease.... 20060211670 - Antitumoral18a-homoestra-1,3,5(10)-trien-3yl 2-substituted sulfamates: The invention relates to the use of compounds of a general formula (I), wherein R2, R14 to R17 and X groups have the following significance: R2 is C1-C5-Alkyl, C1-C5-Alkoxy or a —O—C<SB>N</SB>FmHo rest, wherein n=1,2,3,4,5 or 6, m>1 and m+o=2n+1, R14 and R15 separately designate hydrogen or together a methyl... 20060211671 - Estrogen receptors: This invention relates to the field of estrogen receptors and particularly though not exclusively on the effect of estrogen receptors and ligands for estrogen receptors on the prevention or treatment of obesity. The invention also relates to the effect of estrogen receptors and their ligands on lipoprotein levels in mammals.... 20060211673 - Modulation of neurodegenerative diseases through the estrogen receptor: Methods for modulating hormonal pathways involving the estrogen receptor in a subject with a neurodegenerative disorder, are provided. Estrogen receptor activity is modulated by administering an effective amount of an estrogen receptor modulating pharmacological agent to a subject such that the estrogen receptor modulating pharmacological agent interacts with the estrogen... 20060211669 - Synthesis of estetrol via estrone derived steroids: A process is provided for the making of estetrol starting from a 3-A-oxy-estra 1,3,5(10),15-tetraen-17-one, wherein A is a C1-C5 alkyl group, preferably a methyl group, or a C7-C12 benzylic group, preferably a benzyl group. This process is particularly suitable to industry.... 20060211672 - Use of estrogen receptor-beta selective agonists for radiation-or chemotherapy-induced mucositis and radiation cystitis: The present invention provides a method of treating or inhibiting mucositis or radiation cystitis using an ERβ selective ligand. The present invention also provides compositions, including pharmaceutical compositions, containing the ERβ selective ligand and a traditional medicament for mucositis or radiation cystitis.... 20060211674 - Combination comprising a vasculostatic compound and an alkylating agent for the treatment of a tumor: The invention relates to a pharmaceutical combination which comprises (a) a vasculostatic compound, (b) an alkylating agent and (c) optionally at least one pharmaceutically acceptable carrier for simultaneous, separate or sequential use for the treatment of a tumor disease; a pharmaceutical composition comprising such a combination; the use of such... 20060211675 - Preventives/remedies for urinary disturbance: Preventives/remedies for voiding disturbance containing a compound having both of an acetylcholinesterase inhibitory action and an al antagonistic action which exhibits an excellent effect of improving the urinary function of the bladder (i.e., effects of improving urine flow rate and voiding efficiency) without affecting the urinary pressure or the blood... 20060211676 - Crystalline anhydrous cefdinir and crystalline cefdinir hydrates: A novel crystalline cefdinir anhydrate and novel crystalline cefdinir hydrates, ways to make them and use them, compositions comprising them and made with them, and methods of treatment using them are disclosed.... 20060211678 - Aryl-amino substituted pyrrolopyrimidine multi-kinase inhibiting compounds: or stereoisomers or pharmaceutically acceptable salts thereof, are inhibitors of least two of the Abl, Aurora-A, Blk, c-Raf, cSRC, Src, PRK2, FGFR3, Flt3, Lck, Mek1, PDK-1, GSK3β, EGFR, p70S6K, BMX, SGK, CaMKII, Tie-2, IGF-1R, Ron, Ret, and KDR kinases in animals, including humans, for the treatment and/or prevention of various... 20060211677 - Diphenyl substituted cycloalkanes, compositions containing such compounds and methods of use: The instant invention provides compounds of formula: (I) which are 5-lipoxygenase activating protein inhibitors: formula (I). Compounds of formula (I) are useful as anti-atherosclerotic, anti-asthmatic, anti-allergic, anti-inflammatory and cyto-protective agents.... 20060211679 - Substituted lactams as inhibitors of abeta protein production: having drug and bio-affecting properties, their pharmaceutical compositions and methods of use. These novel compounds inhibit the processing of amyloid precursor protein and, more specifically, inhibit the production of Aβ-peptide, thereby acting to prevent the formation of neurological deposits of amyloid protein. More particularly, the present invention relates to the... 20060211680 - Cinnamoyl compound and use of the same: The present invention relates to a cinnamoyl compound represented by the formula (I):... 20060211681 - Adenosine deaminase inhibitor and novel bacillus sp. iada-7 strain which produces it: The present invention relates to an adenosine deaminase inhibitor and a novel Bacillus sp. strain which produces it. Particularly, the present 5 invention relates to the adenosine deaminase inhibitor, and the novel Bacillus sp. IADA-7 producing the above adenosine deaminase inhibitor. The adenosine deaminase inhibitor of the present Invention shows... 20060211683 - Erastin and erastin binding proteins, and uses thereof: The invention relates to methods of screening for binding partners, especially binding partners essential for the biological activity of erastin (e.g. VDACs such as VDAC3). The invention also provides reagents and methods for effective killing of cancer cells with erastin and related compounds or derivatives.... 20060211682 - Hexahydrodiazepinones as dipeptidyl peptidase-iv inhibitors for the treatment or prevention of diabetes: The present invention is directed to hexahydrodiazepinone compounds which are inhibitors of the dipeptidyl peptidase-IV enzyme (“DPP-IV inhibitors”) and which are useful in the treatment or prevention of diseases in which the dipeptidyl peptidase-IV enzyme is involved, such as diabetes and particularly type 2 diabetes. The invention is also directed... 20060211686 - Alpha7 neuronal nicotinic receptor ligand and antipsychotic compositions: The present invention relates to a composition comprising an antipsychotic and an α7 nicotinic acetylcholine receptor ligand, a method of using the same, and a related article of manufacture.... 20060211685 - Pharmaceutical compositions for the treatment and/or prevention of depression: The invention relates to new pharmaceutical compositions for the treatment and/or prevention of depression and methods for the preparation thereof. In a preferred embodiment, the instant invention is directed to pharmaceutical combinations comprising flibanserin as one active ingredient in combination with at least one additional active ingredient for the treatment... 20060211684 - Use of alpha-2 adrenergic receptor agonists: The present invention provides a strategy to compensate for deficiency in the alpha-2C receptor by administering an agonist of different receptors; the alpha-2A and/or dopamine d2 receptors. These receptors are fully functional and receptive to stimulation by an agonist. Agonism of the alpha-2A and/or dopamine d2 receptors by clonidine, Nolomirole... 20060211687 - Potassium salt of an hiv integrase inhibitor: A potassium salt of Compound A is disclosed, wherein Compound A is of formula (1): Compound A is an integrase inhibitor useful for preventing or treating HIV infection, for delaying the onset of AIDS, and for treating AIDS.... 20060211688 - Vehicle for topical delivery of anti-inflammatory compounds: A vehicle for topical delivery which contains a liquid eutectic mixture of hydrophobic compounds.... 20060211689 - Aminoquinoline derivatives and their use as adenosine a3 ligands: The present invention relates to an adenosine A3 receptor ligand of the general formula (I), within those preferably to the antagonists, including a salt, solvate or isomer (tautomer, desmotrop, and optically active isomer) thereof, to a pharmaceutical composition containing the ligand, to the use of the ligand, to its preparation,... 20060211690 - Microglia inhibitors for interrupting interleukin 12 and ifngamma-mediated immune reactions: The invention describes the use of microglia inhibitors for the production of pharmaceutical agents that inhibit immune reactions that are mediated by monocytes, macrophages and T cells, and their use for treating T-cell-mediated immunological diseases and non-T-cell-mediated inflammation reactions.... 20060211691 - Use of 2h-[1,3]-oxazino[3,2-a] indole derivatives for the treatment of neuropathic pain: Use of a compound of formula (I), wherein R is H, a linear or branched alkyl chain having from 1 to 12 carbon atoms or an arylalkyl group, and of the acid addition salts thereof with pharmaceutically acceptable organic or inorganic acids, to prepare a pharmaceutical composition active in the... 20060211692 - Method for the production of pyrrolidine-1,2-dicarboxylic acid-1-(phenyl(-amide))-2-(phenyl(-amide)) derivatives and 1-(phenylcarbamoyl)-pyrrolidine-2-carboxylic acid derivatives as intermediate products: Process for the preparation of compounds of the formula I in which R, R1, R2 and R3 are as defined in Patent claim 1, and compounds of the formula IV in which R and R1 are as defined in Patent claim 1, are intermediates for the preparation of the compounds... 20060211693 - Cis-imidazolines: o 20060211694 - Diaryl substituted pyridinones: and pharmaceutically acceptable salts thereof, wherein R1, R2, R3, R4, and R5 are defined herein. These compounds are useful for treating diseases and conditions caused or exacerbated by unregulated p38 MAP Kinase and/or TNF activity. Pharmaceutical compositions containing the compounds, methods of preparing the compounds and methods of treatment using... 20060211695 - Fused heterocyclic kinase inhibitors: d 20060211696 - Imidazo[1,2-b]pyridazine compound: Wherein R1 denotes a hydrogen atom, a C1-6 alkyl group, a C1-6 alkoxy group and the like; R2 denotes a halogen atom, a cyano group, a nitro group, a C1-10 alkyl group, a C2-10 alkenyl group, C2-10 alkynyl group and the like; R3 denotes a C6-14 aromatic hydrocarbon cyclic group... 20060211697 - 2-(2 or 4-substituted aryloxy)-phenol derivatives as antibacterial agents: Antimicrobial compounds, compositions and methods of treatment administering same, of 2-aryloxyphenol derivatives having a heterocyclic or polar functional substitution attached through a N—C or C—C bond at the position para or ortho relative to oxygen bridge on non-phenolic phenyl ring, as well as methods for their preparation and formation, wherein... 20060211698 - Bicyclic heteroaryl derivatives for treating viruses: Disclosed are compounds having formula I and related compositions and methods thereof. The compounds are useful for treating viral infections caused by the Flaviviridae family of viruses.... 20060211699 - Quinoxaline dihydrohalide dihydrates and synthetic methods therefor: Crystalline polymorph forms of Gonadotropin Releasing Hormone receptor antagonists, including crystalline polymorphs of quinoxaline dihydrohalide dihydrates, in particular crystalline polymorphs of 6-({4-[2-(4-tert-butylphenyl)-1H-benzimidazol-4-yl]-piperazin-1-yl}methyl)-quinoxaline dihydrochloride dihydrate, methods of making the same, as well as pharmaceutical compositions, and dosage forms containing them are disclosed.... 20060211700 - (r)-8,9-dichloro-2,3,4,4a-tetrahydro-1h,6h-pyrazino[1,2-a]quinoxalin-5-one for controlling iop and treating glaucoma: Compositions and methods for controlling intraocular pressure and treating glaucoma using (R)-8,9-dichloro-2,3,4,4a-tetrahydro-1H,6H-pyrazino[1,2-a]quinoxalin-5-one are disclosed.... 20060211702 - Pyrido pyrimidinones, dihydro pyrimido pyrimidinones and pteridinones useful as raf kinase inhibitors: n, R1, R2, R3, R4, L1, L2, Y and Z are as defined in classes and subclasses herein, and pharmaceutical compositions thereof, as described generally and in subclasses herein, which compounds are useful as inhibitors of protein kinase (e.g., RAF), and thus are useful, for example, for the treatment of... 20060211701 - Use of von tetrahydrobiopterine derivatives in the treatment and nutrition of patients with amino acid metabolic disorders: The use of tetrahydrobiopterine and the derivatives thereof in the production of a medicament to improve protein tolerance for the treatment of diseases arising from an amino acid metabolic disorder, e.g. hyperphenylalaninemia. The invention also relates to a composition which contains tetrahydrobiopterine or derivatives thereof in addition to a special... 20060211703 - Substituted alkyl-pyridazinones for the treatment of memory and learning malfunctions: The compounds of the general Formula I, wherein R1 stands for hydrogen or lower alkyl; one of symbols X and Y stands for hydrogen or halogen and the other represents a group of the general Formula II, R2 is hydrogen or lower alkyl; n is 1, 2 or 3; R3... 20060211704 - 2,4-disubstituted thiazolyl derivatives: wherein X and Y each independently are O, NR3, CH2 or S, with R3 being hydrogen or C1-4alkyl; q is 1 to 4; Z is O or NR4 with R4 being hydrogen or C1-4alkyl; r is 1 to 3; L is optionally substituted phenyl or L is Het with Het... 20060211705 - 'n-(2-chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyethyl)-1-piperazinyl]-2-methyl-4-pyrimidinyl]amino]-5-thiazolecarboxamides metabolites: The present invention is directed to metabolites of ′N-(2-Chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyethyl)-1-piperazinyl]-2-methyl-4-pyrimidinyl]amino]-5-thiazolecarboxamide, the compound of formula (I), pharmaceutical compositions thereof, and to methods of using the metabolites and the pharmaceutical compositions in the treatment of oncological and immunological disorders.... 20060211706 - Farnesyl protein transferase inhibitors and methods for treating proliferative diseases: e 20060211707 - Piperazine-alkyl-ureido derivatives: The invention relates to novel piperazine derivatives and related compounds and their use as active ingredients in the preparation of pharmaceutical compositions. The invention also concerns related aspects including processes for the preparation of the compounds, pharmaceutical compositions containing one or more of those compounds and especially their use as... 20060211708 - Ziprasidone free from colored impurities and a process for its preparation: Ziprasidone base or a pharmaceutically acceptable salt thereof free from colored impurities, in particular those giving the product a “slightly pink to pink” coloration.... 20060211709 - Protein kinase modulators and methods of use: Substituted aryl 1,4-pyrazine derivatives and their use in treating anxiety disorders, depression and stress related disorders are disclosed.... 20060211710 - Substituted aryl 1,4-pyrazine derivatives: The invention is directed to compounds of Formula I, described herein, as well as pharmaceutically acceptable salts thereof, which act as CRF1 antagonists and are useful in the treatment of disorders and diseases associated with CRF1 receptors, including CNS-related disorders and diseases.... 20060211711 - 7-(alkinylamino)-triazolopyrimidines, methods for the production and use thereof to combat harmful fungi and agents containing said compounds: 7-alkinylamino-triazolopyrimidins of formula (I), wherein the substituents have the following meanings: L=halogen, alkyl, halogenalkyl, alkoxy, amino, NHR, NR2, cyano, S(O)nA1 or C(O)A2; R=alkyl or alkylcarbonyl, A1=hydrogen, hydroxy, alkyl, alkylamino or aialkylamino; n=0, 1 or 2; A2=alkenyl, alkoxy, halogenalkoxy or one of the groups cited in A1; m=1, 2, 3, 4... 20060211712 - Bicyclic anilide spirohydantoin cgrp receptor antagonists: that are antagonists of CGRP receptors and that are useful in the treatment or prevention of diseases in which the CGRP is involved, such as headache, migraine and cluster headache. The invention is also directed to pharmaceutical compositions comprising these compounds and the use of these compounds and compositions in... 20060211713 - Compounds having selective hydrolytic potentials: Disclosed are compounds having selective hydrolytic potential. The disclosed compounds are useful as compounds having selective stability and are capable of undergoing programmed hydrolysis in biologic systems.... 20060211714 - Quinazoline derivatives and their use in the treatment of cancer: The invention concerns quinazoline derivatives of the formula: (I); wherein X1, Q1, Z, R1, R2, Y, a and m are as defined in the description, which are erbB tyrosine kinase inhibitors, particularly EGFR tyrosine kinase inhibitors. Also claimed are processes for their preparation; pharmaceutical compositions containing them; and their use... 20060211717 - Quinoline and quinazoline derivatives and drugs containing the same: wherein R1 and R2 represent hydrogen, alkyl or the like; R3, R4, R5, and R6 represent hydrogen, halogen, alkyl, alkoxy or the like; R11 and R12 represent hydrogen, alkyl, alkylcarbonyl or the like; and A represents any one of formulae (i) to (x), provided that compounds wherein R3, R4, R5... 20060211716 - (3,4-dihydro-quinazolin-2-yl)-aryl-amines: e 20060211715 - Quinazoline protein tyrosine phosphatase inhibitors: wherein X is an unsubstituted or substituted phenyl, or is an unsubstituted or substituted 5 or 6 membered heteroaromatic ring. The compounds of the present invention are potent inhibitors of PTP1B. Accordingly, the invention also encompasses pharmaceutical compositions and methods of treating or preventing PTP-1B mediated diseases, including diabetes, obesity,... 20060211718 - Deazaflavin compounds and methods of use thereof: The present invention features 5-deazaflavin compounds, pharmaceutical compositions of 5-deazaflavin compounds and methods of treating a patient suffering from cancer, the method comprising administering to a patient one or more 5-deazaflavin compounds of the invention.... 20060211719 - Heteroaryl aminoguanidine and alkoxyguanidines and their use as protease inhibitors: wherein X is O or NR9 and Het, R1, R7, R8, R12-R15, Ra, Rb, Rc, Z, and n are set forth in the specification, as well as hydrates, solvates or pharmaceutically acceptable salts thereof, that inhibit proteolytic enzymes such as thrombin. Also described are methods for preparing such compounds. The... 20060211720 - Heterocyclic compounds as inhibitors of factor viia: The present invention relates generally to compounds that inhibit serine proteases. In particular it is directed to novel heterocyclic compounds, or a stereoisomer or pharmaceutically acceptable salt, solvate, or prodrug form thereof, which are useful as selective inhibitors of serine protease enzymes of the coagulation cascade; for example thrombin, factor... 20060211721 - Nutraceutical formulation of a cognitive enhancement system: A nutraceutical composition and method of use thereof includes core ingredients, huperzine A, dimethylaminoethanol (DMAE), thiamin, niacin, and pantothenic acid. The core ingredients provide a synergistic effect to improve and support cognitive function, such as learning, thinking, and judging and to promote alertness, awareness, attention and mental clarity. Combinations of... 20060211722 - Amino cyclobutylamide modulators of chemokine receptor activity: The present invention is directed to compounds of the formulas I and II: wherein R1, R2, R3, R4, R5, R6, R7, R8, R9, R10, R15, R16, R17, R18, R19, R25, R26, Y, Z, l, m, n and the broken lines are as defined herein which are useful as modulators of... 20060211723 - Aporphine and oxoaporphine compounds and pharmaceutical use thereof: The invention provides aporphine and oxoaporphine compounds that may be used to manufacture a medicaments for preventing or treating vascular dysfunctions that may result in ischemic and metabolic diseases or preventing complications associated with these diseases in human and mammal. The ischemic diseases may include ischemic cerebral apoplexy, ischemic cerebral... 20060211726 - Ascomycin derivatives for combination treatment with tazorotene: A method is disclosed herein comprising administering a therapeutically effective amount of an ascomycin derivative topically in combination with tazarotene, wherein said method is effective in reducing adverse events associated with tazarotene. A method is also disclosed herein comprising administering a therapeutically effective amount of an ascomycin derivative topically in... 20060211724 - Hiv integrase inhibitors: The present invention concerns the compounds having the formula (1), N-oxides, salts, stereoisomeric forms, racemic mixtures, prodrugs, esters and metabolites thereof wherein (a) or (b); A, together with the two carbons of the phenyl ring to which it is attached forms a monocyclic aryl or a monocyclic Het2; R1 is... 20060211725 - Use: This invention relates to a new use of a compound of the following formula (I) or (II) for the manufacture of a medicament for preventing and/or treating chronic rejection in a transplanted organ or tissue.... 20060211727 - Novel compounds: Novel substituted 1,5,7-trisubstituted-1,8-napthyridin-2(1H)-one compounds; 1,5,7 trisubstituted-1,6-napthyridine-2-(1H)-one compounds and 1,5,7-trisubstituted quinoline-2(1H)-one compounds, processes for the preparation thereof, the use thereof in treating CSBP/p38 kinase mediated diseases and pharmaceutical compositions for use in such therapy.... 20060211728 - Thalidomide analogs: Thalidomide analogs that modulate tumor necrosis factor alpha (TNF-α) activity and angiogenesis are disclosed. In particularly disclosed embodiments, the thalidomide analogs are isosteric sulfur-containing analogs. Also disclosed are methods of treating a subject with the analogs.... 20060211729 - Combination of anticholinergics and leukotriene receptor antagonists for the treatment of respiratory diseases: Pharmaceutical compositions comprising an anticholinergic and at least one leukotriene inhibitor for treatment of respiratory diseases, including allergic rhinitis, bronchial asthma, COPD and common cold, and methods of treatment.... 20060211730 - Beta-sulfonamide hydroxamic acid inhibitors of tace/matrix metalloproteinase: that are useful in treating diseases or disorders mediated by TNF-α, such as arthritis (rheumatoid arthritis (RA), juvenile RA, psoriatic arthritis, osteoarthritis etc), tumor metastasis, tissue ulceration, abnormal wound healing, periodontal disease, bone disease, diabetes (insulin resistance) and HIV infection, ankylosing spondylitis, psoriasis, sepsis, multiple sclerosis, Crohn's disease, degenerative cartilage... 20060211731 - New substituted pyridine or piperidine compounds: a 20060211732 - Hydroxamic acid derivatives as antibacterials: A method for the treatment of bacterial infections in humans and non-human mammals, which comprises inhibiting bacterial growth by administering to a subject an antibacterially effective dose of a compound of formula (I) or a pharmaceutically or veterinarily acceptable salt thereof:... 20060211733 - Methods of preventing and treating opioid bowel dysfunction: Methods of preventing and treating opioid bowel dysfunction are disclosed. In addition, methods of increasing the frequency of spontaneous complete bowel movements, methods for improving the quality of life of a patient suffering from opioid bowel dysfunction, methods for reducing a patient's dependence on laxatives, and methods for preventing or... 20060211734 - (piperidinyloxy)phenyl, (piperidinyloxy)pyridinyl, (piperidinylsulfanyl)phenyl and (piperidinylsulfanyl)pyridinyl compounds as 5-ht1f agonists: The present invention relates to compounds of formula 1: and pharmaceutically acceptable acid addition sails thereof. The compounds of the present invention are useful for activating 5-HT1F receptors, inhibiting neuronal protein extravasation, and for the treatment or preverition of migraine in mammals, particularly humans.... 20060211735 - 4-arylsulphonylpiperidine derivatives for antagonism of the 5-ht2a receptor: Compounds of formula (I): are selective antagonists of the 5-HT2A receptor, and hence are useful in treatment of adverse conditions at the central nervous system, such as sleep disorders and schizophrenia.... 20060211736 - Glutarimide-containing polyketide analogs and methods thereof: The present invention provides library of glutarimide-containing polyketide analogs, such as analogs of migrastatin, iso-migrastatin, dorrigocin A and B, epi-dorrigocin, NK30424 A and B and lactimidomycin, methods of synthesizing and using these analogs and further methods of creating a combinatorial library of these compounds through chemical modifications.... 20060211737 - Benzene, pyridine, and pyridazine derivatives: wherein R1, R2, R3, R4, R5, R6, R7, n, Q1, Q2, Q3, Y, and X1-X4 are as defined herein. Compounds of Formula I are useful in the treatment of diseases and/or conditions related to cell proliferation, such as cancer, inflammation, arthritis, angiogenesis, or the like. Also disclosed are pharmaceutical compositions... 20060211738 - Certain substituted diphenyl ureas, as modulators of kinase activity: Certain chemical entities chosen from compounds of Formula 1 and pharmaceutically acceptable salts, solvates, crystal forms, chelates, non-covalent complexes, prodrugs, and mixtures thereof, are provided herein. Pharmaceutical compositions comprising at least one chemical entity and one or more pharmaceutically acceptable vehicle chosen from carriers, adjuvants, and excipients, are also provided... 20060211739 - Use of selective p2x7 receptor antagonists: r 20060211740 - Novel compounds: The present invention relates to novel hydroxyethylamine compounds having Asp2 (β-secretase, BACE1 or Memapsin) inhibitory activity, processes for their preparation, to compositions containing them and to their use in the treatment of diseases characterised by elevated β-amyloid levels or β-amyloid deposits, particularly Alzheimer's disease.... 20060211741 - Substituted sulfonylaminoarylmethyl cyclopropanecarboxamide as vr1 receptor antagonists: e 20060211742 - Amorphous lercanidipine hydrochloride and uses thereof: The invention provides a substantially pure amorphous lercanidipine hydrochloride having a purity of at least 95% pure, preferably at least about 97% pure, more preferably at least about 99% pure, and still more preferably at least about 99.5% pure. The invention further relates to methods of preparing substantially pure amorphous... 20060211743 - 3-pyridinecarboxamide reduces nerve degeneration: Neural degeneration is reduced in a patient determined to be suffering from chronic neurodegeneration by administering to the patient an effective amount of 3-pyridinecarboxamide (nicotinamide) and detecting a resultant decrease in the neural degeneration.... 20060211744 - 3-pyridinecarboxamide reduces nerve degeneration: Neural degeneration is reduced in a patient determined to be suffering from chronic neurodegeneration by administering to the patient an effective amount of 3-pyridinecarboxamide (nicotinamide) and detecting a resultant decrease in the neural degeneration.... 20060211745 - Methods and compositions for treating cancer: In one aspect the present invention provides methods for treating cancer in a mammal, including the step of administering to a mammal suffering from a cancer an amount of ebselen that is sufficient to inhibit the growth of the cancer. In another aspect, the present invention provides methods for enhancing... 20060211746 - Desferrithiocin derivatives and methods of use thereof: 20060211747 - Methods of screening for compounds which inhibit the activity of cdc34 in a zinc-mediated manner and compounds obtained by this method: The present invention relates to methods of searching/screening for compounds which inhibit the activity of the ubiquitin conjugating enzyme Cdc34 in a zinc-mediated manner, to compounds obtainable by such a method, to a method of treating mammalian subjects with such compounds, to pharmaceutical compositions containing such compounds, to the use... 20060211748 - Sulphydryl compounds in combination with sulpha compounds: The present invention discloses various compositions and methods for co-administration of one or more sulfa compounds or pharmaceutically acceptable salts thereof, and one or more sulphydryl compounds in the treatment or prevention of disease, wherein the disease has in whole or part microbial and/or inflammatory origins.... 20060211749 - Treatment with omega-3 fatty acids and ppar agonist and/or antagonist and a combination product thereof: A method and composition for blood lipid therapy that comprises administering to the subject an effective amount of a PPAR agonist and/or antagonist and an omega-3 fatty acid. The methods and compositions include combination products or concomitant therapy for the treatment of subjects with hypertriglyceridemia, hypercholesteremia, mixed dyslipidemia, vascular disease,... 20060211750 - Triazole derivatives: m 20060211751 - Zolmitriptan crystal forms: The invention encompasses novel crystalline forms of zolmitriptan herein defined as Form B, D, C, E, F, G, H, I, J, K, M, N, O, P, Q, R, S, or Amorphous and to methods of making thereof. The invention also encompasses methods of making zolmitriptan crystalline Form A.... 20060211752 - Use of phenylmethimazoles, methimazole derivatives, and tautomeric cyclic thiones for the treatment of autoimmune/inflammatory diseases associated with toll-like receptor overexpression: The present invention relates to the treatment of autoimmune and/or inflammatory diseases associated with overexpression of Toll-like receptor 3 (TLR3) as well as Toll-like receptor 4 (TLR4) and/or TLR3/TLR4 signaling in nonimmune cells, monocytes, macrophages, and/or dendritic cells in association with related pathologies. This invention also relates to the use... 20060211753 - Method and composition which reduces stimulation of muscles which dilate the eye: A method for optimizing pupil size in individuals suffering from excessive pupillary dilation in dim light as well as through medication is disclosed. Alpha 1 antagonist is applied in an eye drop formulation to the eye, resulting in reduced pupil size in dim light, but less reduction in pupil size... 20060211754 - Compositions comprising n-propanoyl derivatives of amino acids, aminocarbohydrates and derivatives thereof: The embodiments relate to compositions comprising therapeutically effective amounts of at least one N-propanoyl derivative of amino acids, aminocarbohydrates, and derivatives thereof. The compositions are useful the prevention and treatment of symptoms or syndromes associated with nervous, vascular, musculoskeletal, or cutaneous systems. The compositions may be topically or systemically administered... 20060211755 - 3-oxo-1, 3-dihydro-indazole-2-carboxylic acid amide derivatives as phospholipase inhibitors: The present invention provides a compound of formula I (1) wherein; R, is selected from the group consisting of C5-C13alkyl; C,—C,2haloalkyl, C4C,2alkenyl, C4-C12alkynyl, or C,—C5alkylcycloalkyl, C3-C8cycloalkyl, C, C5alkylheterocyclic, and aryl, wherein the, cycloalkyl, cycloalkenyl, heterocyclic and aryl substituents are optionally substituted with one to three substituents independently selected from C,—C8a)kyl,... 20060211756 - Novel heterocycle derivatives useful as selective androgen receptor modulators (sarms): The present invention is directed to novel heterocycle derivatives, pharmaceutical compositions containing them and their use in the treatment of disorders and conditions modulated by the androgen receptor.... 20060211757 - Small molecule inhibitors of mdm2 and the uses thereof: The invention relates to small molecules which function as inhibitors of the interaction between p53 and MDM2. The invention also relates to the use of these compounds for inhibiting cell growth, inducing cell death, inducing cell cycle arrest and/or sensitizing cells to additional agent(s).... 20060211758 - M3 muscarinic acetylcholine receptor antagonists: Novel thiazole aniline compounds, pharmaceutical compositions, methods of making them and uses thereof in treating M3 muscarinic acetylcholine receptor mediated diseases are disclosed.... 20060211759 - Bis-heterocyclic compounds with antitumour and chemosensitising activity: Bis-heterocyclic compounds of general formula (I) are described which are useful as antitumour and chemosensitising agents.... 20060211760 - Indolamide derivatives which possess glycogen phosphorylase inhibitory activity: A compound of the formula (1) or a pharmaceutically-acceptable salt wherein, for example, A is phenylene or heteroarylene; Y is selected from —C(O)R2, —C(O)OR2, —C(O)NR2R3, -(1-4C)alkyl [optionally substituted]-(2-4C)alkenyl, —SO2NR2R3, and —S(O)cR2 (wherein c is 0, 1 or 2); compounds which possess glycogen phosphorylase inhibitory activity and accordingly have value in... 20060211761 - Hmg-coa-reductase inhibitors: The invention relates to particular hydroxyl and protected hydroxyl derivatives of compounds known to be useful as HMG CoA-reductase inhibitors. In particular, herein are provided hydroxyl and protected hydroxyl compounds of Formula I and their corresponding lactones.... 20060211762 - Omega-3 fatty acids and dyslipidemic agent for lipid therapy: A method and composition for blood lipid therapy by administering to the subject an effective amount of a dyslipidemic agent and omega-3 fatty acids. The method utilizes a single administration or a unit dosage of a combination of dyslipidemic agent and omega-3 fatty acids for the treatment of patients with... 20060211763 - Treatment with statin and omega-3 fatty acids and a combination product thereof: A pharmaceutical composition in unit dose form, comprising an essentially homogeneous solution comprising a statin essentially dissolved in solvent system comprising natural or synthetic omega-3 fatty acids or pharmaceutically acceptable esters, derivatives, conjugates, precursors or salts thereof, or mixtures thereof, wherein less than 10% of the statin is undissolved in... 20060211764 - Cell activator, process for producing cell activator and apparatus therefor: It is determined whether phase noise and parasitic oscillation take place on the basis of a carrier-to-noise (C/N) ratio calculated with amplitudes in an amplitude direction of signal points of a reception signal and a C/N ratio calculated with amplitudes in a phase direction of the signal points of the... 20060211765 - Novel compounds: The invention relates to substituted phenoxyacetic acids (I) as useful pharmaceutical compounds for treating respiratory disorders, pharmaceutical compositions containing them, and processes for their preparation.... 20060211766 - Gelled immunomodulating topical compositions and a method of treating warts and other human papilloma virus skin infections: Topical drug compositions of this invention contain delayed type contact sensitizing haptens in a unique non-flowable, non-toxic, non-volatile, anhydrous gel composition to achieve retained site application on warts and other human papilloma virus (HPV) skin infections. The preferred gelled compositions contain, but are not limited to, the sensitizing haptens, squaric... 20060211767 - Method of combating turf pests with a combination of imidacloprid and bifenthrin: This invention relates to a method of controlling surface insect pests of turf using bifenthrin and imidacloprid.... 20060211768 - Means for the modulation of processes mediated by retinoid receptors and compounds useful therefor: In accordance with the present invention, there are provided methods to modulate processes mediated by retinoid receptors, employing high affinity, high specificity ligands for such receptors. In one aspect of the present invention, there are provided ligands which are more selective for the retinoid X receptor than is retinoic acid... 20060211769 - Methods for inhibiting angiogenesis and tumor growth: wherein G1 and G2 are each independently —NH—C(O)—O—(CH2)v—(C6H4)—X3; Y1 and Y2 are each independently —OH or C1-C4 alkoxy; X1 and X2 are each independently halo or C1-C4 alkoxy; X3 is fluoro, nitro, C1-C4 alkyl, C1-C4 alkoxy, or C1-C4 perfluoroalkyl; Z is —C≡C—, —C6H4—, cis —CH═CH—, trans —CH═CH—, cis —CH2—CH═CH—CH2—, trans... 20060211770 - Enhanced bimatoprost ophthalmic solution: A composition comprising from 0.005% to 0.02% bimatoprost by weight and from 100 ppm to 250 ppm benzalkonium chloride, wherein said composition is an aqueous liquid which is formulated for ophthalmic administration is disclosed herein. A method which is useful in treating glaucoma or ocular hypertension related thereto is also... 20060211771 - Phenyl benzamides: c 20060211772 - Processes for the preparation of atomoxetine hydrochloride: The present invention provides improved processes for the preparation of atomoxetine hydrochloride under reaction conditions that improve reaction yields and facilitate commercial synthesis. In particular, the invention is directed to the synthesis of atomoxetine HCl by adding HCl to a mixture of (R)-(−)-tomoxetine (S)-(+)-mandelate with an organic solvent, with or... 20060211773 - Polyamine-metal chelator conjugates: Many metal collators have polar or charged functional groups, which render them difficult to transport across a cell membrane. Polyimide-metal collator conjugates of the invention are compounds comprising a first moiety which is a metal collator and a second moiety which is a polyimide, where the polyimide moiety includes three... 20060211774 - Method of diagnosins a genetic susceptibility for bone damage: The present invention relates to the identification of a novel nucleotide polymorphism in the inhibin beta-A (INHBA) gene and the exploitation of this nucleotide polymorphism in the diagnosis of susceptibility to bone damage, particularly fracture. Also provided are transgenic non-human animals comprising the polynucleotides of the present invention and methods... 09/14/2006 > 194 patent applications in 119 patent subcategories.20060205633 - Therapeutic agent for diabetes: A pharmaceutical composition herein provided comprises at least one branched chain amino acid selected from the group consisting of isoleucine, leucine and valine, combined with at least one drug selected from the group consisting of anti-diabetic agents, agents for treating or preventing obesity and agents for treating or preventing diabetic... 20060205634 - Lactoferrin in the reduction of circulating cholesterol, vascular inflammation, atherosclerosis and cardiovascular disease: The present invention relates to methods of using lactoferrin (LF) to reduce circulating levels of cholesterol and vascular inflammation, in order to treat, prevent or reduce the incidence of atherosclerosis and cardiovascular disease.... 20060205635 - Antigene oligomers inhibit transcription: Transcription of a gene in a mammalian cell is methylase-independently inhibited by contacting the cell with a nucleic acid oligomer of 12-28 bases complementary for a partially single-stranded target genomic sequence of the gene.... 20060205637 - Fluoro-alkyl-cyclopeptide derivatives having anti-integrin activity: Compounds of formula (I) cyclo [NX1-R1-CO—NX2-R2-CO—NX3-R3-CO—NX4-CO—NX5-R5-CO], wherein at least one x-fluoroalkylated amino acid is present, are inhibitors of integrins, particularly those belonging to the alphavbeta3 and alphavbeta5 family, and thus are useful as medicaments, particularly for the treatment of the underlying diseases responsible for abnormal angiogenesis, such as retinopathy, acute... 20060205636 - Oxytocin as cardiomyogenesis inducer and uses thereof: The invention relates to oxytocin and oxytocin-related compounds and functional derivatives thereof, and uses thereof to induce differentiation of a non-cardiomyocyte (e.g. a stem/progenitor cell) to a cardiomyocyte. The invention further relates to the methods of prevention or treatment of conditions characterized by or associated with a cardiomyocyte loss or... 20060205638 - Process for preparing macrocyclic compounds: e 20060205639 - Pro-nanodispersion for the delivery of cyclosporin: A novel cyclosporine formulation, which is a pro-nanodispersion at room temperature, featuring solid particles of a relatively large particle size (at least about 150 nm) and yet which is a nanodispersion at body temperature.... 20060205662 - Combination treatment with t-pa variant and low molecular weight heparin: The invention concerns an improved therapeutic regimen for the treatment of thrombolytic disorders, such as acute myocardial infarction (AMI). In particular, the present invention concerns the treatment of thrombolytic disorders, e.g., AMI, with a combination of a tissue plasminogen activator (t-PA) variant having improved fibrin specificity and extended plasma half-life... 20060205652 - Formulations and methods for delivery of growth factor analogs: Formulations, kits and methods for bone or cartilage repair, including treatment of osteogenic defects, including formulations of synthetic heparin-binding growth factor analogs, non-ionic polymers, gelling agents and calcium-containing agents.... 20060205659 - Fumaric acid amides: wherein R1 represents OR3 or a D- or L-amino acid radical —NH—CHR4—COOH bonded via an amide bond, wherein R3 is hydrogen, a straight-chained or branched, optionally substituted C1-24 alkyl radical, a phenyl radical or C6-10 aralkyl radical and R4 is a side chain of a natural or synthetic amino acid... 20060205657 - Irrigation solution and method for inhibition of pain and inflammation: A method and solution for perioperatively inhibiting a variety of pain and inflammation processes at wounds from general surgical procedures including oral/dental procedures. The solution preferably includes at least one pharmacological agent that is a class I cytokine soluble receptor, and optionally additional multiple pain and inflammation inhibitory agents at... 20060205658 - Irrigation solution and method for inhibition of pain and inflammation: A method and solution for perioperatively inhibiting a variety of pain and inflammation processes at wounds from general surgical procedures including oral/dental procedures. The solution preferably includes at least one pharmacological agent that is an interleukin-1 (IL-1) soluble receptor, and optionally additional multiple pain and inflammation inhibitory agents at dilute... 20060205648 - Liquid, aqueous pharmaceutical compositions of factor vii polypeptides: The present invention is directed to liquid, aqueous pharmaceutical compositions stabilised against chemical and/or physical degradation containing Factor VII polypeptides, and methods for preparing and using such compositions, as well as vials containing such compositions, and the use of such compositions in the treatment of a Factor VII-responsive syndrome. The... 20060205649 - Metabolic-based methods for modulating gene expression: This invention provides methods for modulating cellular gene expression for genes operably linked to an NRSE element that is recognized by an NRSF transcriptional repressor, by changing the concentration of reduced nicotinamide adenine dinucleotide (NADH) in the cell.... 20060205651 - Method of treating cancer: The invention relates to a method of treating cancer in an individual in need thereof including inhibiting tumour growth and metastasis. The invention also relates to a method of suppressing or preventing formation of metastases, or inhibiting the growth of metastases, particularly bone metastases, from primary tumours.... 20060205646 - Methods for increasing cell and tissue viability: The present invention features methods of increasing cell or tissue viability by administering to the cell or tissue a protective protein. The invention also features methods of treating a condition characterized by cell or tissue damage in a subject by administering to the subject a protective protein. Also included are... 20060205644 - Methods of treating neurological diseases by regulating migration of neuroblasts in the adult nervous system with tenascin-r: This invention provides a method for regulating migration of neuronal progenitor cells in the nervous system of a mammal. The method comprises providing a mammal with TNR, a biologically active fragment of TNR, or a TNR agonist in an amount sufficient to direct migration of the neuronal progenitor cells. The... 20060205661 - Novel albumin-free factor viii formulations: A Factor VIII composition formulated without albumin, comprising the following formulation excipients in addition to Factor VIII: 4% to 10% of a bulking agent selected from the group consisting of mannitol, glycine and alanine; 1% to 4% of a stabilizing agent selected from the group consisting of sucrose, trehalose, raffinose,... 20060205654 - Novel human growth factors: The present invention relates to huXAG-1, huXAG-2 and huXAG-3 proteins which are novel human growth factors. In particular, isolated nucleic acid molecules are provided encoding the huXAG-1, huXAG-2 and huXAG-3 proteins. huXAG-1, huXAG-2 and huXAG-3 polypeptides are also provided as are vectors, host cells and recombinant methods for producing the... 20060205655 - Nucleic acids encoding (poly) peptides having chips activity: The invention relates to nucleic acid molecules encoding (poly)peptides having chemotaxis inhibiting (poly)peptides CHIPS activity, to recombinant vectors harboring such molecules, and the host cells carrying the vectors. The invention further relates to methods for preparing recombinant (poly)peptides having CHIPS activity and to the use of such recombinant (poly)peptides having... 20060205660 - Ob protein-immunoglobulin chimeras: The present invention concerns long-half derivative of the obesity protein OB. The invention specifically concerns OB protein-immunoglobulin chimeras and polyethylene glycol (PEG)-OB derivatives, which have extended half-life as compared to the corresponding native OB proteins. The invention further relates to methods for appetite and/or weight reducion and for treating other... 20060205642 - Oral methods of treatment using proanf peptides: A method of treatment of hypertension, congestive heart failure, pulmonary edema, nephrotic syndrome, acute and chronic renal failure, toxemia of pregnancy, hepatic cirrhosis, and/or hyperkalemia. Humans or other mammals are administered an effective amount of peptide(s) consisting of amino acids 1-30 (proANF 1-30), amino acids 31-67 (proANF 31-67) and amino... 20060205656 - P-superfamily conopeptides: The present invention is directed to P-superfamily conopeptides, to DNA encoding precursors of the P-superfamily conopeptides and to the precursor peptides.... 20060205640 - Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism: A antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows: GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its fragments and a polypeptide, as well as transformed host organisms capable of producing the peptide such as microorganisms, animal cells, digital cells and plants,... 20060205647 - Somatostatin and somatostatin agonists for decreasing body weight: The present invention relates to a method of decreasing body weight in a patient. The method includes the step of administering a therapeutically effective amount of a somatostatin or a somatostatin agonist ot said patient. A pharmaceutical/cosmetic composition comprises the somatostatin or somatostatin agonist. Such products are used to prepare... 20060205653 - Sources for, and types of, insecticidally active proteins, and polynucleotides that encode the proteins: The subject invention provides exciting new sources for surprising, new types of toxin complex (“TC”) proteins. The subject invention includes these new classes and types of TC proteins. The subject invention also includes polynucleotides that encode the subject proteins. The subject invention further provides vectors and cells comprising these polynucleotides.... 20060205643 - Treatment of inflammatory conditions of the intestine: A method for the treatment and/or prophylaxis of an inflammatory condition of the intestine of a patient, comprises parenteral administration to the patient of an effective amount of high density lipoprotein (HDL)... 20060205650 - Treatment of neuropsychiatric disease with protease and neuraminidase inhibitors: The present invention provides a method of treating a neuropsychiatric disease characterized by an abnormally elevated level of a fragment of an isoform of a neural cell adhesion molecule, N-CAM, in the brain or cerebrospinal fluid of an affected human subject, comprising administering a therapeutically effective amount of at least... 20060205645 - Use of hypoxia inducible factor 2 alpha for curing neonatal respiratory distress syndrome and as a target for the treatment of pulmonary hypertension: The current invention relates to the field of hypoxia-induced disorders and more specifically to the use of hypoxia inducible factor 2α as a target in a method for the screening for molecules that can be used for the treatment of pulmonary hypertension. The invention further relates to the use of... 20060205641 - Vanilrep4 polypeptides and vanilrep4 polynucleotides: VANILREP4 polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques are disclosed. Also disclosed are methods for utilizing VANILREP4 polypeptides and polynucleotides in diagnostic assays.... 20060205665 - Intracellular delivery of biological effectors: The invention relates to a sequence of amino acids with the capacity to facilitate transport of an effector across a biological membrane. More specifically, the present invention relates to novel peptide transporters that specifically target certain cell types for the intracellular delivery of drugs and therapeutic agents.... 20060205663 - Methods to produce lung surfactant formulations via lyophilization and formulations and uses thereof: Methods of producing lung surfactant formulations through solvent dissolution and lyophilization are described as well as surfactant formulations derived therefrom. Methods of treating respiratory distress dysfunction are also provided.... 20060205664 - Mucin hypersecretion inhibitors and methods of use: Peptides are provided that comprise less than 24 amino acids. The peptides have an amino acid sequence selected from the group consisting of: (a) an amino acid sequence having from 4 to 23 contiguous amino acids of a reference sequence PEPTIDE 1; (b) an amino acid sequence substantially identical to... 20060205666 - Gamma-secretase inhibitors: Disclosed, as a γ-secretase inhibitor, is a compound consisting of an amino acid sequence which consists of at least three consecutive amino acids of the amino acid sequence Val-Val-Ile-Ala-Thr-Val-Ile-Val-Ile-Thr-Leu-Val-Met-Leu-Lys-Lys including Leu at position 11, wherein, between the Leu and one or both amino acids located immediately before or after it,... 20060205667 - Wt1 substitution pepides: Novel substituted type peptides of WT1 wherein the cysteine residue is substituted with a defined amino acid residue, polynucleotides encoding said peptides, cancer vaccines using those peptides or polynucleotides in vivo or in vitro, or the like are provided. Peptides which comprise an amino acid sequence of the formula: X—Y-Thr-Trp-Asn-Gln-Met-Asn-Leu... 20060205670 - Anti-angiogenic compounds: The present invention provides AA targeting compounds which comprise AA targeting agent-linker conjugates which are linked to a combining site of an antibody. Various uses of the compounds are provided, including methods to treat disorders connected to abnormal angiogenesis.... 20060205668 - Central nervous system damage: The application provides peptides that interact with the inhibitory domains of the myelin proteins Nogo, TNR, and MAG. These may be used in the treatment of CNS damage, and for the development of further treatments. Also provided are methods and materials for immunizing subjects against the inhibitory domains of the... 20060205669 - G-type peptides and other agents to ameliorate atherosclerosis and other pathologies: This invention provides novel peptides, and other agents, that ameliorate one or more symptoms of atherosclerosis and/or other pathologies characterized by an inflammatory response. In certain embodiment, the peptides resemble a G* amphipathic helix of apolipoprotein J. The peptides are highly stable and readily administered via an oral route.... 20060205673 - 2-amino-3-hydroxy-4-tert-leucyl-amino-5-phenyl-pentanoic acid amide derivatives: i 20060205671 - Compositions and methods for use of a protease inhibitor and adenosine for preventing organ ischemia and reperfusion injury: Methods and compositions in |