| Antiviral agents for the treatment, control and prevention of infections by coronaviruses -> Monitor Keywords |
|
|
 
Antiviral agents for the treatment, control and prevention of infections by coronavirusesRelated Patent Categories: Drug, Bio-affecting And Body Treating Compositions, Designated Organic Active Ingredient Containing (doai), Peptide Containing (e.g., Protein, Peptones, Fibrinogen, Etc.) Doai, Cyclopeptides, 25 Or More Peptide Repeating Units In Known Peptide Chain StructureAntiviral agents for the treatment, control and prevention of infections by coronaviruses description/claimsThe Patent Description & Claims data below is from USPTO Patent Application 20070185027, Antiviral agents for the treatment, control and prevention of infections by coronaviruses. Brief Patent Description - Full Patent Description - Patent Application Claims
[0001] This is a continuation of prior application Ser. No. 10/833,304, filed Apr. 28, 2004, which claims priority to 60/466,432, filed Apr. 30, 2003 and 60/465,782 filed Apr. 28, 2003, the entireties of which are hereby incorporated by reference. BACKGROUND [0002] Severe Acute Respiratory Syndrome (SARS) is an emerging new infectious disease caused by a novel coronavirus that infects humans. See Ksiazek et al., New Engl. J Med. (http://content.nejm.org/cgi/reprint/NEJMoa030781v2.pdf, published Apr. 10, 2003). SARS is fatal in about 4-10% of cases reported so far. Initially described in mid February, 2003 in China's Guangdong province as atypical pneumonia, by mid-March, 2003 the World Health Organization (WHO) had received reports of more than 150 new suspected cases of unknown origin or cause. By mid April, 2003, over 4400 cases with 263 deaths of patients diagnosed with symptoms of SARS have been documented from 26 different countries, including Canada, China, Hong Kong, Indonesia, Philippines, Singapore, Thailand, Viet Nam and the United States. In light of the rapid spread of SARS to several countries in a short period of time, the World Health Organization issued a global alert and provided emergency guidance for travellers and airlines. In only a few months after the outbreak was first recognized, SARS became a worldwide threat to global health and global economies. There are presently no known therapies that are effective against SARS, and no vaccine is available. Accordingly, there is an urgent need for antiviral agents that can control or prevent SARS in infected individuals, and that can prevent SARS from spreading. [0003] In general, SARS begins with a fever greater than 100.4.degree. F. [>38.0.degree. C.]. Other symptoms may include headache, an overall feeling of discomfort, and body aches. Some people also experience mild respiratory symptoms. After 2 to 7 days, SARS patients may develop a dry cough and have trouble breathing. [0004] The primary way that SARS appears to spread is by close person-to-person contact. Most cases of SARS have involved people who cared for or lived with someone with SARS, or had direct contact with infectious material (for example, respiratory secretions) from a person who has SARS. Potential ways in which SARS can be spread include touching the skin of other people or objects that are contaminated with infectious droplets followed by touching of eye(s), nose, or mouth. This can happen when someone who is sick with SARS coughs or sneezes droplets onto themselves, other people, or nearby surfaces. It also is possible that SARS can be spread more broadly through the air or by other ways that are currently not known. [0005] Scientists at the Centers for Disease Control and Prevention (CDC) and other laboratories around the world have detected a previously unrecognized coronavirus in patients with SARS. The evidence for a coronavirus was based on genetic fingerprint and electron microscopic ultrastructural studies and was widely reported in the popular press. Viologists at the CDC, WHO and numerous academic laboratories all reported that a coronavirus is the leading hypothesis for the cause of SARS. [0006] The CDC recently reported sequencing the genome for SARS-CoV (Urbani strain), a strain of a novel human coronavirus believed to be responsible for SARS. The sequence data confirm that the SARS virus is a previously unrecognized coronavirus. The virus was cultured from cells taken from a throat culture taken from a SARS patients and grown in Vero cells (African green monkey kidney cells) in order to reproduce the ribonucleic acid (RNA) of the disease-causing coronavirus. The new sequence has 29,727 nucleotides, which places it well within the typical RNA boundaries for coronaviruses. Members of this viral family tend to have between 29,000 and 31,000 nucleotides. See Lai et al., Adv. Virus Res. 48:1, (1997). The genome organization of the SARS virus also is similar to that of other coronaviruses. [0007] The genome sequence of SARS-CoV (Urbani) is available from GenBank at the Web site for the National Center for Biotechnology Information, National Library of Medicine httfp://www.ncbi.nlm.nih.gov/. The accession number for the sequence of SARS-CoV (Urbani strain) is ay278741. The present inventors have used these sequence data to identify molecular targets that can be exploited to design safe and effective novel antiviral therapies that can be used to treat SARS and to stem the tide of the growing epidemic. SUMMARY OF THE INVENTION [0008] In accordance with a first aspect of the invention there is provided an antiviral peptide having between 7 and 50 amino acids, where the peptide exhibits antiviral activity against a coronavirus, and where the peptide contains a sequence comprising at least 7 contiguous amino acids from one of the following sequences: TABLE-US-00001 (SEQ ID NO: 1) DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK; (SEQ ID NO: 2) QIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLT; (SEQ ID NO: 3) ESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISS; (SEQ ID NO: 4) GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAE; and (SEQ ID NO: 5) RLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDF. [0009] In accordance with a second aspect of the invention there is provided an antiviral peptide having between 7 and 50 amino acids, where the peptide exhibits antiviral activity against a coronavirus, and where the peptide contains a sequence comprising at least 7 contiguous amino acids from the sequence: TABLE-US-00002 (SEQ ID NO: 1) DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK;; [0010] where the amino acids at bold letter positions can be substituted with an amino acid selected from the group consisting of I, L, V, W, Y, F, N, Q, S, T, D, E, G, H, and M, and where amino acids in non-bold positions can be any amino acid except proline. [0011] The peptides above may contain a sequence selected from the group consisting of TABLE-US-00003 SVVNIQK VVNIQKE VNIQKEI (SEQ ID NO: 6) (SEQ ID NO: 7) (SEQ ID NO: 8) NIQKEID IQKEIDR QKEIDRL (SEQ ID NO: 9) (SEQ ID NO: 10) (SEQ ID NO: 11) KEIDRLN EIDRLNE IDRLNEV (SEQ ID NO: 12) (SEQ ID NO: 13) (SEQ ID NO: 14) DRLNEVA RLNEVAK LNEVAKN (SEQ ID NO: 15) (SEQ ID NO: 16) (SEQ ID NO: 17) NEVAKNL EVAKNLN VAKNLNE (SEQ ID NO: 18) (SEQ ID NO: 19) (SEQ ID NO: 20) AKNLNES KNLNESL NLNESLI (SEQ ID NO: 21) (SEQ ID NO: 22) (SEQ ID NO: 23) LNESLID NESLIDL ESLIDLQ (SEQ ID NO: 24) (SEQ ID NO: 25) (SEQ ID NO: 26) SLIDLQE LIDLQEL IDLQELG (SEQ ID NO: 27) (SEQ ID NO: 28) (SEQ ID NO: 29) DLQELGK LQELGKY QELGKYE (SEQ ID NO: 30) (SEQ ID NO: 31) (SEQ ID NO: 32) ELGKYEQ LGKYEQY GKYEQYI (SEQ ID NO: 33) (SEQ ID NO: 34) (SEQ ID NO: 35) KYEQYIK QIPFAMQ IPFAMQM (SEQ ID NO: 36) (SEQ ID NO: 37) (SEQ ID NO: 38) PFAMQMA FAMQMAY AMQMAYR (SEQ ID NO: 39) (SEQ ID NO: 40) (SEQ ID NO: 41) MQMAYRF QMAYRFN MAYRFNG (SEQ ID NO: 42) (SEQ ID NO: 43) (SEQ ID NO: 44) AYRFNGI YRFNGIG RFNGIGV (SEQ ID NO: 45) (SEQ ID NO: 46) (SEQ ID NO: 47) FNGIGVT NGIGVTQ IGVTQNV (SEQ ID NO: 48) (SEQ ID NO: 49) (SEQ ID NO: 50) GVTQNVL VTQNVLY TQNVLYE (SEQ ID NO: 51) (SEQ ID NO: 52) (SEQ ID NO: 53) QNVLYEN NVLYENQ VLYENQK (SEQ ID NO: 54) (SEQ ID NO: 55) (SEQ ID NO: 56) LYENQKQ YENQKQI ENQKQIA (SEQ ID NO: 57) (SEQ ID NO: 58) (SEQ ID NO: 59) NQKQIAN QKQIANQ KQIANQF (SEQ ID NO: 60) (SEQ ID NO: 61) (SEQ ID NO: 62) QIANQFN IANQFNK ANQFNKA (SEQ ID NO: 63) (SEQ ID NO: 64) (SEQ ID NO: 65) NQFNKAI QFNKAIS FNKAISQ (SEQ ID NO: 66) (SEQ ID NO: 67) (SEQ ID NO: 68) NKAISQI KAISQIQ AISQIQE (SEQ ID NO: 69) (SEQ ID NO: 70) (SEQ ID NO: 71) ISQIQES SQIQESL QIQESLT (SEQ ID NO: 72) (SEQ ID NO: 73) (SEQ ID NO: 74) ESLTTTS SLTTTST LTTTSTA (SEQ ID NO: 75) (SEQ ID NO: 76) (SEQ ID NO: 77) TTTSTAL TTSTALG TSTALGK (SEQ ID NO: 78) (SEQ ID NO: 79) (SEQ ID NO: 80) STALGKL TALGKLQ ALGKLQD (SEQ ID NO: 81) (SEQ ID NO: 82) (SEQ ID NO: 83) LGKLQDV GKLQDVV KLQDVVN (SEQ ID NO: 84) (SEQ ID NO: 85) (SEQ ID NO: 86) LQDVVNQ QDVVNQN DVVNQNA (SEQ ID NO: 87) (SEQ ID NO: 88) (SEQ ID NO: 89) VVNQNAQ VNQNAQA NQNAQAL (SEQ ID NO: 90) (SEQ ID NO: 91) (SEQ ID NO: 92) QNAQALN NAQALNT AQALNTL (SEQ ID NO: 93) (SEQ ID NO: 94) (SEQ ID NO: 95) QALNTLV ALNTLVK LNTLVKQ (SEQ ID NO: 96) (SEQ ID NO: 97) (SEQ ID NO: 98) NTLVKQL TLVKQLS LVKQLSS (SEQ ID NO: 99) (SEQ ID NO: 100) (SEQ ID NO: 101) VKQLSSN KQLSSNF QLSSNFG (SEQ ID NO: 102) (SEQ ID NO: 103) (SEQ ID NO: 104) LSSNFGA SSNFGAI SNFGAIS (SEQ ID NO: 105) (SEQ ID NO: 106) (SEQ ID NO: 107) NFGAISS LQDVVNQ QDVVNQN (SEQ ID NO: 108) (SEQ ID NO: 109) (SEQ ID NO: 110) DVVNQNA VVNQNAQ VNQNAQA (SEQ ID NO: 111) (SEQ ID NO: 112) (SEQ ID NO: 113) NQNAQAL QNAQALN NAQALNT (SEQ ID NO: 114) (SEQ ID NO: 115) (SEQ ID NO: 116) AQALNTL QALNTLV ALNTLVK (SEQ ID NO: 117) (SEQ ID NO: 118) (SEQ ID NO: 119) LNTLVKQ NTLVKQL TLVKQLS (SEQ ID NO: 120) (SEQ ID NO: 121) (SEQ ID NO: 122) LVKQLSS VKQLSSN KQLSSNF (SEQ ID NO: 123) (SEQ ID NO: 124) (SEQ ID NO: 125) QLSSNFG LSSNFGA SSNFGAI (SEQ ID NO: 126) (SEQ ID NO: 127) (SEQ ID NO: 128) SNFGAIS NFGAISS FGAISSV (SEQ ID NO: 129) (SEQ ID NO: 130) (SEQ ID NO: 131) GAISSVL AISSVLN ISSVLND (SEQ ID NO: 132) (SEQ ID NO: 133) (SEQ ID NO: 134) SSVLNDI SVLNDIL VLNDILS (SEQ ID NO: 135) (SEQ ID NO: 136) (SEQ ID NO: 137) LNDILSR NDILSRL DILSRLD (SEQ ID NO: 138) (SEQ ID NO: 139) (SEQ ID NO: 140) ILSRLDK LSRLDK SRLDKV (SEQ ID NO: 141) (SEQ ID NO: 142) (SEQ ID NO: 143) RLDKVE LDKVEA, RLITGRL (SEQ ID NO: 144) (SEQ ID NO: 145) (SEQ ID NO: 146) LITGRLQ ITGRLQS TGRLQSL (SEQ ID NO: 147) (SEQ ID NO: 148) (SEQ ID NO: 149) GRLQSLQ RLQSLQT LQSLQTY (SEQ ID NO: 150) (SEQ ID NO: 151) (SEQ ID NO: 152) QSLQTYV SLQTYVT LQTYVTQ (SEQ ID NO: 153) (SEQ ID NO: 154) (SEQ ID NO: 155) QTYVTQQ TYVTQQL YVTQQLI (SEQ ID NO: 156) (SEQ ID NO: 157) (SEQ ID NO: 158) VTQQLIR TQQLIRA QQLIRAA (SEQ ID NO: 159) (SEQ ID NO: 160) (SEQ ID NO: 161) QLIRAAE LIRAAE IRAAEIR (SEQ ID NO: 162) (SEQ ID NO: 163) (SEQ ID NO: 164) RAAEIRA AAEIRAS AEIRASA (SEQ ID NO: 165) (SEQ ID NO: 166) (SEQ ID NO: 167) EIRASAN IRASANL RASANLA (SEQ ID NO: 168) (SEQ ID NO: 169) (SEQ ID NO: 170) ASANLAA SANLAAT ANLAATK (SEQ ID NO: 171) (SEQ ID NO: 172) (SEQ ID NO: 173) NLAATKM LAATKMS AATKMSE (SEQ ID NO: 174) (SEQ ID NO: 175) (SEQ ID NO: 176) ATKMSEC TKMSECV KMSECVL and (SEQ ID NO: 177) (SEQ ID NO: 178) (SEQ ID NO: 179) MSECVLG. (SEQ ID NO: 180). [0012] The peptide may contain at least 10, 15, 20, 25, 30, 35, or 40 contiguous amino acids from one of the sequences: TABLE-US-00004 (SEQ ID NO: 181) VVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK; (SEQ ID NO: 2) QIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLT; (SEQ ID NO: 3) ESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISS; (SEQ ID NO: 4) GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAE; and (SEQ ID NO: 5) RLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDF. [0013] Any of the peptides above may be linked to a carrier protein, such as human serum albumin, for example. [0014] In accordance with a third aspect of the invention there is provided an antiviral composition comprising a peptide X having between 7 and 50 amino acids, where the peptide exhibits antiviral activity against a coronavirus, and where the composition has the structure:B-X-Z, [0015] where B is an amino acid sequence containing up to about 43 amino acids, or B is an amino group, an acetyl group, a 9-fluorenylmethoxy-carbonyl group, a hydrophobic group, or a macromolecule carrier group, or B is a carrier protein, in which case B may contain more than 8 amino acids, and may also comprises a linker peptide sequence that connects the antiviral sequence to the carrier protein;.Z is an amino acid sequence containing up to about 43 amino acids, or Z comprises a carboxyl group, an amido group, a hydrophobic group, or a macromolecular carrier group, or Z is a carrier protein, such as HSA, in which case Z may contain more than 8 amino acids, and may also comprise a linker peptide sequence that connects the antiviral sequence to the carrier protein; where when considered together B and Z must contain at least 8 amino acids between the B and Z groups; and where X is a peptide sequence comprising at least 7 contiguous amino acids from one of the following sequences: TABLE-US-00005 (SEQ ID NO: 181) VVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK; (SEQ ID NO: 2) QIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLT; (SEQ ID NO: 3) ESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISS; (SEQ ID NO: 4) GKLQDVVNQNAQALNTLYKQLSSNFGAISSVLNDILSRLDKVEAE; and (SEQ ID NO: 5) RLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDF. [0016] X may contain, for example, at least 10, 15, 20, 25, 30, 35, or 40 contiguous amino acids from one of the following sequences: TABLE-US-00006 (SEQ ID NO: 181) VVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK; (SEQ ID NO: 2) QIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLT; (SEQ ID NO: 3) ESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISS; (SEQ ID NO: 4) GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAE; and (SEQ ID NO: 5) RLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDF. [0017] In accordance with a fourth aspect of the invention there is provided an antiviral peptide having between 7 and 50 amino acids, where the peptide exhibits antiviral activity against a coronavirus, and where the peptide comprises a sequence that exhibits identity in any two of the seven positions of a contiguous heptapeptide, where the contiguous heptapeptide comprises 7 contiguous amino acids from one of the following sequences: TABLE-US-00007 (SEQ ID NO: 181) VVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK; (SEQ ID NO: 2) QIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLT; (SEQ ID NO: 3) ESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISS; (SEQ ID NO: 4) GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAE; and (SEQ ID NO: 5) RLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDF. [0018] The sequence identity may be located, for example, in the ith and i+4th positions in the contiguous heptapeptides. [0019] In accordance with another aspect of the invention there is provided a pharmaceutical composition comprising a peptide or composition as described above and a pharmaceutically acceptable diluent, adjuvant and/or excipient. [0020] In accordance with yet another aspect of the invention there is provided a method of treating or preventing a coronavirus infection in a subject, comprising administering to a patient suspected of suffering from the infection an effective amount of a peptide or composition as described above. The subject may be a human, a cow, pig, or chicken. [0021] Other objects, features and advantages of the present invention will become apparent from the following detailed description. It should be understood, however, that the detailed description and the specific examples, while indicating preferred embodiments of the invention, are given by way of illustration only, since various changes and modifications within the spirit and scope of the invention will become apparent to those skilled in the art from this detailed description. BRIEF DESCRIPTION OF THE DRAWINGS Continue reading about Antiviral agents for the treatment, control and prevention of infections by coronaviruses... Full patent description for Antiviral agents for the treatment, control and prevention of infections by coronaviruses Brief Patent Description - Full Patent Description - Patent Application Claims Click on the above for other options relating to this Antiviral agents for the treatment, control and prevention of infections by coronaviruses patent application. ###  How KEYWORD MONITOR works... a FREE service from FreshPatents1. Sign up (takes 30 seconds). 2. Fill in the keywords to be monitored. 3. Each week you receive an email with patent applications related to your keywords. Start now! - Receive info on patent apps like Antiviral agents for the treatment, control and prevention of infections by coronaviruses or other areas of interest. ### Previous Patent Application: Antiproliferative peptides and antibodies for their detection Next Patent Application: Compositions and methods for the treatment of immune related diseases Industry Class: Drug, bio-affecting and body treating compositions ### FreshPatents.com Support Thank you for viewing the Antiviral agents for the treatment, control and prevention of infections by coronaviruses patent info. IP-related news and info Results in 0.0873 seconds Other interesting Feshpatents.com categories: Tyco , Unilever , Warner-lambert , 3m 174 |
 * Protect your Inventions * US Patent Office filing 
PATENT INFO |
|
